Basic Information | |
---|---|
Family ID | F058398 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 135 |
Average Sequence Length | 45 residues |
Representative Sequence | ANGAALGNAGGVTQIIMIDNAGRDKDTVSSLTSGENFSATWLRSN |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 7.58 % |
% of genes near scaffold ends (potentially truncated) | 83.70 % |
% of genes from short scaffolds (< 2000 bps) | 87.41 % |
Associated GOLD sequencing projects | 114 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.333 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.593 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.519 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.148 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.55% Coil/Unstructured: 79.45% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF00561 | Abhydrolase_1 | 11.11 |
PF11941 | DUF3459 | 9.63 |
PF00069 | Pkinase | 7.41 |
PF01555 | N6_N4_Mtase | 6.67 |
PF12697 | Abhydrolase_6 | 5.93 |
PF04012 | PspA_IM30 | 3.70 |
PF00392 | GntR | 2.96 |
PF01828 | Peptidase_A4 | 2.22 |
PF00355 | Rieske | 1.48 |
PF01391 | Collagen | 1.48 |
PF00753 | Lactamase_B | 1.48 |
PF01370 | Epimerase | 0.74 |
PF00441 | Acyl-CoA_dh_1 | 0.74 |
PF11271 | PorA | 0.74 |
PF02911 | Formyl_trans_C | 0.74 |
PF13460 | NAD_binding_10 | 0.74 |
PF13377 | Peripla_BP_3 | 0.74 |
PF01609 | DDE_Tnp_1 | 0.74 |
PF01243 | Putative_PNPOx | 0.74 |
PF13845 | Septum_form | 0.74 |
PF05016 | ParE_toxin | 0.74 |
PF00293 | NUDIX | 0.74 |
PF00501 | AMP-binding | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 29.63 |
COG1842 | Phage shock protein A | Transcription [K] | 7.41 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 6.67 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 6.67 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 6.67 |
COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.74 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.74 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.74 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.74 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.74 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.74 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 73.33 % |
Unclassified | root | N/A | 26.67 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004091|Ga0062387_100645470 | Not Available | 766 | Open in IMG/M |
3300004635|Ga0062388_102631127 | Not Available | 529 | Open in IMG/M |
3300005177|Ga0066690_10203882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1317 | Open in IMG/M |
3300005332|Ga0066388_100495675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1858 | Open in IMG/M |
3300005355|Ga0070671_101632859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 572 | Open in IMG/M |
3300005356|Ga0070674_100451753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1061 | Open in IMG/M |
3300005367|Ga0070667_101297661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 682 | Open in IMG/M |
3300005434|Ga0070709_10568521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 869 | Open in IMG/M |
3300005436|Ga0070713_101215738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
3300005437|Ga0070710_10512871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 822 | Open in IMG/M |
3300005445|Ga0070708_100168508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2044 | Open in IMG/M |
3300005471|Ga0070698_100295494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1551 | Open in IMG/M |
3300005591|Ga0070761_10959689 | Not Available | 542 | Open in IMG/M |
3300005598|Ga0066706_11331366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
3300005921|Ga0070766_10349017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 960 | Open in IMG/M |
3300005921|Ga0070766_10773907 | Not Available | 653 | Open in IMG/M |
3300006028|Ga0070717_10842304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 834 | Open in IMG/M |
3300006052|Ga0075029_101255835 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300006173|Ga0070716_100489897 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300006174|Ga0075014_100687699 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300006176|Ga0070765_102250240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Thermasporomyces → Thermasporomyces composti | 508 | Open in IMG/M |
3300006237|Ga0097621_100308310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1400 | Open in IMG/M |
3300006755|Ga0079222_10075009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1681 | Open in IMG/M |
3300006755|Ga0079222_10371649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 978 | Open in IMG/M |
3300006914|Ga0075436_100192910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1442 | Open in IMG/M |
3300009520|Ga0116214_1270811 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300009525|Ga0116220_10312493 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300009551|Ga0105238_12742162 | Not Available | 529 | Open in IMG/M |
3300009553|Ga0105249_13490189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Streptomonospora → Streptomonospora salina | 506 | Open in IMG/M |
3300009672|Ga0116215_1479531 | Not Available | 538 | Open in IMG/M |
3300009698|Ga0116216_10623938 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300009698|Ga0116216_10699188 | Not Available | 609 | Open in IMG/M |
3300009700|Ga0116217_10184784 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
3300009700|Ga0116217_10191725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1347 | Open in IMG/M |
3300010154|Ga0127503_10137874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300010333|Ga0134080_10512079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 572 | Open in IMG/M |
3300010360|Ga0126372_10564053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1084 | Open in IMG/M |
3300010361|Ga0126378_10107159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2771 | Open in IMG/M |
3300010371|Ga0134125_11369148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 771 | Open in IMG/M |
3300010379|Ga0136449_102374036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
3300010379|Ga0136449_103455129 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300010396|Ga0134126_11495306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 744 | Open in IMG/M |
3300010876|Ga0126361_10444256 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
3300010937|Ga0137776_1308138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
3300012205|Ga0137362_11410633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 583 | Open in IMG/M |
3300012351|Ga0137386_10663324 | Not Available | 750 | Open in IMG/M |
3300012359|Ga0137385_10491202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1039 | Open in IMG/M |
3300012361|Ga0137360_11809768 | Not Available | 516 | Open in IMG/M |
3300012481|Ga0157320_1010819 | Not Available | 710 | Open in IMG/M |
3300012498|Ga0157345_1055972 | Not Available | 514 | Open in IMG/M |
3300013102|Ga0157371_10067153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2538 | Open in IMG/M |
3300013307|Ga0157372_11785291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 707 | Open in IMG/M |
3300014201|Ga0181537_10785527 | Not Available | 646 | Open in IMG/M |
3300014326|Ga0157380_10154727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1986 | Open in IMG/M |
3300015373|Ga0132257_100792877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1182 | Open in IMG/M |
3300017821|Ga0187812_1247937 | Not Available | 567 | Open in IMG/M |
3300017926|Ga0187807_1030182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1679 | Open in IMG/M |
3300017926|Ga0187807_1302481 | Not Available | 531 | Open in IMG/M |
3300017928|Ga0187806_1067363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1109 | Open in IMG/M |
3300017932|Ga0187814_10161878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 835 | Open in IMG/M |
3300017932|Ga0187814_10203932 | Not Available | 743 | Open in IMG/M |
3300017948|Ga0187847_10570382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 631 | Open in IMG/M |
3300017955|Ga0187817_10211429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1236 | Open in IMG/M |
3300017974|Ga0187777_11033358 | Not Available | 596 | Open in IMG/M |
3300018001|Ga0187815_10051812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1727 | Open in IMG/M |
3300018042|Ga0187871_10553056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 638 | Open in IMG/M |
3300018043|Ga0187887_10151325 | Not Available | 1389 | Open in IMG/M |
3300018044|Ga0187890_10263421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 970 | Open in IMG/M |
3300018058|Ga0187766_10180042 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
3300018085|Ga0187772_10014902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4339 | Open in IMG/M |
3300018086|Ga0187769_10875396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 679 | Open in IMG/M |
3300020002|Ga0193730_1022050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1839 | Open in IMG/M |
3300020081|Ga0206354_10392717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1504 | Open in IMG/M |
3300020582|Ga0210395_10504339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
3300021088|Ga0210404_10328023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 846 | Open in IMG/M |
3300021171|Ga0210405_10940080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 655 | Open in IMG/M |
3300021374|Ga0213881_10037584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → Amycolatopsis sulphurea | 2039 | Open in IMG/M |
3300021403|Ga0210397_10366949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1070 | Open in IMG/M |
3300021420|Ga0210394_10587713 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300021433|Ga0210391_10296868 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
3300021433|Ga0210391_10709255 | Not Available | 788 | Open in IMG/M |
3300021560|Ga0126371_10091272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 3014 | Open in IMG/M |
3300021560|Ga0126371_12079295 | Not Available | 684 | Open in IMG/M |
3300022467|Ga0224712_10126936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1110 | Open in IMG/M |
3300022840|Ga0224549_1017096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1016 | Open in IMG/M |
3300025901|Ga0207688_10065380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2055 | Open in IMG/M |
3300025910|Ga0207684_11485169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 552 | Open in IMG/M |
3300025915|Ga0207693_10641515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
3300025916|Ga0207663_11176231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 617 | Open in IMG/M |
3300025916|Ga0207663_11589731 | Not Available | 526 | Open in IMG/M |
3300025928|Ga0207700_11302774 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 647 | Open in IMG/M |
3300026490|Ga0257153_1032600 | Not Available | 1075 | Open in IMG/M |
3300026551|Ga0209648_10033431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 4483 | Open in IMG/M |
3300027031|Ga0208986_1021908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
3300027765|Ga0209073_10067100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 1212 | Open in IMG/M |
3300027787|Ga0209074_10507887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300027855|Ga0209693_10406357 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300027879|Ga0209169_10000557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22706 | Open in IMG/M |
3300027884|Ga0209275_10006477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4902 | Open in IMG/M |
3300027884|Ga0209275_10323950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
3300027889|Ga0209380_10141911 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300027895|Ga0209624_10654646 | Not Available | 695 | Open in IMG/M |
3300027905|Ga0209415_10911669 | Not Available | 596 | Open in IMG/M |
3300028715|Ga0307313_10088312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 936 | Open in IMG/M |
3300028828|Ga0307312_10088238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1907 | Open in IMG/M |
3300028906|Ga0308309_10507942 | Not Available | 1042 | Open in IMG/M |
3300028906|Ga0308309_11209564 | Not Available | 651 | Open in IMG/M |
3300029910|Ga0311369_10708299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 826 | Open in IMG/M |
3300029944|Ga0311352_10065917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora acidiphila | 3252 | Open in IMG/M |
3300030520|Ga0311372_11532491 | Not Available | 819 | Open in IMG/M |
3300030730|Ga0307482_1172507 | Not Available | 643 | Open in IMG/M |
3300030740|Ga0265460_10303014 | Not Available | 1070 | Open in IMG/M |
3300030741|Ga0265459_13921094 | Not Available | 522 | Open in IMG/M |
3300031128|Ga0170823_14845240 | Not Available | 644 | Open in IMG/M |
3300031234|Ga0302325_10730188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. ADI95-17 | 1417 | Open in IMG/M |
3300031234|Ga0302325_11426048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 898 | Open in IMG/M |
3300031708|Ga0310686_104605674 | Not Available | 728 | Open in IMG/M |
3300031723|Ga0318493_10047356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MH60 | 2022 | Open in IMG/M |
3300031833|Ga0310917_10225222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MH60 | 1259 | Open in IMG/M |
3300031890|Ga0306925_10129727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. MH60 | 2704 | Open in IMG/M |
3300032025|Ga0318507_10032359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1960 | Open in IMG/M |
3300032025|Ga0318507_10396147 | Not Available | 601 | Open in IMG/M |
3300032067|Ga0318524_10653965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
3300032068|Ga0318553_10102098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1463 | Open in IMG/M |
3300032160|Ga0311301_11546896 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
3300032261|Ga0306920_101885862 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300032805|Ga0335078_10142181 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3406 | Open in IMG/M |
3300032828|Ga0335080_12249500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 523 | Open in IMG/M |
3300032895|Ga0335074_11412888 | Not Available | 562 | Open in IMG/M |
3300032896|Ga0335075_10627673 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1054 | Open in IMG/M |
3300032898|Ga0335072_11596750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Nocardiopsaceae → Streptomonospora → Streptomonospora salina | 551 | Open in IMG/M |
3300032955|Ga0335076_10761757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 850 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.59% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.63% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.15% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.15% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.93% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.44% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.70% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.96% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.48% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.48% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.48% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.48% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.48% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.74% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.74% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.74% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.74% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.74% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.74% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.74% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.74% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.74% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.74% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.74% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.74% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.74% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022840 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027031 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0062387_1006454701 | 3300004091 | Bog Forest Soil | ALGSAGGVTSITMIDNEGRDKDTVSSLSGGENFSATWVRSN* |
Ga0062388_1026311273 | 3300004635 | Bog Forest Soil | LANGAAIGNAGGLTEIVMIDSEGRDRDSVSSLSGGENFSATWIRDN* |
Ga0066690_102038823 | 3300005177 | Soil | GSTANGSAIGSAGGVTQIIMIDGAGRDKDTVSGLTSGENFSATWLRSN* |
Ga0066388_1004956753 | 3300005332 | Tropical Forest Soil | MANGAALGNAGGMTQIIMVDSAGRDKDTVSSLTGGENFSATWLRSN* |
Ga0070671_1016328592 | 3300005355 | Switchgrass Rhizosphere | GAALGNAGGVTKITMINNSGQAKDRISSLSSGTSFSATWLRAN* |
Ga0070674_1004517532 | 3300005356 | Miscanthus Rhizosphere | LANFGTVHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0070667_1012976612 | 3300005367 | Switchgrass Rhizosphere | TVHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0070709_105685212 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | GSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0070713_1012157382 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | IGSAGGVTQIIMIDSAGRDKDTVSGVTSGENFSATWLRSN* |
Ga0070710_105128712 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0070708_1001685082 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MANGAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSN* |
Ga0070698_1002954943 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VNITGSTANGSAIGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLGSS* |
Ga0070761_109596892 | 3300005591 | Soil | ATVNGSALGNAGGLTAINLVDSEGQSMDTISALSGGENFSATWRRSS* |
Ga0066706_113313662 | 3300005598 | Soil | AGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSN* |
Ga0070766_103490172 | 3300005921 | Soil | ISLTSSEANGSAIGNAGGLTEIVMADSKGRNEDTVSSLTGGESFSATWLRSN* |
Ga0070766_107739071 | 3300005921 | Soil | VNFTGATVNGSALGNAGGLTAINLVDSEGQSMDTISALSGGENFSATWRRSS* |
Ga0070717_108423041 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0075029_1012558352 | 3300006052 | Watersheds | GNAGGVTQIIMIDNAGCDEDSVSSLSSGENFSATWLRSS* |
Ga0070716_1004898972 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LGNAGGVTEITMVNNSGQAKDSVSSLSGGENFSARWLRAN* |
Ga0075014_1006876991 | 3300006174 | Watersheds | ANGAALGNAGGVTQIIMIDNAGRDKDTVSSLTSGENFSATWLRSN* |
Ga0070765_1022502401 | 3300006176 | Soil | ILPLADFGTVSMAGSQANRAALGNAGGLTQIVMIDGAGLGKDTVSALATGENFTATWLGSN* |
Ga0097621_1003083101 | 3300006237 | Miscanthus Rhizosphere | NFGTVNITGSLANGAALGNAGGVTKITMINNSGQAKDRISSLSSGTSFSATWLRAN* |
Ga0079222_100750091 | 3300006755 | Agricultural Soil | IGSAGGVTQIIMIDSAGRDKDTVSGLTRGENFTATWLRSN* |
Ga0079222_103716492 | 3300006755 | Agricultural Soil | PLANFGTVHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTISSLTSGENFTATWLRST* |
Ga0075436_1001929103 | 3300006914 | Populus Rhizosphere | LGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0116214_12708112 | 3300009520 | Peatlands Soil | GSAGGVTQIVMIDNARSDKDRVSSLSGEGTFSATWLGSS* |
Ga0116220_103124931 | 3300009525 | Peatlands Soil | TANGAALGNAGGVTQIIMIDNSGRDKDTVSSLSSGENFSATWLRSN* |
Ga0105238_127421621 | 3300009551 | Corn Rhizosphere | SAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN* |
Ga0105249_134901891 | 3300009553 | Switchgrass Rhizosphere | GNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN* |
Ga0116215_14795311 | 3300009672 | Peatlands Soil | GGLTQIIMIDNAGRDKDSVPSLTCGENFSATWLRSN* |
Ga0116216_106239382 | 3300009698 | Peatlands Soil | ANGSAIGNAGGLTQIIMIDNAGRDKDSVSALTGGENFSATWLRSN* |
Ga0116216_106991882 | 3300009698 | Peatlands Soil | ANGSAIGNAGGLTQIIMIDNAGRDKDSVPSLTSGENFSATWLRSN* |
Ga0116217_101847841 | 3300009700 | Peatlands Soil | GAALGSADGVTPIIMIDKAGSDKDSVSPLSGGENFSATWLRSS* |
Ga0116217_101917252 | 3300009700 | Peatlands Soil | LGAALGNAGGVTQIIMIDNSGRDKDTVSSLSSGENFSATWLRSN* |
Ga0127503_101378741 | 3300010154 | Soil | GTVHVTGSTANGSAIGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSS* |
Ga0134080_105120791 | 3300010333 | Grasslands Soil | STANGSAIGSAGGVTQIIMIDGAGRDKDTVSGLTSGENFSATWLRSN* |
Ga0126372_105640531 | 3300010360 | Tropical Forest Soil | LANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSAENFSATWLRSN* |
Ga0126378_101071591 | 3300010361 | Tropical Forest Soil | MANGAALGNAGGVTQIIMVDSAGRDKDTVSSLTGGENFSATWLRSN* |
Ga0134125_113691482 | 3300010371 | Terrestrial Soil | MANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN* |
Ga0136449_1023740362 | 3300010379 | Peatlands Soil | MSNYGPTQIIMIDSAGRDKDSVSSLSGNAFTATWLRSN* |
Ga0136449_1034551291 | 3300010379 | Peatlands Soil | NAGGVTQIIMIDNSGRDKDTVSSLSSGENFSATWLRSN* |
Ga0134126_114953061 | 3300010396 | Terrestrial Soil | MANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0126361_104442561 | 3300010876 | Boreal Forest Soil | GGVTGITMVDNSGRDKDTISSLSGGENFSATWVRSN* |
Ga0137776_13081382 | 3300010937 | Sediment | VHITGSLANGAALGNAGGVTQIIMVDSAGRDKDSVSSLTSGENFSATWLRSS* |
Ga0137362_114106332 | 3300012205 | Vadose Zone Soil | GSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSN* |
Ga0137386_106633241 | 3300012351 | Vadose Zone Soil | NAGGVTQIIMVDSAGQDKDSVSSLTSGENFSATWLRSN* |
Ga0137385_104912021 | 3300012359 | Vadose Zone Soil | ITGSLANGSALGNAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSN* |
Ga0137360_118097681 | 3300012361 | Vadose Zone Soil | NTVSITGSTANGAALGNAGGVTQIIMVDSAGRHKDTVSSLSGGENFSATWLRSN* |
Ga0157320_10108191 | 3300012481 | Arabidopsis Rhizosphere | PLANFGTVHITGSLANGSALGNAGGVTQIIMIDSAGQDKDTVSSLTSKENFTATWLRSN* |
Ga0157345_10559721 | 3300012498 | Arabidopsis Rhizosphere | LANFGTVHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0157371_100671533 | 3300013102 | Corn Rhizosphere | ANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0157372_117852911 | 3300013307 | Corn Rhizosphere | NAGGVTEITMVNNSGQAKDSVSALSGGENFSARWLRAN* |
Ga0181537_107855271 | 3300014201 | Bog | IGNAGGLTEIIMIDNSGRDKDTISALSGGEAFSATWLRSN* |
Ga0157380_101547273 | 3300014326 | Switchgrass Rhizosphere | VTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN* |
Ga0182024_128004351 | 3300014501 | Permafrost | FSPTEIIMINNSGTPKDSISSLSGGTSFTATWLRSN* |
Ga0132257_1007928771 | 3300015373 | Arabidopsis Rhizosphere | NGAALGNAGGVTQIIMIDSVGRDKDTVSSLTSGENFTATWLRSN* |
Ga0187812_12479371 | 3300017821 | Freshwater Sediment | DANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGTSFSATWLRSN |
Ga0187807_10301821 | 3300017926 | Freshwater Sediment | TGSDANGSALGNAGGVTEIIMVDNAGRDKDSISALSGGTSFSATWLRSN |
Ga0187807_13024811 | 3300017926 | Freshwater Sediment | MSFTSSDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGENFSATWLRSN |
Ga0187806_10673632 | 3300017928 | Freshwater Sediment | MSFTSSDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGTSFS |
Ga0187814_101618781 | 3300017932 | Freshwater Sediment | MSFTGSDANGGAIGNAGGVTQIIMVDNRGLDKDTVSSLSGGTSFSATWLRSN |
Ga0187814_102039321 | 3300017932 | Freshwater Sediment | GTAGGVTQLIMVDNRGLDKDTISSLSGGTSFSATWLRSN |
Ga0187847_105703822 | 3300017948 | Peatland | GNAGGVTEIIMIDNEGRDKDTVTSLSGGENFSATWVRSN |
Ga0187817_102114292 | 3300017955 | Freshwater Sediment | MSFTSSDANGGAIGNAGGVTQIIMVDNRGLDKDTISSLSGGTSFSATWLRSN |
Ga0187777_110333582 | 3300017974 | Tropical Peatland | STANGSAIGNAGGVTEILMIDNAGRDKDTISALSGGESFSATWERSN |
Ga0187815_100518124 | 3300018001 | Freshwater Sediment | PLTDFGTMSFTGSTDNGSAIGNAGGVTEIVMVDNAGRDKDSISALSGGESFSATWLRSN |
Ga0187871_105530562 | 3300018042 | Peatland | GVTEIIMIDNEGRDKDTVTSLSGGENFSATWVRSN |
Ga0187887_101513251 | 3300018043 | Peatland | NLTNSLANGAALGSAGGVTGITMVDNSGRDKDTISSLSGGENFSATWVRSN |
Ga0187890_102634211 | 3300018044 | Peatland | ANGSAIGNAGGLTEIIMQDSEGRDEDTVSNLSGGENFSATWVRSN |
Ga0187766_101800422 | 3300018058 | Tropical Peatland | AALGNAGGVTQIIMVDSAGRDKDTVSSLSGGEAFSATWLRST |
Ga0187772_100149027 | 3300018085 | Tropical Peatland | FSAPDANGSDIGNAGGVTQITMVDNRGLDKDSISSLSGGTGFSATWLRSS |
Ga0187769_108753962 | 3300018086 | Tropical Peatland | ADLGAAGGLTQIIMVDNSRRDKDSVSALTPSGVTGQDFSATWVASS |
Ga0193730_10220503 | 3300020002 | Soil | GGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN |
Ga0206354_103927173 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | MANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0210395_105043391 | 3300020582 | Soil | GGLTEIIMIDNAGRDKDTVSSLSGGENFSATWLRSN |
Ga0210404_103280231 | 3300021088 | Soil | WGRAGNGSAIGSAGGVTQIIMIDSAGRDKDTVSGLTSGENFSATWLRSS |
Ga0210405_109400802 | 3300021171 | Soil | AGNGSAIGSAGGVTQIIVIDSAGRDKDTVSGLTSGENFSATWLRST |
Ga0213881_100375843 | 3300021374 | Exposed Rock | AGGVTQIIMIDNAGRDKDTVSSLSGGENFSATWLRSN |
Ga0210397_103669492 | 3300021403 | Soil | VNITGSTANGAALSNAGGVTQIIMVDSAGRDKDTVSSLSGGANFSARWLRSN |
Ga0210383_113156212 | 3300021407 | Soil | GNADPTQIIMVDSAGRDKDSISSLSGGNSFTGTWLRAN |
Ga0210394_105877132 | 3300021420 | Soil | GSTANGAALGSVGGMTQIRMIDNAGRDKDIVSSLSSEGNFSATWLGSS |
Ga0210391_102968681 | 3300021433 | Soil | GGMTQIVMIDNAGRDKDIVSSLNSEGNFSATWLGSN |
Ga0210391_107092553 | 3300021433 | Soil | TVSLTGTTANGSAIGNAGGLTEIIMIDSAGRDKDTVSSLSSGENFSATWLRSN |
Ga0126371_100912722 | 3300021560 | Tropical Forest Soil | MANGAALGNAGGVTQIIMVDSAGRDKDTVSSLTGGENFSATWLRSN |
Ga0126371_120792953 | 3300021560 | Tropical Forest Soil | VNITGSLANGAAIGNAGGVTQIIMIDSQGRTRDSVSSLSGGENFSATWIRSN |
Ga0224712_101269361 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | HVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0224549_10170961 | 3300022840 | Soil | DFGTISLKSSEANGSAIGNAGGLTEIVMVDSEGRNEDTVSSLTGGESFSATWVRSN |
Ga0207692_104128742 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | GNFSPTQIIMVDGAGRAKDSISSLSGGNSFTATWLRAN |
Ga0207688_100653803 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN |
Ga0207684_114851692 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | GGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0207693_106415152 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | NGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0207663_111762312 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGGVTQIIMIDSAGRDKDTVSGVTSGENFSATWLRSN |
Ga0207663_115897311 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | GVTQIVMVDNAGRQKDSVSSLSGKENFSATWLRSN |
Ga0207700_113027741 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GSAIGSAGSVTQIIMIDSAGRDKDTVSGVTSGENFSATWLRSN |
Ga0257153_10326001 | 3300026490 | Soil | NAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSN |
Ga0209648_100334316 | 3300026551 | Grasslands Soil | DFGTMNFTGSTANGSAIGSAGGLTEIIMVDNAGRDKDSISSLSSGENFSATWLRSN |
Ga0208986_10219082 | 3300027031 | Forest Soil | ANFGTVHVTGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0209073_100671001 | 3300027765 | Agricultural Soil | ANGAALGNAGGVTKITMINNSGQAKDSVSSLSGGENFSATWLRAN |
Ga0209074_105078872 | 3300027787 | Agricultural Soil | HITGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0209693_104063571 | 3300027855 | Soil | NIAGSTANGAALGNAGGVTQIVMIDNAGRDKDTVSSLSGKENFSATWLRSN |
Ga0209169_1000055723 | 3300027879 | Soil | VNITSSMANGAAIGNAGGLTEIIMIDNEGRDKDTVSALSGGENFSATWVRSN |
Ga0209275_100064776 | 3300027884 | Soil | AIGNAGGLTSITMIDNEGRDKDTVSALSGGENFSATWVRSN |
Ga0209275_103239503 | 3300027884 | Soil | FTGATVNGSALGNAGGLTAINLVDSEGQSMDTISALSGGENFSATWRRSS |
Ga0209380_101419113 | 3300027889 | Soil | TANGAALGSVGGMTQIVMIDNAGRDKDIVSSLNSEGNFSATWLGSN |
Ga0209624_106546463 | 3300027895 | Forest Soil | FTGSMANGAAIGNAGGLTEIIMIDNSGRDKDTISSLSGGENFSATWLRSN |
Ga0209415_109116691 | 3300027905 | Peatlands Soil | GNFSPTEIIMIDNAGRDKDSVSSLSGGNSFKATWLRSN |
Ga0307313_100883122 | 3300028715 | Soil | LTGSMANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN |
Ga0307312_100882383 | 3300028828 | Soil | FGTVHLTGSMANGSAIGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFSATWLRSN |
Ga0308309_105079421 | 3300028906 | Soil | GNAGGLTEIIMIDNAGRDKDSISSLSGGESFSATWLRSN |
Ga0308309_112095641 | 3300028906 | Soil | SAIGNAGGLTEIIMIDNAGRDKDSISSLSGGENFSATWLRSN |
Ga0311369_107082992 | 3300029910 | Palsa | DFGTVNITSSEANGAAIGNAGGLTEIVMIDSEGRDRDSVSSLSGGENFSATWIRDN |
Ga0311352_100659173 | 3300029944 | Palsa | NGSAIGNAGGLTEIIMIDNSGRDKDTISALSGGEAFSATWLRSN |
Ga0311372_115324911 | 3300030520 | Palsa | GLTEIIMIDSEGRDRDSVSSLSGGENFSATWIRDN |
Ga0307482_11725071 | 3300030730 | Hardwood Forest Soil | GGAIGNAGGVTEIVMVDNSGRDKDSISALSGGTSFSATWLRST |
Ga0265460_103030142 | 3300030740 | Soil | VSLTGTTANGSAIGNAGGLTEIIMIDNAGRDKDSVSSLSGGENFSATWLRSS |
Ga0265459_139210941 | 3300030741 | Soil | GNAGGLTEIIMIDNEGRDKDTVSALSVGENFSATWVRSN |
Ga0170823_148452401 | 3300031128 | Forest Soil | MNFTGTTANGSAIGNAGGLTEIIMVDNAGRDKDSISTLSGGENFSATWLRSN |
Ga0302325_107301882 | 3300031234 | Palsa | SAPGCGSAIGNAGGLTEIIMVDSRGRDEDTVSSPSDGENFSATWVRSN |
Ga0302325_114260482 | 3300031234 | Palsa | GGLTEIVMIDSEGRDRDSVSSLSGGENFSATWIRDN |
Ga0310686_1046056742 | 3300031708 | Soil | IGNAGGLTEIIMIDNAGRDKDTVSSLSGGENFSATWLRSS |
Ga0318493_100473562 | 3300031723 | Soil | NAGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN |
Ga0310917_102252222 | 3300031833 | Soil | TGSLANGAALGNAGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN |
Ga0306925_101297271 | 3300031890 | Soil | GGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN |
Ga0318507_100323594 | 3300032025 | Soil | GSTANGAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSS |
Ga0318507_103961471 | 3300032025 | Soil | GSLANGAALGNAGGVTQIIMVDSAGRDKDTVSSLAGGENFSATWLRSN |
Ga0318524_106539651 | 3300032067 | Soil | VSITGSTANGAALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSATWLRSS |
Ga0318553_101020981 | 3300032068 | Soil | MSFTGSDANGSAIGNAGGVTEIIMVDNAGRDKDSISSLSGGTSFSATWLRSN |
Ga0311301_115468962 | 3300032160 | Peatlands Soil | GSAGGVTQIVMIDNARSDKDRVSSLSGEGTFSATWLGSS |
Ga0306920_1018858621 | 3300032261 | Soil | NGSALGNAGGVTQIIMVDNAGLDKDTVSSLSGGENFSATWVRSN |
Ga0335078_101421811 | 3300032805 | Soil | LGNAGGVTQIIMIDNAGRDKDTVSSLTSGENFTATWLRSN |
Ga0335080_122495002 | 3300032828 | Soil | ALGNAGGVTQIIMVDSAGRDKDTVSSLSGGENFSAHWLRSN |
Ga0335074_114128881 | 3300032895 | Soil | TMSFTSSDANGSAIGNAGGLTEIVMVDSAGRDKDSISSLSGGSSFSATWLRSN |
Ga0335075_106276731 | 3300032896 | Soil | MSFTSSDANGSAIGNAGGLTEIVMVDSAGRDKDSISSLSGGSSFSATWLRSN |
Ga0335072_115967501 | 3300032898 | Soil | NFGTVHITGSMANGAALGNAGGVTQIIMIDSAGRDKDTVSSLTSGENFTATWLRSN |
Ga0335076_107617571 | 3300032955 | Soil | MSFTSSDANGSAIGNAGGLTEIVMVDSAGRDKDSISSLSGGSSFSATWLPSN |
⦗Top⦘ |