Metagenome Family F058574

Basic Information
Family ID	F058574
Family Type	Metagenome
Number of Sequences	134
Average Sequence Length	39 residues
Representative Sequence	MDRRLKNRSVHDRLGKRVVDQNWADYEEEGDEEEYVW
Number of Associated Samples	65
Number of Associated Scaffolds	134

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	29.77 %
% of genes near scaffold ends (potentially truncated)	35.07 %
% of genes from short scaffolds (< 2000 bps)	97.01 %
Associated GOLD sequencing projects	65
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.23

Most Common Taxonomy
Group	Unclassified (57.463 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (91.045 % of family members)
Environment Ontology (ENVO)	Unclassified (91.045 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (91.045 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 47.69% β-sheet: 0.00% Coil/Unstructured: 52.31%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 134 Family Scaffolds
PF13650	Asp_protease_2	1.49

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
All Organisms	root	All Organisms	42.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
cellular organisms	root	All Organisms → cellular organisms	42.54 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	39.55 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	39.55 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	39.55 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	39.55 %
Aeromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	39.55 %
Aeromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	39.55 %
Aeromonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	39.55 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	39.55 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	39.55 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	39.55 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	29.10 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	10.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	29.10 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	10.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	29.10 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	10.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	29.10 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	10.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
malvids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids	29.10 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	10.45 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Malvales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales	29.10 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	9.70 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Malvaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae	29.10 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	9.70 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Malvoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae	29.10 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	8.21 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Gossypium	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium	29.10 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	8.21 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.49 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	29.10 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	5.97 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.75 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	29.10 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	5.97 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.75 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	29.10 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.99 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.75 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.75 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.75 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	57.46 %
Gossypium australe	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	29.10 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	2.99 %
Aeromonas jandaei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	2.99 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.75 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.75 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	0.75 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300013296\|Ga0157374_11519995	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	693	Open in IMG/M
3300013296\|Ga0157374_12447143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	549	Open in IMG/M
3300013296\|Ga0157374_12779458	Not Available	517	Open in IMG/M
3300013297\|Ga0157378_11769819	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	666	Open in IMG/M
3300013297\|Ga0157378_11958204	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	635	Open in IMG/M
3300013297\|Ga0157378_11962799	Not Available	635	Open in IMG/M
3300013297\|Ga0157378_12539837	Not Available	564	Open in IMG/M
3300013297\|Ga0157378_13060710	Not Available	519	Open in IMG/M
3300014745\|Ga0157377_11013185	Not Available	630	Open in IMG/M
3300015267\|Ga0182122_1046175	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	572	Open in IMG/M
3300015267\|Ga0182122_1061468	Not Available	527	Open in IMG/M
3300015268\|Ga0182154_1062981	Not Available	526	Open in IMG/M
3300015269\|Ga0182113_1086117	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	522	Open in IMG/M
3300015274\|Ga0182188_1052393	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	527	Open in IMG/M
3300015275\|Ga0182172_1017968	Not Available	753	Open in IMG/M
3300015276\|Ga0182170_1038678	Not Available	616	Open in IMG/M
3300015276\|Ga0182170_1065315	Not Available	529	Open in IMG/M
3300015277\|Ga0182128_1048385	Not Available	582	Open in IMG/M
3300015279\|Ga0182174_1048274	Not Available	598	Open in IMG/M
3300015281\|Ga0182160_1039787	Not Available	624	Open in IMG/M
3300015282\|Ga0182124_1025538	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	699	Open in IMG/M
3300015282\|Ga0182124_1050077	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	583	Open in IMG/M
3300015282\|Ga0182124_1067354	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	534	Open in IMG/M
3300015283\|Ga0182156_1040814	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	630	Open in IMG/M
3300015283\|Ga0182156_1070145	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	538	Open in IMG/M
3300015283\|Ga0182156_1080205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	517	Open in IMG/M
3300015285\|Ga0182186_1063828	Not Available	544	Open in IMG/M
3300015286\|Ga0182176_1041409	Not Available	633	Open in IMG/M
3300015286\|Ga0182176_1066855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	545	Open in IMG/M
3300015287\|Ga0182171_1016044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	813	Open in IMG/M
3300015287\|Ga0182171_1018290	Not Available	784	Open in IMG/M
3300015288\|Ga0182173_1031497	Not Available	672	Open in IMG/M
3300015288\|Ga0182173_1056455	Not Available	571	Open in IMG/M
3300015289\|Ga0182138_1024379	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	729	Open in IMG/M
3300015292\|Ga0182141_1030990	Not Available	696	Open in IMG/M
3300015294\|Ga0182126_1023178	Not Available	759	Open in IMG/M
3300015294\|Ga0182126_1053552	Not Available	599	Open in IMG/M
3300015294\|Ga0182126_1075069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	542	Open in IMG/M
3300015294\|Ga0182126_1077939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	536	Open in IMG/M
3300015295\|Ga0182175_1092791	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	512	Open in IMG/M
3300015296\|Ga0182157_1054707	Not Available	610	Open in IMG/M
3300015298\|Ga0182106_1036879	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	684	Open in IMG/M
3300015298\|Ga0182106_1071811	Not Available	562	Open in IMG/M
3300015298\|Ga0182106_1080942	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	542	Open in IMG/M
3300015298\|Ga0182106_1098485	Not Available	509	Open in IMG/M
3300015299\|Ga0182107_1046272	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	644	Open in IMG/M
3300015299\|Ga0182107_1100244	Not Available	509	Open in IMG/M
3300015300\|Ga0182108_1035228	Not Available	702	Open in IMG/M
3300015300\|Ga0182108_1070471	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	572	Open in IMG/M
3300015302\|Ga0182143_1024686	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	767	Open in IMG/M
3300015302\|Ga0182143_1052141	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	622	Open in IMG/M
3300015302\|Ga0182143_1068211	Not Available	574	Open in IMG/M
3300015302\|Ga0182143_1084580	Not Available	537	Open in IMG/M
3300015303\|Ga0182123_1082260	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	531	Open in IMG/M
3300015303\|Ga0182123_1087224	Not Available	522	Open in IMG/M
3300015303\|Ga0182123_1099113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	502	Open in IMG/M
3300015305\|Ga0182158_1010512	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	967	Open in IMG/M
3300015305\|Ga0182158_1011488	Not Available	943	Open in IMG/M
3300015305\|Ga0182158_1050883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	625	Open in IMG/M
3300015305\|Ga0182158_1056196	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	607	Open in IMG/M
3300015307\|Ga0182144_1022366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	802	Open in IMG/M
3300015307\|Ga0182144_1044463	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	659	Open in IMG/M
3300015314\|Ga0182140_1050801	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	648	Open in IMG/M
3300015314\|Ga0182140_1059110	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	620	Open in IMG/M
3300015314\|Ga0182140_1098703	Not Available	529	Open in IMG/M
3300015314\|Ga0182140_1099271	Not Available	528	Open in IMG/M
3300015321\|Ga0182127_1094072	Not Available	551	Open in IMG/M
3300015323\|Ga0182129_1046134	Not Available	664	Open in IMG/M
3300015341\|Ga0182187_1130167	Not Available	589	Open in IMG/M
3300015341\|Ga0182187_1133919	Not Available	583	Open in IMG/M
3300015341\|Ga0182187_1200821	Not Available	501	Open in IMG/M
3300015343\|Ga0182155_1218243	Not Available	508	Open in IMG/M
3300015344\|Ga0182189_1106422	Not Available	670	Open in IMG/M
3300015344\|Ga0182189_1164213	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	571	Open in IMG/M
3300015345\|Ga0182111_1051550	Not Available	899	Open in IMG/M
3300015345\|Ga0182111_1112396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	678	Open in IMG/M
3300015345\|Ga0182111_1189287	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	556	Open in IMG/M
3300015346\|Ga0182139_1071820	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	800	Open in IMG/M
3300015346\|Ga0182139_1115359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	672	Open in IMG/M
3300015346\|Ga0182139_1158161	Not Available	597	Open in IMG/M
3300015346\|Ga0182139_1194836	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	550	Open in IMG/M
3300015351\|Ga0182161_1050876	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	954	Open in IMG/M
3300015351\|Ga0182161_1138358	Not Available	654	Open in IMG/M
3300015351\|Ga0182161_1140970	Not Available	649	Open in IMG/M
3300015351\|Ga0182161_1160354	Not Available	617	Open in IMG/M
3300015351\|Ga0182161_1255440	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	512	Open in IMG/M
3300015355\|Ga0182159_1088446	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	902	Open in IMG/M
3300015355\|Ga0182159_1243867	Not Available	590	Open in IMG/M
3300015361\|Ga0182145_1042589	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	830	Open in IMG/M
3300017404\|Ga0182203_1001055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	2138	Open in IMG/M
3300017404\|Ga0182203_1069624	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	664	Open in IMG/M
3300017404\|Ga0182203_1132462	Not Available	540	Open in IMG/M
3300017404\|Ga0182203_1147538	Not Available	520	Open in IMG/M
3300017407\|Ga0182220_1033541	Not Available	696	Open in IMG/M
3300017409\|Ga0182204_1047835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	664	Open in IMG/M
3300017409\|Ga0182204_1099192	Not Available	533	Open in IMG/M
3300017410\|Ga0182207_1080069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	656	Open in IMG/M
3300017410\|Ga0182207_1159391	Not Available	520	Open in IMG/M
3300017411\|Ga0182208_1053937	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Aeromonadales → Aeromonadaceae → Aeromonas → Aeromonas jandaei	660	Open in IMG/M
3300017413\|Ga0182222_1043794	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	637	Open in IMG/M
3300017413\|Ga0182222_1080830	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	543	Open in IMG/M
3300017415\|Ga0182202_1046763	Not Available	710	Open in IMG/M
3300017415\|Ga0182202_1076072	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	611	Open in IMG/M
3300017415\|Ga0182202_1076183	Not Available	611	Open in IMG/M
3300017415\|Ga0182202_1111739	Not Available	541	Open in IMG/M
3300017417\|Ga0182230_1090742	Not Available	559	Open in IMG/M
3300017417\|Ga0182230_1116574	Not Available	502	Open in IMG/M
3300017420\|Ga0182228_1103185	Not Available	546	Open in IMG/M
3300017420\|Ga0182228_1114636	Not Available	525	Open in IMG/M
3300017420\|Ga0182228_1125281	Not Available	508	Open in IMG/M
3300017424\|Ga0182219_1009656	Not Available	1189	Open in IMG/M
3300017424\|Ga0182219_1083087	Not Available	593	Open in IMG/M
3300017424\|Ga0182219_1091878	Not Available	575	Open in IMG/M
3300017424\|Ga0182219_1093756	Not Available	571	Open in IMG/M
3300017425\|Ga0182224_1062963	Not Available	684	Open in IMG/M
3300017430\|Ga0182192_1040027	Not Available	829	Open in IMG/M
3300017430\|Ga0182192_1160947	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	516	Open in IMG/M
3300017438\|Ga0182191_1184909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	500	Open in IMG/M
3300017442\|Ga0182221_1129113	Not Available	549	Open in IMG/M
3300017443\|Ga0182193_1152858	Not Available	550	Open in IMG/M
3300017680\|Ga0182233_1072843	Not Available	618	Open in IMG/M
3300017680\|Ga0182233_1112297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	510	Open in IMG/M
3300017681\|Ga0182226_1120646	Not Available	502	Open in IMG/M
3300017683\|Ga0182218_1092511	Not Available	589	Open in IMG/M
3300017684\|Ga0182225_1031012	Not Available	810	Open in IMG/M
3300017684\|Ga0182225_1146348	Not Available	500	Open in IMG/M
3300017685\|Ga0182227_1041356	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	807	Open in IMG/M
3300017686\|Ga0182205_1052749	Not Available	743	Open in IMG/M
3300017690\|Ga0182223_1091398	Not Available	548	Open in IMG/M
3300025926\|Ga0207659_11471454	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Malvoideae → Gossypium → Gossypium australe	583	Open in IMG/M
3300025940\|Ga0207691_11715535	Not Available	508	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	91.04%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.96%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	91.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.46%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.49%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	91.04%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.46%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.49%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	91.04%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	7.46%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.49%

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0157374_115199951	3300013296	Miscanthus Rhizosphere	RRLKNKSVHNRLGKRVVDQDWANYEEEGNEKGYVW*
Ga0157374_124471431	3300013296	Miscanthus Rhizosphere	MDWRLKNKSVHDQLGERVIDPNWTDYEEESNEEGYIW*
Ga0157374_127794581	3300013296	Miscanthus Rhizosphere	MDRRLKNKNVHNRLGKRVVDQNWANYEEEDSEEEYVWQEEQW
Ga0157378_117698191	3300013297	Miscanthus Rhizosphere	VDQRLKNRSIHDRLRKQVVDQNWIDYEEEDDEEYIW*
Ga0157378_119582041	3300013297	Miscanthus Rhizosphere	MDRRLKNKSIHDRLRKRVVDQDWAGHEEEGTERKYTWQEDQ
Ga0157378_119627991	3300013297	Miscanthus Rhizosphere	VSNIGSLGNNMDRRLKNRSVYDQLGKRVVDQNWADYEEGSNEEEYVW*
Ga0157378_125398372	3300013297	Miscanthus Rhizosphere	MDQRLKNRSVHGRLGKRVVDQNWADYEEERNEEEYVW*
Ga0157378_130607101	3300013297	Miscanthus Rhizosphere	QHNDVDRRLKNKSIHDRLRKRVVDQNWANYEEEDDEEYVW*
Ga0157377_110131852	3300014745	Miscanthus Rhizosphere	MDHRLKNRSVHDRLGKRVVDQNWADYEEKSDEEEYVW*
Ga0157377_113455401	3300014745	Miscanthus Rhizosphere	MDRRLKNRSVHDRHQKGVVDQNWVDYEEEGDEKEYVWQEGQ
Ga0182122_10461751	3300015267	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVVDQNWADYEEEDDEEEYVW*
Ga0182122_10614681	3300015267	Miscanthus Phyllosphere	DRIEYQHNDVDRRLKDRSIHDWLGKQVVDQNWADCEEEDDEEYVW*
Ga0182154_10629812	3300015268	Miscanthus Phyllosphere	MDRRLKNKSVHDWLGKRVVDLDWADHEEKGNERKYV*
Ga0182113_10861172	3300015269	Miscanthus Phyllosphere	DRRLKNKSIHDRLGERVVDQDWTDHEEGSNQREHV*
Ga0182188_10523931	3300015274	Miscanthus Phyllosphere	MDRRLKNRSVHDQLGKRVVDQNWADYEEEGDEEEY
Ga0182172_10179681	3300015275	Miscanthus Phyllosphere	DAYHHNNIDRRLKNGSVRNRLGKRAVDQDCADYEEEGNERKYIW*
Ga0182170_10386781	3300015276	Miscanthus Phyllosphere	VDRRLKNKSIHDRLGKRVVEQGWVDYEEEDDEEYVWQEG*
Ga0182170_10653152	3300015276	Miscanthus Phyllosphere	IIIWIRRLKNKSVHDRLGKRVVDQNWADYKEEDSEEEYVW*
Ga0182128_10483851	3300015277	Miscanthus Phyllosphere	MDRCLKNGSVPNQLGKMVVDQNWADYEEENNEEEYVWQEGYGVQEV*
Ga0182174_10482741	3300015279	Miscanthus Phyllosphere	MDRRLKNGSVHNWLGKRVVDQDWADYEEGNERKCVL*
Ga0182160_10397871	3300015281	Miscanthus Phyllosphere	IEYQHNDVDRRLKNRSIHDRLGKRVVDQNWANYEEEDDDERYVW*
Ga0182124_10255382	3300015282	Miscanthus Phyllosphere	MDRRLKNGSVHNRLGKRVVDQNWADYEEGSNEEKYIW*
Ga0182124_10500771	3300015282	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVVDQNWADYEEKDSEEEYVW*
Ga0182124_10673542	3300015282	Miscanthus Phyllosphere	MDRCLKNKSVHDQLGKRVVDQDWADYGEEDSEKEYVWQEG*
Ga0182156_10408142	3300015283	Miscanthus Phyllosphere	MDQRLKNTSVHDRLGKRVIDQNWADYEEESNEEEYVWQEG*
Ga0182156_10701451	3300015283	Miscanthus Phyllosphere	RRLKNKSVHDRLGERVIDQDWADHEEEGTERRYVWQESQ*
Ga0182156_10802052	3300015283	Miscanthus Phyllosphere	MDRRLKNGSVHNRLGKRVVDQNWADYEEDEEEEYVW*
Ga0182186_10638282	3300015285	Miscanthus Phyllosphere	MDQCLKNRSVHDRLGKRVVDQNWADYEKESNKEEYVWQEGQ*
Ga0182176_10414092	3300015286	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVVDQNWADYEEEGDEEEYVW*
Ga0182176_10668552	3300015286	Miscanthus Phyllosphere	RRLKNRSIYDRFGKRVVDQNWAYDEEEGAEEEYVWQKE*
Ga0182176_10825472	3300015286	Miscanthus Phyllosphere	LKNKSVHDRLGKPVVDKKWADYDEEDNEEVYVWQEG*
Ga0182171_10160442	3300015287	Miscanthus Phyllosphere	VDRRLKNRSIHDRLGKRVVDQNWAGYEEEDDEEYVWQE
Ga0182171_10182902	3300015287	Miscanthus Phyllosphere	VLKNRSVHDRLGKRVVDQNWADYEEEGDEEDYVWQEGK*
Ga0182173_10314972	3300015288	Miscanthus Phyllosphere	MDWHLKNRSIHDQLGKRVVDQNWADYEEKSNEEEYVW*
Ga0182173_10564552	3300015288	Miscanthus Phyllosphere	VDRRLKDRSIHDWLGKQVVDQNWADCEEEDDEEYVW*
Ga0182138_10243792	3300015289	Miscanthus Phyllosphere	MDRHLKNKSVHDRLGERVVDQDWDDYEEQGNEKEYVW*
Ga0182141_10309903	3300015292	Miscanthus Phyllosphere	MDRRLKSKSVHDRLGKRVVDQNWADYEEKDDEEKYVWQEGQW
Ga0182141_10605682	3300015292	Miscanthus Phyllosphere	DMDRRLKNKSVHDRLGKRVIDQGWADHEQESNKGGYIWQEG*
Ga0182126_10231781	3300015294	Miscanthus Phyllosphere	MDRYLKNRSVHDRLGKRVVDQNWADYEEDDEEEYVWQEGW*
Ga0182126_10535522	3300015294	Miscanthus Phyllosphere	MDRRLKNKSVHGRLGKRVVDQDWADCEEEGNERKYVWQEGQ*
Ga0182126_10750691	3300015294	Miscanthus Phyllosphere	MDQRLKNRSVHDRLGKRVVDQNWADYEEEGDEEEYIW*
Ga0182126_10779392	3300015294	Miscanthus Phyllosphere	VDRRLKNRSIHDRLGKRVVDQNWADYEEEDEEYVW*
Ga0182175_10927911	3300015295	Miscanthus Phyllosphere	MDRRLKNKSIHDRLRKRVVDQNWANYEEEDDEEYVW*
Ga0182157_10547072	3300015296	Miscanthus Phyllosphere	MDRRLKNKSIHDRLGKRVVDQDWADQEEGSNKKEYIWQEGQWC
Ga0182106_10368791	3300015298	Miscanthus Phyllosphere	MDQCLKNGSVHNRLEKRVVDQDWADYEEEGNERKYVW
Ga0182106_10718111	3300015298	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVVDQNWADYEEESNKEEYVWQKGQ*
Ga0182106_10809421	3300015298	Miscanthus Phyllosphere	MDRRLKTKSVHDWLGKRVVDQNWADYEEEDSEEEYVW*
Ga0182106_10984852	3300015298	Miscanthus Phyllosphere	DNIDRHLKNRSVHDRLGKRVVDQNWANYEEEGDDKEYV*
Ga0182107_10462722	3300015299	Miscanthus Phyllosphere	MDRRLKNRSVRDRLGKRVVDQNWVDYEEEVNEEEYVW*
Ga0182107_11002442	3300015299	Miscanthus Phyllosphere	MDQRLKNRSIHNRLGKRVVDQNWSDYEEKSKKEEYVW*
Ga0182108_10352282	3300015300	Miscanthus Phyllosphere	MDRRLKNKSVHDRLGKRVVDQDWADHEEEGTKRRYVWQEGQ
Ga0182108_10704712	3300015300	Miscanthus Phyllosphere	MDRRLKIRSVHDRLGKRVIDQNWADYEEEGDEKEYVW*
Ga0182143_10246861	3300015302	Miscanthus Phyllosphere	MDRRLKNGSVHDRLEKRVVDQNWADYESNEEECVWQGGQ*
Ga0182143_10521411	3300015302	Miscanthus Phyllosphere	MDQRLKNKSVHDRLGKRVVDQDWADHEEKSNERK*
Ga0182143_10682112	3300015302	Miscanthus Phyllosphere	VDRRLKNRSIHERLGKGVVDQNWVNYEEDDDEEYVWQEG
Ga0182143_10845801	3300015302	Miscanthus Phyllosphere	MDGRLKNKSIHDQLGKRVVDQDWANHEEESNQREYVWQEG
Ga0182123_10822601	3300015303	Miscanthus Phyllosphere	MDQRLKNKSVHDWLGKRVIDQDWADHEEEGTERRYVW*
Ga0182123_10872241	3300015303	Miscanthus Phyllosphere	VDWRLKNRSIHDWLGKRVVDQNWADYEKENDEDYV*
Ga0182123_10991132	3300015303	Miscanthus Phyllosphere	LALKNRSVHDRLGKRIIDQNWVDHEEESNEEEYVWQEGQ*
Ga0182158_10105121	3300015305	Miscanthus Phyllosphere	MDRRLKNRSVHDRLEKRVVDQNWADYEEESNKEEYVWQEGQ
Ga0182158_10114882	3300015305	Miscanthus Phyllosphere	MDQRLKNRSIYDRLGKRVVDQNWVEYEEEGDEEEHVW*
Ga0182158_10508832	3300015305	Miscanthus Phyllosphere	VDQRLKNRSIHDRLGKRIVDQKWADYEEEDDEEYVWQER*
Ga0182158_10561961	3300015305	Miscanthus Phyllosphere	MDWRLKNKSVHNRLGKLVVDQNWADYEEESNEEEYIW*
Ga0182144_10223662	3300015307	Miscanthus Phyllosphere	VLKNKSVHDRLGKRVVDQDWTDYEEEGNEKEYVWQEGQW
Ga0182144_10444631	3300015307	Miscanthus Phyllosphere	MDRRLKNKSIHDRLGKRVVDQDWADHEEESNKKEYIW*
Ga0182140_10508011	3300015314	Miscanthus Phyllosphere	MDRRLKNKSVHDWLGKRIVDQNWAVYEEGSNEEEYIWQEGQCV*
Ga0182140_10591101	3300015314	Miscanthus Phyllosphere	VDRRLKNRSIHDQLGKRVLDQNWADYEEEDEEEKYVCQE
Ga0182140_10987031	3300015314	Miscanthus Phyllosphere	MDRCLKNRSVHDRLWKRVIDQNWANYEEVGDEEEYDW*
Ga0182140_10992711	3300015314	Miscanthus Phyllosphere	MDQHLKNRSVHDRFGKRVVDQNWADNEEEDNEEENVWQ*
Ga0182127_10940722	3300015321	Miscanthus Phyllosphere	EYHYNNMDQRLKNRSVHDWLGKRVVDQNWADYEEESNEEEYVW*
Ga0182129_10461342	3300015323	Miscanthus Phyllosphere	MDWRLKNRSVQNRLGKRVVDQDWTDYEEEGNERKYVWQEGQ*
Ga0182187_11301671	3300015341	Miscanthus Phyllosphere	MDRRLNNRSVHDRLGKRVVDQNWVDYEKEDEEEKYVRQEGQ*
Ga0182187_11339192	3300015341	Miscanthus Phyllosphere	MDQQLKNRSVHDRLGKRVVDQNWVNYEEEGDEEEYVL*
Ga0182187_12008211	3300015341	Miscanthus Phyllosphere	MDRRLKNKSVHDRLGKQVVDQNWADYGEEGNEREYVWQEGQ*
Ga0182155_12182432	3300015343	Miscanthus Phyllosphere	MDRRLKNKSVHDWLGKRVVDQDWADYGEEGNEREYVWQKGQ*
Ga0182189_11064221	3300015344	Miscanthus Phyllosphere	VDRRLKNRSIHDRLGKRVVDQNWADYEEESNEGKYVWQEG*
Ga0182189_11642131	3300015344	Miscanthus Phyllosphere	HNNMDRRLKNKSVHDWLGKRVVDQDWDDYGEEGNKRKYVW*
Ga0182111_10515502	3300015345	Miscanthus Phyllosphere	MDRRLKIRSVHDRLGKRVVDQNWADYEEQGDEEEYVWQEG*
Ga0182111_11123962	3300015345	Miscanthus Phyllosphere	MDQHLKNKSIHNRLGKRVVDQDWVDYEEEGNKRKYIWQEG*
Ga0182111_11892872	3300015345	Miscanthus Phyllosphere	MDRRLKNGSVHNRLGKRVVDQNWADYEEESNEEEYIWQEGQ
Ga0182139_10718202	3300015346	Miscanthus Phyllosphere	LKNKSVHDRLGKRVVDQNWADHEERGSDRRYMWQEGQ*
Ga0182139_11153592	3300015346	Miscanthus Phyllosphere	MDRRLKNGSVHNRLGKRVVDQDWADYEEEGNERKHV*
Ga0182139_11581611	3300015346	Miscanthus Phyllosphere	MDRHLKNRSAHDRLGKRVVDQNWADYEEKDNEEEYVW
Ga0182139_11948362	3300015346	Miscanthus Phyllosphere	VDRRLKNRSIHDRLGKRVIDQNWADYEEEDDEEYVW*
Ga0182161_10508762	3300015351	Miscanthus Phyllosphere	MDRRLKNKSIHDWLGKRVVDQDWADHEEESNKKEYIW*
Ga0182161_11383581	3300015351	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVLDQNWADYEEEDNEEEYVWQEG*
Ga0182161_11409701	3300015351	Miscanthus Phyllosphere	MDRRLKNRSVHDWLGKRVVDQNWADYEKESNEKEYVWQEG*
Ga0182161_11603542	3300015351	Miscanthus Phyllosphere	MDRRLKNRSVHNWLRKRVIDKNWVDYEEEGDEEEYVW*
Ga0182161_12554401	3300015351	Miscanthus Phyllosphere	MDRRLKNGSIHNWLGKRVVDQDWADYEEGNKREYVW
Ga0182159_10884462	3300015355	Miscanthus Phyllosphere	MDRRLKNRSIYDRFGKRVVDQNWAYDEEEGAEEEYVWQKE*
Ga0182159_12438672	3300015355	Miscanthus Phyllosphere	MYRRLKNRSVHDRLGKRVVDQTWADYEEEGDEEEYVW*
Ga0182145_10425892	3300015361	Miscanthus Phyllosphere	MDRRLKNGSVHNRLGKRVVDQDWADYEEEGNEREYVWQE
Ga0182203_10010553	3300017404	Miscanthus Phyllosphere	NMDRRLKNGSVHNRLGKRVVDQDWADYKEEGNERK
Ga0182203_10696242	3300017404	Miscanthus Phyllosphere	MDRHLKNRSVHDWLGKRVVDQNWADHEEEDNEDEYVWQ
Ga0182203_11324621	3300017404	Miscanthus Phyllosphere	HHNMDRRLKNRSVHDRLGKRVVDQNWADYEEGNREEYIW
Ga0182203_11475382	3300017404	Miscanthus Phyllosphere	MDRCLKNRSVHDRLGKRVVDQNWADYEEEGNEEEYV
Ga0182220_10335412	3300017407	Miscanthus Phyllosphere	NMDRRLKNKSIHDRLGKRVVDQDWADHEEGSNKKEYIW
Ga0182204_10478352	3300017409	Miscanthus Phyllosphere	MDRRLKNKSVHDQLGKRVVDQDWADHEEEGTEKRYVR
Ga0182204_10991921	3300017409	Miscanthus Phyllosphere	QRLKNRSVHDRLGKRVVDQNWTNYEEEGTKEEYVW
Ga0182207_10800691	3300017410	Miscanthus Phyllosphere	MDRRLKNGSVHNRLGKRVVDQDWADYVEEGNEREYVW
Ga0182207_11593912	3300017410	Miscanthus Phyllosphere	TRDEYHHNMDRHLKNRSIHDRLRKRVVDQKWIDYEEESNEEEYVWQEG
Ga0182208_10539372	3300017411	Miscanthus Phyllosphere	VDRCLKNRSIHDQLGKRVVDQDWADYEEEDDEEYIW
Ga0182222_10437942	3300017413	Miscanthus Phyllosphere	MDQSLKNKSVHDRLRKRVVDQNWADYEEEDNKEEYVW
Ga0182222_10808302	3300017413	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVVDQNWANYEEKDDEEDYVWQE
Ga0182202_10467632	3300017415	Miscanthus Phyllosphere	MDRRLKNRSVQDRLGKCVVDQNWADYEEEGDKEEYV
Ga0182202_10760722	3300017415	Miscanthus Phyllosphere	MDRCLKNKSVHDRLGKRVVDQNWADYEEEDNEEEYIW
Ga0182202_10761832	3300017415	Miscanthus Phyllosphere	MDRRLKNRSVHDRLGKRVVDQNWADYEEGDEEEYVWQEGQWCP
Ga0182202_11117391	3300017415	Miscanthus Phyllosphere	VDQHLKNRSIHDRLGKRVVDQNWADYEEEDDEEYVW
Ga0182230_10907421	3300017417	Miscanthus Phyllosphere	MDQRLKNRSVHDQLGKRVVDQNWANYEEDNKEEYV
Ga0182230_11165741	3300017417	Miscanthus Phyllosphere	MDRHLNNRSVHDQLGKRVVDQNWADCEEEINEEEYVWQEG
Ga0182228_11031851	3300017420	Miscanthus Phyllosphere	MDRHLKNRSIHDRLEKRVVDQNWVDYGEESNEEEYVWQDGQW
Ga0182228_11146362	3300017420	Miscanthus Phyllosphere	MDRRFKNRSIHDRLGKQVIDQNWADYEEKDDEEYFW
Ga0182228_11252811	3300017420	Miscanthus Phyllosphere	MDRRLKNGSIHNRLGKRVVDQDWADYEEEGNEKGYVWQKG
Ga0182219_10096562	3300017424	Miscanthus Phyllosphere	MDWRLKNRSVHDRLGKPVVDQNWANYEEEGDEEEYVW
Ga0182219_10830871	3300017424	Miscanthus Phyllosphere	MDRCLKNKSVHDQLGKRIVDQDWADHEKESNEKGYVW
Ga0182219_10918783	3300017424	Miscanthus Phyllosphere	HHNNMDRHLKNGSIHNRLGKRVVDQDWADYEEGSDEGKYVW
Ga0182219_10937562	3300017424	Miscanthus Phyllosphere	MDRRLKIKSVHDRLGKRVVDQDWADYGEEGNERKYV
Ga0182224_10629631	3300017425	Miscanthus Phyllosphere	MLKNGSVHNWLGKRVVDQDWADYEEEGNERKYIWQKGQ
Ga0182192_10400271	3300017430	Miscanthus Phyllosphere	MDRHLKNRSIHDRLEKRVVDQNWADYEEEDDEEYVWQE
Ga0182192_11609471	3300017430	Miscanthus Phyllosphere	MDRRLKIRSVHDRFGKQVVDQNWANYEEECDEEEYVWQ
Ga0182191_11849091	3300017438	Miscanthus Phyllosphere	MDQRLKNRSVHDRLGKQVVDQNKADYEEEGDEEQYVW
Ga0182221_11291131	3300017442	Miscanthus Phyllosphere	MDRRLKNKSVHNWLGKRVVDQDWADYEEEGNERKYVW
Ga0182193_11528582	3300017443	Miscanthus Phyllosphere	MDWRLKNRSVHDRVGKRVVDQNWADYEEEDNEEEYVW
Ga0182233_10728433	3300017680	Miscanthus Phyllosphere	MDRCLKNRGVHDRLGKRVVDQNWANYEEESNEEEYIW
Ga0182233_11122973	3300017680	Miscanthus Phyllosphere	RRLKNKSIYDRLGKRVIDQDWADHEEGNNQREYVW
Ga0182226_11206462	3300017681	Miscanthus Phyllosphere	VDRRLKNRSIHDRLRKQVVDQSWADYEEKDDEEYVWQEG
Ga0182218_10925112	3300017683	Miscanthus Phyllosphere	MDRRLKNGSIHNRLGKRVVDQDWANYEEEGNEREYVWQERQ
Ga0182225_10310121	3300017684	Miscanthus Phyllosphere	MDRRLKNRSVHNWLGKRVVDQDWADYEEEDNEREYVW
Ga0182225_11463481	3300017684	Miscanthus Phyllosphere	VDQRLKNRSIHDRLGKRVVDQNWADYEDKDDKEYVW
Ga0182227_10413562	3300017685	Miscanthus Phyllosphere	MERWLKYKSVHDRLGKRVVDQDWADQEEEGTKKRHMWQEG
Ga0182205_10527491	3300017686	Miscanthus Phyllosphere	MDRRLENRSVHDRLGKRVIDQNWADYEEGGDKEEYVWQGG
Ga0182223_10913981	3300017690	Miscanthus Phyllosphere	VDRRLKNRSIHDRLEKRVVDQNWADYKEEDDEEYIW
Ga0207659_114714542	3300025926	Miscanthus Rhizosphere	QNDVDPRLKNRSIYDRLRKRVVDQNWDDYEQEDHEEYVW
Ga0207691_117155351	3300025940	Miscanthus Rhizosphere	MDRCLKNKSVHDRLGKIVVDQDWADYEEECNKRKYVW

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.23
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.23
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F058574

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign