Metagenome Family F058483

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F058483
Family Type	Metagenome
Number of Sequences	135
Average Sequence Length	36 residues
Representative Sequence	MTDTLSAAVIGAIAGYLIARHCPEIEWILHTLIG
Number of Associated Samples	100
Number of Associated Scaffolds	135

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	22.96 %
% of genes near scaffold ends (potentially truncated)	20.00 %
% of genes from short scaffolds (< 2000 bps)	72.59 %
Associated GOLD sequencing projects	96
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.593 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (18.518 % of family members)
Environment Ontology (ENVO)	Unclassified (28.148 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (52.593 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.39
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 135 Family Scaffolds
PF08281	Sigma70_r4_2	21.48
PF04542	Sigma70_r2	13.33
PF13602	ADH_zinc_N_2	2.22
PF02780	Transketolase_C	2.22
PF04392	ABC_sub_bind	1.48
PF05957	DUF883	1.48
PF00561	Abhydrolase_1	0.74
PF03466	LysR_substrate	0.74
PF01425	Amidase	0.74
PF00346	Complex1_49kDa	0.74
PF00857	Isochorismatase	0.74
PF00753	Lactamase_B	0.74
PF01625	PMSR	0.74
PF13649	Methyltransf_25	0.74
PF04679	DNA_ligase_A_C	0.74
PF12681	Glyoxalase_2	0.74
PF02517	Rce1-like	0.74
PF13580	SIS_2	0.74
PF00293	NUDIX	0.74

COG ID	Name	Functional Category	% Frequency in 135 Family Scaffolds
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	13.33
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	13.33
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	13.33
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	13.33
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	1.48
COG4575	Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 family	Translation, ribosomal structure and biogenesis [J]	1.48
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.74
COG0225	Peptide methionine sulfoxide reductase MsrA	Posttranslational modification, protein turnover, chaperones [O]	0.74
COG0649	NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)	Energy production and conversion [C]	0.74
COG1266	Membrane protease YdiL, CAAX protease family	Posttranslational modification, protein turnover, chaperones [O]	0.74
COG1335	Nicotinamidase-related amidase	Coenzyme transport and metabolism [H]	0.74
COG1535	Isochorismate hydrolase	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.74
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	0.74
COG3261	Ni,Fe-hydrogenase III large subunit	Energy production and conversion [C]	0.74
COG4449	Predicted protease, Abi (CAAX) family	General function prediction only [R]	0.74

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.59 %
Unclassified	root	N/A	7.41 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.59 %
Unclassified	root	N/A	7.41 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.59 %
Unclassified	root	N/A	7.41 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	79.26 %
Unclassified	root	N/A	7.41 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	75.56 %
Unclassified	root	N/A	7.41 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.74 %

Name	Rank	Taxonomy	Distribution
unclassified Gammaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria	75.56 %
Unclassified	root	N/A	7.41 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.74 %

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	75.56 %
Unclassified	root	N/A	7.41 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.74 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000364\|INPhiseqgaiiFebDRAFT_100822638	All Organisms → cellular organisms → Bacteria	11958	Open in IMG/M
3300000364\|INPhiseqgaiiFebDRAFT_104758499	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	561	Open in IMG/M
3300000655\|AF_2010_repII_A100DRAFT_1099244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	510	Open in IMG/M
3300001545\|JGI12630J15595_10047446	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	862	Open in IMG/M
3300001661\|JGI12053J15887_10024810	All Organisms → cellular organisms → Bacteria	3360	Open in IMG/M
3300001867\|JGI12627J18819_10107201	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1152	Open in IMG/M
3300002245\|JGIcombinedJ26739_100063904	All Organisms → cellular organisms → Bacteria	3381	Open in IMG/M
3300002245\|JGIcombinedJ26739_100446091	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1171	Open in IMG/M
3300004091\|Ga0062387_101788377	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	501	Open in IMG/M
3300005367\|Ga0070667_101335351	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	672	Open in IMG/M
3300005526\|Ga0073909_10075758	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1282	Open in IMG/M
3300005540\|Ga0066697_10165871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1308	Open in IMG/M
3300005542\|Ga0070732_10978308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	517	Open in IMG/M
3300005548\|Ga0070665_100013076	All Organisms → cellular organisms → Bacteria → Proteobacteria	8357	Open in IMG/M
3300005554\|Ga0066661_10017040	All Organisms → cellular organisms → Bacteria	3785	Open in IMG/M
3300005554\|Ga0066661_10638425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	629	Open in IMG/M
3300005556\|Ga0066707_10546327	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	748	Open in IMG/M
3300005560\|Ga0066670_10092144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1678	Open in IMG/M
3300005564\|Ga0070664_100530531	All Organisms → cellular organisms → Bacteria	1087	Open in IMG/M
3300005566\|Ga0066693_10073305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1191	Open in IMG/M
3300005568\|Ga0066703_10734668	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	566	Open in IMG/M
3300005586\|Ga0066691_10191651	All Organisms → cellular organisms → Bacteria	1188	Open in IMG/M
3300005614\|Ga0068856_100058522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3806	Open in IMG/M
3300005764\|Ga0066903_100592038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1919	Open in IMG/M
3300005764\|Ga0066903_100861395	All Organisms → cellular organisms → Bacteria → Proteobacteria	1632	Open in IMG/M
3300005764\|Ga0066903_100939462	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1571	Open in IMG/M
3300005764\|Ga0066903_101876940	Not Available	1147	Open in IMG/M
3300005764\|Ga0066903_104374034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	755	Open in IMG/M
3300005764\|Ga0066903_105438047	Not Available	672	Open in IMG/M
3300005764\|Ga0066903_105978514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	638	Open in IMG/M
3300006032\|Ga0066696_10064852	All Organisms → cellular organisms → Bacteria	2098	Open in IMG/M
3300006163\|Ga0070715_10321108	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	836	Open in IMG/M
3300006175\|Ga0070712_100347537	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1213	Open in IMG/M
3300006237\|Ga0097621_100450999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1159	Open in IMG/M
3300006358\|Ga0068871_101382473	Not Available	663	Open in IMG/M
3300006797\|Ga0066659_10635889	All Organisms → cellular organisms → Bacteria	868	Open in IMG/M
3300006800\|Ga0066660_10538015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	981	Open in IMG/M
3300006806\|Ga0079220_11232919	Not Available	620	Open in IMG/M
3300006854\|Ga0075425_100204930	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2267	Open in IMG/M
3300006914\|Ga0075436_100542455	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	853	Open in IMG/M
3300006954\|Ga0079219_11591670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	598	Open in IMG/M
3300007258\|Ga0099793_10096392	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1364	Open in IMG/M
3300007265\|Ga0099794_10129895	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1271	Open in IMG/M
3300009093\|Ga0105240_10318673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1773	Open in IMG/M
3300009093\|Ga0105240_11661722	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	667	Open in IMG/M
3300009098\|Ga0105245_12736570	Not Available	546	Open in IMG/M
3300009137\|Ga0066709_100707103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1450	Open in IMG/M
3300009545\|Ga0105237_10093744	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2992	Open in IMG/M
3300009551\|Ga0105238_10452424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1281	Open in IMG/M
3300009826\|Ga0123355_10053702	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6531	Open in IMG/M
3300009826\|Ga0123355_10290266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2245	Open in IMG/M
3300009826\|Ga0123355_10306653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2157	Open in IMG/M
3300009826\|Ga0123355_11023583	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	873	Open in IMG/M
3300009826\|Ga0123355_11077379	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	840	Open in IMG/M
3300009826\|Ga0123355_11875149	Not Available	562	Open in IMG/M
3300010043\|Ga0126380_10270170	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1190	Open in IMG/M
3300010046\|Ga0126384_10412692	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1143	Open in IMG/M
3300010047\|Ga0126382_11148466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	692	Open in IMG/M
3300010048\|Ga0126373_10151517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2204	Open in IMG/M
3300010048\|Ga0126373_10723169	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1055	Open in IMG/M
3300010048\|Ga0126373_11125268	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	851	Open in IMG/M
3300010048\|Ga0126373_11450918	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	752	Open in IMG/M
3300010048\|Ga0126373_11553777	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	727	Open in IMG/M
3300010048\|Ga0126373_11591889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	718	Open in IMG/M
3300010048\|Ga0126373_11884697	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	661	Open in IMG/M
3300010048\|Ga0126373_12089503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	628	Open in IMG/M
3300010049\|Ga0123356_10074766	All Organisms → cellular organisms → Bacteria	3190	Open in IMG/M
3300010049\|Ga0123356_10814887	All Organisms → cellular organisms → Bacteria	1105	Open in IMG/M
3300010321\|Ga0134067_10023400	All Organisms → cellular organisms → Bacteria	1874	Open in IMG/M
3300010335\|Ga0134063_10014745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	3136	Open in IMG/M
3300010337\|Ga0134062_10005063	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	4703	Open in IMG/M
3300010358\|Ga0126370_10932838	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	787	Open in IMG/M
3300010359\|Ga0126376_11962078	Not Available	626	Open in IMG/M
3300010361\|Ga0126378_10037307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	4417	Open in IMG/M
3300010361\|Ga0126378_10444037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1411	Open in IMG/M
3300010361\|Ga0126378_10585936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1230	Open in IMG/M
3300010366\|Ga0126379_10121275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2376	Open in IMG/M
3300010371\|Ga0134125_11388972	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	765	Open in IMG/M
3300010375\|Ga0105239_10319553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1750	Open in IMG/M
3300010376\|Ga0126381_100020171	All Organisms → cellular organisms → Bacteria	7782	Open in IMG/M
3300010376\|Ga0126381_100028862	All Organisms → cellular organisms → Bacteria → Proteobacteria	6595	Open in IMG/M
3300010376\|Ga0126381_100093915	All Organisms → cellular organisms → Bacteria	3812	Open in IMG/M
3300010376\|Ga0126381_100702816	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1446	Open in IMG/M
3300010376\|Ga0126381_102283993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	777	Open in IMG/M
3300010376\|Ga0126381_103202176	Not Available	647	Open in IMG/M
3300010376\|Ga0126381_105111337	Not Available	502	Open in IMG/M
3300010401\|Ga0134121_10014689	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	6228	Open in IMG/M
3300012198\|Ga0137364_10018940	All Organisms → cellular organisms → Bacteria	4183	Open in IMG/M
3300012198\|Ga0137364_10059650	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2573	Open in IMG/M
3300012203\|Ga0137399_10033228	All Organisms → cellular organisms → Bacteria	3580	Open in IMG/M
3300012203\|Ga0137399_10214531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1567	Open in IMG/M
3300012205\|Ga0137362_10325364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1331	Open in IMG/M
3300012206\|Ga0137380_10201000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1807	Open in IMG/M
3300012285\|Ga0137370_10641811	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	658	Open in IMG/M
3300012349\|Ga0137387_10018959	All Organisms → cellular organisms → Bacteria	4244	Open in IMG/M
3300012351\|Ga0137386_10960888	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	609	Open in IMG/M
3300012582\|Ga0137358_10067149	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2405	Open in IMG/M
3300012917\|Ga0137395_10002887	All Organisms → cellular organisms → Bacteria	8420	Open in IMG/M
3300012917\|Ga0137395_10083790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2086	Open in IMG/M
3300012917\|Ga0137395_10104996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1882	Open in IMG/M
3300012918\|Ga0137396_10036253	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	3303	Open in IMG/M
3300012923\|Ga0137359_10087000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2749	Open in IMG/M
3300012924\|Ga0137413_11417355	All Organisms → cellular organisms → Bacteria → Proteobacteria	562	Open in IMG/M
3300012927\|Ga0137416_10078913	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2413	Open in IMG/M
3300012960\|Ga0164301_10523482	Not Available	860	Open in IMG/M
3300012971\|Ga0126369_11536011	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	755	Open in IMG/M
3300013307\|Ga0157372_12827646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	556	Open in IMG/M
3300014166\|Ga0134079_10145921	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	950	Open in IMG/M
3300014968\|Ga0157379_10176592	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1929	Open in IMG/M
3300014969\|Ga0157376_10317588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1480	Open in IMG/M
3300015371\|Ga0132258_10246616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	4363	Open in IMG/M
3300016319\|Ga0182033_10854153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	804	Open in IMG/M
3300016357\|Ga0182032_10219710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1458	Open in IMG/M
3300017936\|Ga0187821_10034123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1801	Open in IMG/M
3300021432\|Ga0210384_10880935	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	795	Open in IMG/M
3300025903\|Ga0207680_11220225	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	536	Open in IMG/M
3300025913\|Ga0207695_10609254	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	973	Open in IMG/M
3300025949\|Ga0207667_10092647	All Organisms → cellular organisms → Bacteria	3120	Open in IMG/M
3300025986\|Ga0207658_12077010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	517	Open in IMG/M
3300026310\|Ga0209239_1136952	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	994	Open in IMG/M
3300028047\|Ga0209526_10166617	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1538	Open in IMG/M
3300031543\|Ga0318516_10474642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	719	Open in IMG/M
3300031545\|Ga0318541_10584279	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	625	Open in IMG/M
3300031573\|Ga0310915_10463335	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	901	Open in IMG/M
3300031680\|Ga0318574_10802231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	552	Open in IMG/M
3300031740\|Ga0307468_102211516	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	532	Open in IMG/M
3300031753\|Ga0307477_10026500	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	3959	Open in IMG/M
3300031778\|Ga0318498_10433755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	582	Open in IMG/M
3300031821\|Ga0318567_10344756	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	842	Open in IMG/M
3300031942\|Ga0310916_10090582	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	2438	Open in IMG/M
3300031959\|Ga0318530_10095780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1175	Open in IMG/M
3300032001\|Ga0306922_10878889	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	932	Open in IMG/M
3300032009\|Ga0318563_10678721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	554	Open in IMG/M
3300032180\|Ga0307471_100060206	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	3201	Open in IMG/M
3300032261\|Ga0306920_100812187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium	1372	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	77.78%
Host-Associated	Host-Associated	22.22%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	76.30%
Plants	Host-Associated → Plants	16.30%
Arthropoda	Host-Associated → Arthropoda	5.93%
Aquatic	Environmental → Aquatic	1.48%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	76.30%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.59%
Digestive System	Host-Associated → Arthropoda → Digestive System	5.93%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.22%
Freshwater	Environmental → Aquatic → Freshwater	1.48%
Roots	Host-Associated → Plants → Roots	1.48%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	65.19%
Loam	Environmental → Terrestrial → Soil → Loam	11.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	8.89%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	5.93%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.70%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.48%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.48%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.74%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	39.26%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	13.33%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	11.11%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	9.63%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	8.89%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	5.93%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.70%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.48%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.48%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.74%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.74%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.74%

Habitat	Taxonomy	Distribution
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	18.52%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	9.63%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	7.41%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	5.93%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	5.19%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.44%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.44%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.22%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	2.96%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.48%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.48%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.48%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.48%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	1.48%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.48%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.48%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.48%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.74%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.74%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.74%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.74%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.74%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.74%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.74%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental	Open in IMG/M
3300000655	Forest soil microbial communities from Amazon forest - 2010 replicate II A100	Environmental	Open in IMG/M
3300001545	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1	Environmental	Open in IMG/M
3300001661	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)	Environmental	Open in IMG/M
3300001867	Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)	Environmental	Open in IMG/M
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental	Open in IMG/M
3300004091	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental	Open in IMG/M
3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Host-Associated	Open in IMG/M
3300005526	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1	Environmental	Open in IMG/M
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental	Open in IMG/M
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005568	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152	Environmental	Open in IMG/M
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental	Open in IMG/M
3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Host-Associated	Open in IMG/M
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental	Open in IMG/M
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental	Open in IMG/M
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental	Open in IMG/M
3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated	Open in IMG/M
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Host-Associated	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental	Open in IMG/M
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental	Open in IMG/M
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014166	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026310	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental	Open in IMG/M
3300031545	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26	Environmental	Open in IMG/M
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental	Open in IMG/M
3300031680	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental	Open in IMG/M
3300031778	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24	Environmental	Open in IMG/M
3300031821	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031959	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
INPhiseqgaiiFebDRAFT_10082263810	3300000364	Soil	MNDVLSGALIGAVFGYLIARHSSEIEWILHMLIG*
INPhiseqgaiiFebDRAFT_1047584992	3300000364	Soil	MNDPLSAAAIGAIAGYLIARHCPEIEWLLHTLIG*
AF_2010_repII_A100DRAFT_10992441	3300000655	Forest Soil	MSDTLSAAMIGAIVGYLVARHSLEIEWILHTLIG*
JGI12630J15595_100474462	3300001545	Forest Soil	MKDTLSAAVIGAIXGYLAHRYWPEIEWILRILSG*
JGI12053J15887_100248107	3300001661	Forest Soil	MPTPDNAMKDTLSAAVIGAIAGYLIHRHWPEIDWILHILTG*
JGI12627J18819_101072013	3300001867	Forest Soil	MSDTLPAAVIGAIVGYLIAQHSPEIEWILHALFG*
JGIcombinedJ26739_1000639046	3300002245	Forest Soil	MPTPENAMKDTLSAAVIGAIVGYLAHRYWPEIEWILRILSG*
JGIcombinedJ26739_1004460913	3300002245	Forest Soil	MKDTLSAAVIGAIVGYLTHRHWPEIEWILRILSG*
Ga0062387_1017883771	3300004091	Bog Forest Soil	YQPPQRARIPPGRAMKDTASAAVMGAIAGYFIHLHWPEIEWILRILSG*
Ga0070667_1013353512	3300005367	Switchgrass Rhizosphere	MPPGCAMNDTASAALMGAIAGYLIHLHWPEIEWILRLLTR*
Ga0073909_100757582	3300005526	Surface Soil	MNDVLSGALIGAVFGYLIARHSSEVEWILHMLIG*
Ga0066697_101658713	3300005540	Soil	MTDTLSAAVLGAIAGYLIARHCPEIEWVLHTLIG*
Ga0070732_109783081	3300005542	Surface Soil	MSDTLSAAVIGGIAGYLIARHSREIEWILHTLIG*
Ga0070665_1000130764	3300005548	Switchgrass Rhizosphere	MKDTATAAFMGAIVGYLLHRHWPEIDWLVRILTG*
Ga0066661_100170404	3300005554	Soil	MTDSLSAAVIGAIVGYLIARHCPEIEGFLHLLIG*
Ga0066661_106384252	3300005554	Soil	MTDTLSAALIGAIAGYLIAQHCPEIEWILRILSG*
Ga0066707_105463271	3300005556	Soil	MTDTLSATVIGAIAGYLIARHGPEIECILHALIG*
Ga0066670_100921443	3300005560	Soil	MTDTLSAAVIGAITGYLIARHCPEVEWFLHLLIG*
Ga0070664_1005305313	3300005564	Corn Rhizosphere	MNDVLSSALIGTVFGYLIARHSSEVEWILHMLIG*
Ga0066693_100733053	3300005566	Soil	MTDTLSAAVIGAIAGYLIARHCPEIEWILHTLIG*
Ga0066703_107346682	3300005568	Soil	MTDTLSATVIGAIAGYLIARHGPEIEWFLHLLMG*
Ga0066691_101916512	3300005586	Soil	LNDALLAAVIGAIAGYIIARHCPELDWILQILTG*
Ga0068856_1000585226	3300005614	Corn Rhizosphere	MAMTDTLSAAVIGAIAGYLIARHAAELEWILHTVIG*
Ga0066903_1005920383	3300005764	Tropical Forest Soil	MSDTLSAALVGAIAGYLIARHIPEIDWILHILMG*
Ga0066903_1008613954	3300005764	Tropical Forest Soil	MSDTLSAAVVGAIAGYVIARHLPEIDWILHMLIG*
Ga0066903_1009394623	3300005764	Tropical Forest Soil	MTDALSGALIGAVFGYLIARHSSEIEWILHTLIG*
Ga0066903_1018769402	3300005764	Tropical Forest Soil	MNDSLSAAVLGAIAGYLVARYIPEINWILQILIG*
Ga0066903_1043740342	3300005764	Tropical Forest Soil	MAKLEIAMSDSLSAAVIGAIAGYLLARHGPEIEWLLHILLG*
Ga0066903_1054380472	3300005764	Tropical Forest Soil	MSDTLSGAVIGGLAGYLIARHISEIEWILHTLIG*
Ga0066903_1059785141	3300005764	Tropical Forest Soil	MSDTLSAAVLGAVAGYLLARHCPEIEWILHTLLG*
Ga0066696_100648524	3300006032	Soil	MTDTLSAVVIGAIAGYLIARHCSEIEWILHTLIG*
Ga0070715_103211082	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MNDVLSGALIGTVFGYLIARHSSEVEWILHMLIG*
Ga0070712_1003475373	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MTDTLSAAVIGAIAGYFIARHAAELEWILHTVIG*
Ga0097621_1004509991	3300006237	Miscanthus Rhizosphere	MKDTATAALMGAIVGYLIHRHWPEIDRLVRILTG*
Ga0068871_1013824732	3300006358	Miscanthus Rhizosphere	MAMTDTLSAAVIGAIAGYLIARHAAELEWILHTVI
Ga0066659_106358892	3300006797	Soil	VNDALLAAVIGAIAGYIIARHCPELDWILQILTG*
Ga0066660_105380152	3300006800	Soil	MTDTLSAALIGTIAGYLIARHWPDIEWFLHLLIG*
Ga0079220_112329193	3300006806	Agricultural Soil	MTDTLSAAVIGAIAGYLIARYVAELEWILHTVIG*
Ga0075425_1002049302	3300006854	Populus Rhizosphere	MSDTLAAAAIGVITGYLIARHGAEIQWILHTLIG*
Ga0075436_1005424553	3300006914	Populus Rhizosphere	AMSDTLAAAAIGVITGYLIARHGAEIQWILHTLIG*
Ga0079219_115916701	3300006954	Agricultural Soil	MNDILSAAVIGAIAGYFIARHGPEIEWILHILIG*
Ga0099793_100963921	3300007258	Vadose Zone Soil	SAMTDTLSAAVIGAIAGYLIARHCPEIEWILHTLIG*
Ga0099794_101298954	3300007265	Vadose Zone Soil	AMTDTLSAAVIGAIAGYLIARHCPEIEWILYTLIG*
Ga0105240_103186731	3300009093	Corn Rhizosphere	ARVPPGCVMKDTATAALMGAIAGYLIHRHWPEIEWIVRLLTG*
Ga0105240_116617221	3300009093	Corn Rhizosphere	PPPGCAMKDTATAALMGAIAGYFIHRHWPEIEWLVRILTG*
Ga0105245_127365701	3300009098	Miscanthus Rhizosphere	MKDTATAALIGAIVGYLIHRHWPEIDRLVRILTG*
Ga0066709_1007071032	3300009137	Grasslands Soil	MTDTLSAAVIGAIAGYLIVRHCPEIEWILRTLMG*
Ga0105237_100937445	3300009545	Corn Rhizosphere	MKDTATAALMGAIAGYLIHRHWPEIEWIVRLLTG*
Ga0105238_104524241	3300009551	Corn Rhizosphere	MKDTATAALIGAIAGYFIHRHWPEIEWLVRILTG*
Ga0123355_100537025	3300009826	Termite Gut	MNDALSAAVIGAIAGYLIARHGPQIEWILHALLG*
Ga0123355_102902662	3300009826	Termite Gut	MSDTLSAAVIGAIVGYLIARHGPEIEWLLHALIG*
Ga0123355_103066532	3300009826	Termite Gut	MNDALSAAVIGAIAGYLIARHAPQIEWILHALIG*
Ga0123355_110235831	3300009826	Termite Gut	MNDALPAALLGAIAGYLIARHGAQIEWILHALIG*
Ga0123355_110773792	3300009826	Termite Gut	MNDALSAAVIGAIAGYLMARHSAEIEWIVRALIG*
Ga0123355_118751491	3300009826	Termite Gut	MSDTLSAAVIGAMAGYLIARHGAEIEWLLHALIG*
Ga0126380_102701702	3300010043	Tropical Forest Soil	MTDALSGALIGAVFGYLIARHSSEVEWILHTLIG*
Ga0126384_104126922	3300010046	Tropical Forest Soil	MSDTLSAAVIGVIAGYFIARFSPEIEWILHTLIG*
Ga0126382_111484661	3300010047	Tropical Forest Soil	MSDTLSAAVIGVIAGYFIARLSPEIEWILHTLIG*
Ga0126373_101515172	3300010048	Tropical Forest Soil	MSDSLSAAMIGAIAGYLIARHGSEIEWILRTLIG*
Ga0126373_107231691	3300010048	Tropical Forest Soil	MSDTLSAAVIGAIAGYLIARHGPEIDWILHALFG*
Ga0126373_111252682	3300010048	Tropical Forest Soil	MSGILSGAVIGAIAGYVVARHVQEIEWLLRTLIG*
Ga0126373_114509181	3300010048	Tropical Forest Soil	MSDTLSAAMIGAIAGYLIARHSSEIEWILRTLIG*
Ga0126373_115537772	3300010048	Tropical Forest Soil	MSDTLSAAVIGVIAGYFIARHGPEIEWILHTLIG*
Ga0126373_115918892	3300010048	Tropical Forest Soil	MAMNDTLLAALVGAIAGYLIAQHSQEIEWILHTLIG*
Ga0126373_118846972	3300010048	Tropical Forest Soil	MSDSLSAAVIGAIAGYLIARHGPEIEWFLHTLLG*
Ga0126373_120895032	3300010048	Tropical Forest Soil	MNDAMPAAVIGAIAGYLIARHSPEIEWILHTLFG*
Ga0123356_100747665	3300010049	Termite Gut	MNDILSAAAIGAVAGYLIARHSPEIEWLLHALLG*
Ga0123356_108148872	3300010049	Termite Gut	MSDTLSAVVIGAIAGYLIARHSTEIEWLMHALIG*
Ga0134067_100234004	3300010321	Grasslands Soil	MTDTLSAALIGTIAGYLIARHWPEIEWFLHLLIG*
Ga0134063_100147454	3300010335	Grasslands Soil	MTDTLSAAVLVAIAGYLIARHCPEIEWVLHTLIG*
Ga0134062_100050633	3300010337	Grasslands Soil	MTDTLSAAVIGAIAGYLIARHCPEIEWVLHTLIG*
Ga0126370_109328382	3300010358	Tropical Forest Soil	MSDTLSAAVIGVIAGYFLARHSPEIEWILRTLIG*
Ga0126376_119620782	3300010359	Tropical Forest Soil	MNDNLLAAVVGAIAGYLIARHSPQIAWILHALVG*
Ga0126378_100373076	3300010361	Tropical Forest Soil	MSDSLSAALIGAIAGYLIARHGSEIEWILRTLIG*
Ga0126378_104440371	3300010361	Tropical Forest Soil	MSDTLSAVVIGVIAGYFIARHSPEIEWILHTLIG*
Ga0126378_105859362	3300010361	Tropical Forest Soil	MSDTLSAAVLGALAGYLLARHCPEIEWILHTLLG*
Ga0126379_101212753	3300010366	Tropical Forest Soil	MSDTLSAAVIGVIAGYFIARHSPEIEWILHTLIG*
Ga0134125_113889722	3300010371	Terrestrial Soil	MNDTASAALMGAIAGYLIHLHWPEIEWILRLLTR*
Ga0105239_103195533	3300010375	Corn Rhizosphere	MNDTATAAFMGAIVGYLLHRHGPEIEWLVRILTG*
Ga0126381_1000201713	3300010376	Tropical Forest Soil	MNETLSAAVMGVVGAIAGYLIARHIAEIEWIVHTLIG*
Ga0126381_1000288625	3300010376	Tropical Forest Soil	MSGILSGALIGAIAGYLIARHVQEIEWVLRTLIG*
Ga0126381_1000939154	3300010376	Tropical Forest Soil	MHESLSAAVIGAIVGYLIARHGPEIEWLLHALLG*
Ga0126381_1007028162	3300010376	Tropical Forest Soil	MSDTLSAAVIGAIAGYLIARHSSEIEWILHTLIG*
Ga0126381_1022839931	3300010376	Tropical Forest Soil	MNATLSAAVTGAIAGYLIARHSAEIEWILHALFG*
Ga0126381_1032021762	3300010376	Tropical Forest Soil	MSDTLPAAVIGAIAGYLIARHGPEIDWILHALFG*
Ga0126381_1051113372	3300010376	Tropical Forest Soil	MSETLSAAVMGVMGAIAGYLIARHIAEIEWIVHALIG*
Ga0134121_1001468910	3300010401	Terrestrial Soil	MNDVLSGALIGAVFGYLIARHTSEVEWILHMLIG*
Ga0137364_100189403	3300012198	Vadose Zone Soil	MTDTLSATVIGAIAGYLIARHSPEIECILHALIG*
Ga0137364_100596505	3300012198	Vadose Zone Soil	MTDTLSAAVIGAIAGYLIARHCPEIEWILRTLMG*
Ga0137399_100332286	3300012203	Vadose Zone Soil	MTDTLSAAVMGAIAGYLIARHCPEIEWIVHTLIG*
Ga0137399_102145311	3300012203	Vadose Zone Soil	MKDTLSAAVIGAIVGYLTHRHWPEIDWILRILSG*
Ga0137362_103253643	3300012205	Vadose Zone Soil	MTDTLSAAVIGAIAGYIIARHCPELDWILQILTG*
Ga0137380_102010002	3300012206	Vadose Zone Soil	MTDTVSAAVIGAIAGYLIAGHCPEIEWFLHLLMG*
Ga0137370_106418112	3300012285	Vadose Zone Soil	MTDTLSAAVIGTIAGYLIARHSPEIEWFLHLLIG*
Ga0137387_100189597	3300012349	Vadose Zone Soil	MTDTVSAAVIGAIAGYLIARHCPEIEWILRTLMG*
Ga0137386_109608882	3300012351	Vadose Zone Soil	RQKSAMTDTLSAAVIGAIAGYLIAHCPEIEWILHTLIG*
Ga0137358_100671495	3300012582	Vadose Zone Soil	MTDTLSAAVIGTIAGYLIARHCPEIEWILHTLIG*
Ga0137395_100028874	3300012917	Vadose Zone Soil	MPKPESAMKDTLSAAVIGAIVGYLTHRHWPEIDWVLRILSG*
Ga0137395_100837903	3300012917	Vadose Zone Soil	MTDTLSATVIGAIAGYLIARHAPGIEWFLHLLMG*
Ga0137395_101049964	3300012917	Vadose Zone Soil	MTALELAMTDNLLAAVVGAIAGYFIARHSPQITWILHALVG*
Ga0137396_100362536	3300012918	Vadose Zone Soil	MTDTLSAAVMGAIAGYLIARHCPEIEWILHTLIG*
Ga0137359_100870001	3300012923	Vadose Zone Soil	DNAVNDALLAAVIGAIAGYIIARHCPELDWILQILTG*
Ga0137413_114173551	3300012924	Vadose Zone Soil	VRQNATAAMMGVVVGYLLHRHWPEIESLVRLLVG*
Ga0137416_100789132	3300012927	Vadose Zone Soil	MKDTLSAAVIGAIVGYLIHRHWPEIDWILHILTG*
Ga0164301_105234822	3300012960	Soil	MNDVLSGALIGTVFGYLIARHSSEVEWSLHMLIG*
Ga0126369_115360111	3300012971	Tropical Forest Soil	MSDTLSAAVIGAIAGYLIARHGPEVEWFLHTLLG*
Ga0157372_128276462	3300013307	Corn Rhizosphere	MKDTATAALMGTIAGYLIHRHWPEIEWLVRILTG*
Ga0134079_101459213	3300014166	Grasslands Soil	QKRAMTDTLSAAVIGTIAGYLIARHSPEIEWFLHLLIG*
Ga0157379_101765923	3300014968	Switchgrass Rhizosphere	MNDTATAAFMGAIVGYLLHRHWPEIDWLVRILTG*
Ga0157376_103175883	3300014969	Miscanthus Rhizosphere	MKDTAIAALMGAIVGYLIHRHWPEIDRLVRILTG*
Ga0132258_102466164	3300015371	Arabidopsis Rhizosphere	MSDTLSAAAIGVIVGYLIARHGPEIEWILHTLIG*
Ga0182033_108541533	3300016319	Soil	AMSDTLSAAMIGAIAGYLIARHSLEIEWLLHTLIG
Ga0182032_102197105	3300016357	Soil	LCQTTAMNDLLSAAVIGAIAGYFIARHSPEIEWILRTLIG
Ga0187821_100341234	3300017936	Freshwater Sediment	TMTDTLSAAVIGAIAGYFIARHAAQLEWILHTVIG
Ga0210384_108809351	3300021432	Soil	RRQDSVVNDALLAAVIGAIAGYIIARHCPELDWILQILTG
Ga0207680_112202252	3300025903	Switchgrass Rhizosphere	YQPRNEPSVLPGCAMKDTATAAFMGAIVGYLLHRHWPEIDWLVRILTG
Ga0207695_106092541	3300025913	Corn Rhizosphere	PGCAMKDTATAALMGAIAGYLIHRHWPEIEWIVRLLTG
Ga0207667_100926472	3300025949	Corn Rhizosphere	MPPGCAMNDTASAALMGAIAGYLIHLHWPEIEWILRLLTR
Ga0207658_120770103	3300025986	Switchgrass Rhizosphere	PSVLPGCAMKDTATAAFMGAIVGYLLHRHWPEIEWLVRILTG
Ga0209239_11369521	3300026310	Grasslands Soil	QKSAMTDTLSAAVLGAIAGYLIARHCPEIEWVLHTLIG
Ga0209526_101666172	3300028047	Forest Soil	MPSPESAMKDTLSAAVIGAIAGYLIHRHWPEIEWILRILSG
Ga0318516_104746422	3300031543	Soil	MATLEIAMSDSLSAAVIGAIAGYLVARHGPEIEWLLHILLG
Ga0318541_105842791	3300031545	Soil	RQTAMNDALSAAVIGAIAGYLIAQHNSEIVWILHTLFG
Ga0310915_104633352	3300031573	Soil	MATLEIAMSDSLSAAVIGAIAGYLVARHGPEIQWLLHILLG
Ga0318574_108022311	3300031680	Soil	LQLSDTVSAAMIGVIAGYLIARHSPEIEWILHTLIG
Ga0307468_1022115161	3300031740	Hardwood Forest Soil	AMSDTLSAALIGAIAGYIIARHCPELDWILRILTG
Ga0307477_100265002	3300031753	Hardwood Forest Soil	MTGLELAMTDNLLAAVVGAIAGYFIARHSPQITWILHALTG
Ga0318498_104337552	3300031778	Soil	NNQAGALQLSDTVSAAMIGVIAGYLIARHSPEIEWILHTLIG
Ga0318567_103447562	3300031821	Soil	MATLEIAMSDSLSAAVIGAIAGYLVARHGPEIQWLLHIL
Ga0310916_100905825	3300031942	Soil	TWGMSDTLSAAVIGAIAGYFIARHSAEIEWLVHTLIG
Ga0318530_100957803	3300031959	Soil	GIWGMGDTLSAAVIGAIAGYLIARHSAEIEWIVHTLIG
Ga0306922_108788891	3300032001	Soil	MNETLSAAVMGVMGAIVGYLIARHVAEIDWIVHALIG
Ga0318563_106787211	3300032009	Soil	MATLEIAMSDSLSAAVIGAIAGYLVARHGLEIEWLLHILLG
Ga0307471_1000602064	3300032180	Hardwood Forest Soil	MPTPESAMKDTLSAAVIGAIVGYLIHRHWPEIDWILRILSG
Ga0306920_1008121873	3300032261	Soil	MATLEIAMSDSLSAAVIGAIAGYLVARHGPEIAWLLHILLG

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F058483

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences