NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F058137

Metagenome Family F058137

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058137
Family Type Metagenome
Number of Sequences 135
Average Sequence Length 42 residues
Representative Sequence MKKIRSVRVSEQLWRKAQAKARAEGKTVSEVIVDFLKEFVK
Number of Associated Samples 96
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 61.48 %
% of genes near scaffold ends (potentially truncated) 33.33 %
% of genes from short scaffolds (< 2000 bps) 73.33 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (58.519 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(20.000 % of family members)
Environment Ontology (ENVO) Unclassified
(60.741 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(59.259 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 42.03%    β-sheet: 0.00%    Coil/Unstructured: 57.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF09250Prim-Pol 51.85
PF01370Epimerase 5.19
PF02467Whib 2.96
PF13481AAA_25 2.22
PF01755Glyco_transf_25 1.48
PF00145DNA_methylase 1.48
PF12705PDDEXK_1 1.48
PF05257CHAP 0.74
PF02945Endonuclease_7 0.74
PF05135Phage_connect_1 0.74
PF00589Phage_integrase 0.74
PF04860Phage_portal 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG0270DNA-cytosine methylaseReplication, recombination and repair [L] 1.48
COG3306Glycosyltransferase involved in LPS biosynthesis, GR25 familyCell wall/membrane/envelope biogenesis [M] 1.48


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.63 %
UnclassifiedrootN/A30.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002212|metazooDRAFT_1359992All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300002408|B570J29032_109460062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage781Open in IMG/M
3300002476|metazooDRAFT_10818343Not Available628Open in IMG/M
3300002835|B570J40625_100090162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3874Open in IMG/M
3300004240|Ga0007787_10002464All Organisms → cellular organisms → Bacteria6698Open in IMG/M
3300005517|Ga0070374_10652196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300005525|Ga0068877_10002409All Organisms → cellular organisms → Bacteria15106Open in IMG/M
3300005581|Ga0049081_10111298All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1017Open in IMG/M
3300005581|Ga0049081_10172842Not Available783Open in IMG/M
3300005805|Ga0079957_1016913Not Available5223Open in IMG/M
3300006484|Ga0070744_10092540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage875Open in IMG/M
3300006637|Ga0075461_10000208All Organisms → cellular organisms → Bacteria15829Open in IMG/M
3300006637|Ga0075461_10041286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1507Open in IMG/M
3300006641|Ga0075471_10605478All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage537Open in IMG/M
3300006802|Ga0070749_10160616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1302Open in IMG/M
3300006802|Ga0070749_10280210Not Available939Open in IMG/M
3300006805|Ga0075464_10000924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage13094Open in IMG/M
3300006805|Ga0075464_10090454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1748Open in IMG/M
3300006805|Ga0075464_10314323All Organisms → cellular organisms → Bacteria944Open in IMG/M
3300006805|Ga0075464_10539387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales715Open in IMG/M
3300006805|Ga0075464_10599686All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage678Open in IMG/M
3300006917|Ga0075472_10174121All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1057Open in IMG/M
3300006917|Ga0075472_10328311Not Available755Open in IMG/M
3300006920|Ga0070748_1131469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales938Open in IMG/M
3300007216|Ga0103961_1353656Not Available1260Open in IMG/M
3300007538|Ga0099851_1024086All Organisms → cellular organisms → Bacteria2457Open in IMG/M
3300007538|Ga0099851_1055143Not Available1557Open in IMG/M
3300007734|Ga0104986_1719All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage25775Open in IMG/M
3300007973|Ga0105746_1291257Not Available565Open in IMG/M
3300008055|Ga0108970_11286181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2188Open in IMG/M
3300008107|Ga0114340_1077036Not Available1387Open in IMG/M
3300008107|Ga0114340_1158970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage821Open in IMG/M
3300008113|Ga0114346_1083270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1504Open in IMG/M
3300008114|Ga0114347_1060623All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1577Open in IMG/M
3300008266|Ga0114363_1006866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5656Open in IMG/M
3300008266|Ga0114363_1012289All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7035Open in IMG/M
3300008266|Ga0114363_1031019All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3427Open in IMG/M
3300008266|Ga0114363_1090881Not Available1116Open in IMG/M
3300008266|Ga0114363_1118783All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage922Open in IMG/M
3300008266|Ga0114363_1125422Not Available886Open in IMG/M
3300008266|Ga0114363_1191460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300008450|Ga0114880_1067028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1467Open in IMG/M
3300008450|Ga0114880_1100414All Organisms → Viruses → Predicted Viral1119Open in IMG/M
3300008450|Ga0114880_1132385Not Available921Open in IMG/M
3300009155|Ga0114968_10001932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15951Open in IMG/M
3300009158|Ga0114977_10415971Not Available747Open in IMG/M
3300009158|Ga0114977_10437945All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300010354|Ga0129333_10025566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5596Open in IMG/M
3300010370|Ga0129336_10202057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1130Open in IMG/M
3300011984|Ga0119931_1036447Not Available589Open in IMG/M
3300012012|Ga0153799_1073947Not Available614Open in IMG/M
3300012017|Ga0153801_1010014All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1733Open in IMG/M
3300013004|Ga0164293_10003125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage14121Open in IMG/M
3300013004|Ga0164293_10861562Not Available571Open in IMG/M
3300013004|Ga0164293_11032845Not Available511Open in IMG/M
3300013087|Ga0163212_1047680All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1448Open in IMG/M
(restricted) 3300013126|Ga0172367_10115495Not Available1851Open in IMG/M
(restricted) 3300013126|Ga0172367_10353042All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage847Open in IMG/M
(restricted) 3300013126|Ga0172367_10434684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
(restricted) 3300013131|Ga0172373_10354690Not Available927Open in IMG/M
(restricted) 3300013131|Ga0172373_10839525Not Available535Open in IMG/M
(restricted) 3300013132|Ga0172372_10272868All Organisms → Viruses → Predicted Viral1222Open in IMG/M
3300013372|Ga0177922_10121596Not Available767Open in IMG/M
3300013372|Ga0177922_11211369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
(restricted) 3300014720|Ga0172376_10494271Not Available686Open in IMG/M
3300017722|Ga0181347_1198237Not Available529Open in IMG/M
3300017736|Ga0181365_1126862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage610Open in IMG/M
3300017766|Ga0181343_1071697All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1000Open in IMG/M
3300017778|Ga0181349_1000286All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21402Open in IMG/M
3300017784|Ga0181348_1145364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage892Open in IMG/M
3300017785|Ga0181355_1279898Not Available632Open in IMG/M
3300018815|Ga0187845_1288760All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage517Open in IMG/M
3300018868|Ga0187844_10030970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2638Open in IMG/M
3300019784|Ga0181359_1000086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage17986Open in IMG/M
3300019784|Ga0181359_1090083Not Available1138Open in IMG/M
3300020083|Ga0194111_10483246All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage800Open in IMG/M
3300020084|Ga0194110_10746294All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300020159|Ga0211734_11355141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage866Open in IMG/M
3300020161|Ga0211726_10490141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1051Open in IMG/M
3300020183|Ga0194115_10172929All Organisms → cellular organisms → Bacteria1097Open in IMG/M
3300020190|Ga0194118_10313149Not Available833Open in IMG/M
3300020190|Ga0194118_10551713All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300020193|Ga0194131_10082952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1838Open in IMG/M
3300020570|Ga0208465_1021052Not Available859Open in IMG/M
3300020578|Ga0194129_10403586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage715Open in IMG/M
3300020578|Ga0194129_10510473All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300021091|Ga0194133_10423580Not Available727Open in IMG/M
3300021092|Ga0194122_10420558All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage673Open in IMG/M
3300021962|Ga0222713_10031979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4229Open in IMG/M
3300021962|Ga0222713_10375292Not Available882Open in IMG/M
3300021963|Ga0222712_10049095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3167Open in IMG/M
3300021963|Ga0222712_10250705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1132Open in IMG/M
3300022190|Ga0181354_1099380All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage949Open in IMG/M
3300022198|Ga0196905_1008793All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3405Open in IMG/M
3300022200|Ga0196901_1061640All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1376Open in IMG/M
3300022407|Ga0181351_1048870All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1770Open in IMG/M
3300022752|Ga0214917_10001938All Organisms → cellular organisms → Bacteria25941Open in IMG/M
3300023174|Ga0214921_10002940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage26896Open in IMG/M
3300025445|Ga0208424_1000399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5285Open in IMG/M
3300025630|Ga0208004_1000462All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15820Open in IMG/M
3300025655|Ga0208795_1069356Not Available997Open in IMG/M
3300025655|Ga0208795_1084895Not Available871Open in IMG/M
3300025896|Ga0208916_10000979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage12565Open in IMG/M
3300025896|Ga0208916_10010312Not Available3637Open in IMG/M
3300027130|Ga0255089_1046996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage680Open in IMG/M
3300027659|Ga0208975_1064886All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1098Open in IMG/M
3300027759|Ga0209296_1059039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1968Open in IMG/M
3300027764|Ga0209134_10314632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300027785|Ga0209246_10236202All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage710Open in IMG/M
3300027963|Ga0209400_1031453All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2947Open in IMG/M
(restricted) 3300027977|Ga0247834_1022307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4473Open in IMG/M
(restricted) 3300028553|Ga0247839_1191599Not Available844Open in IMG/M
(restricted) 3300028559|Ga0247831_1293810Not Available545Open in IMG/M
3300031758|Ga0315907_10002694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage21993Open in IMG/M
3300031787|Ga0315900_10070417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3558Open in IMG/M
3300031857|Ga0315909_10042706All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4269Open in IMG/M
3300031857|Ga0315909_10250445Not Available1360Open in IMG/M
3300031857|Ga0315909_10548758All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300031951|Ga0315904_10900352Not Available714Open in IMG/M
3300031963|Ga0315901_10132254All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2255Open in IMG/M
3300032093|Ga0315902_10375979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1299Open in IMG/M
3300033482|Ga0316627_100607915Not Available997Open in IMG/M
3300033993|Ga0334994_0168489All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300033996|Ga0334979_0000761All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage24291Open in IMG/M
3300033996|Ga0334979_0091823All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1902Open in IMG/M
3300033996|Ga0334979_0134963Not Available1506Open in IMG/M
3300033996|Ga0334979_0614715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage575Open in IMG/M
3300034062|Ga0334995_0065431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2887Open in IMG/M
3300034062|Ga0334995_0622125All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage623Open in IMG/M
3300034073|Ga0310130_0089906Not Available919Open in IMG/M
3300034073|Ga0310130_0269639Not Available538Open in IMG/M
3300034106|Ga0335036_0018089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5696Open in IMG/M
3300034112|Ga0335066_0381420All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300034272|Ga0335049_0784877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage566Open in IMG/M
3300034283|Ga0335007_0624409Not Available618Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater20.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.04%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake11.11%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake10.37%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.15%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.93%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.70%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.22%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.48%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake1.48%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.48%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.74%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.74%
Drinking Water Treatment PlantEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.74%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.74%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.74%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002212Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002476Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004240Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SNEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007216Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007734Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015JanEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300011984Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107EnvironmentalOpen in IMG/M
3300012012Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013087Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30LEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017766Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017784Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018815Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68EnvironmentalOpen in IMG/M
3300018868Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021092Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10mEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300025445Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027130Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8dEnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027977 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12mEnvironmentalOpen in IMG/M
3300028553 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16mEnvironmentalOpen in IMG/M
3300028559 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1mEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033482Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_CEnvironmentalOpen in IMG/M
3300033993Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034283Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
metazooDRAFT_135999223300002212LakeMKKIRSVRVSDQLWARAKAKAQSEGKTISEVIVDYLKEFVK*
B570J29032_10946006253300002408FreshwaterMIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
metazooDRAFT_1081834313300002476LakeMKKIRSVRVSDKLWAQAKAKARSEGKTVSEVIVDYLKEFVK*
B570J40625_10009016293300002835FreshwaterMCGVVMIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
Ga0007787_1000246433300004240Freshwater LakeMKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFIK*
Ga0070374_1065219613300005517Freshwater LakeVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
Ga0068877_10002409183300005525Freshwater LakeMKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK*
Ga0049081_1011129833300005581Freshwater LenticMKKIRSIRVSEQLWRRAQAKARAEGKSLSEAINDFLKEYVK*
Ga0049081_1017284223300005581Freshwater LenticMKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFVK*
Ga0079957_101691363300005805LakeMKKIRSVRVSDQLWARAKAKARAEGKTVSEVIVDFLKEFVK*
Ga0070744_1009254033300006484EstuarineMTPKPARSVRVSQKLWQQAKAKAKSEGKTVSEIIIDSLKEYVK*
Ga0075461_10000208123300006637AqueousVKKIRSVRVSDQLWARAKAKARSEGKTISEVIVDFLKEFVK*
Ga0075461_1004128623300006637AqueousMKKIRSVRVSEQLWRRAQAKAKAEGKTVSEVIVDFLKEFVK*
Ga0075471_1060547813300006641AqueousVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK*
Ga0070749_1016061623300006802AqueousMKKIRSIRVSEQLWRKAMAKAKSEGTTVSEVIVDFLKEFVK*
Ga0070749_1028021033300006802AqueousMKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFL
Ga0075464_10000924233300006805AqueousMKLKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK*
Ga0075464_1009045443300006805AqueousMKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFVK*
Ga0075464_1031432323300006805AqueousMKKIRSVRVSDQLWRRAQAKARSEGKTVSEAINDFLKEFIK*
Ga0075464_1053938713300006805AqueousVKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK*
Ga0075464_1059968633300006805AqueousMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
Ga0075472_1017412153300006917AqueousMKKIRSVRVSEQLWRTAQAKGKGEGKTVSEVIVDFLKEFV
Ga0075472_1032831113300006917AqueousMKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEF
Ga0070748_113146913300006920AqueousMKKIRSVRVSEQLWRKAQAKARAEGKTVSEVIVDFLKEFVK*
Ga0103961_135365643300007216Freshwater LakeMKKIRSIRVSDQLWAKAKAKARSEGKTVSEVVVDFLKEFVK
Ga0099851_102408643300007538AqueousMKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKEFVK*
Ga0099851_105514333300007538AqueousVIGKKKRSVRVSDQVWFKAKAKAALEGTTVSEVIVDFLKGYIK*
Ga0104986_1719273300007734FreshwaterMVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKGYIK*
Ga0105746_129125733300007973Estuary WaterMKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFVK*
Ga0108970_1128618123300008055EstuaryMKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFIK*
Ga0114340_107703613300008107Freshwater, PlanktonMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKG
Ga0114340_115897033300008107Freshwater, PlanktonGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
Ga0114346_108327043300008113Freshwater, PlanktonMCGVVMVGKKIRSVRVSDQVWAKAKEKAQSEGKSVSEVIVDFLKGYIK*
Ga0114347_106062313300008114Freshwater, PlanktonVRLSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK*
Ga0114363_100686653300008266Freshwater, PlanktonMKKIRSVRVSDQLWRKAQARARAEGKSLSEAINDFLKEYVK*
Ga0114363_1012289133300008266Freshwater, PlanktonMKKIRSIRVSEQLWRRAMVKAKSEGKTVSEVIVDFLKEFVK*
Ga0114363_103101953300008266Freshwater, PlanktonMTGKKARSVRVSDQVWAKAKAKAKEEGTTVSELIVDFLKAYIK*
Ga0114363_109088133300008266Freshwater, PlanktonMKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFV
Ga0114363_111878313300008266Freshwater, PlanktonKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK*
Ga0114363_112542243300008266Freshwater, PlanktonMYGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
Ga0114363_119146033300008266Freshwater, PlanktonKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK*
Ga0114880_106702843300008450Freshwater LakeMKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK*
Ga0114880_110041453300008450Freshwater LakeMKKIRSVRVSDQLWRKARAKARAEGKSLSEAINDFLKE
Ga0114880_113238513300008450Freshwater LakeMKKIRSIRISEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK*
Ga0114968_10001932123300009155Freshwater LakeMVGKKIRSVRVSEQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK*
Ga0114977_1041597113300009158Freshwater LakeMVGKKIRSVRVSDQVWAKAKAKAKSEGKSVSEVIVDFLKGYIK*
Ga0114977_1043794523300009158Freshwater LakeMVGKKVRSVRVSDQLWARAMAKARSEGKSVSEVIVDFLKGYIK*
Ga0129333_10025566123300010354Freshwater To Marine Saline GradientVQVQQEGEEMKKIRSIRVSDQLWAKAKAKARAEGKTLSEVVVDFLKEFVK*
Ga0129336_1020205713300010370Freshwater To Marine Saline GradientMNKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK*
Ga0119931_103644723300011984Drinking Water Treatment PlantMKKIRSIRVSEQLWRRAMAKAKSEGKTVSEVIVDFLKEFVK*
Ga0153799_107394723300012012FreshwaterMKKIRSIRVSEQLWRKAQAKARAEGKTVSEAINDFLKEYVK*
Ga0153801_101001413300012017FreshwaterVMKLKKIRSVRVSDQLWRKAQAKARSEGKTVSEAINDFLKEFVK*
Ga0164293_10003125133300013004FreshwaterMVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKEYIK*
Ga0164293_1086156223300013004FreshwaterMKKIRSVRVSDQLWRKAQAKAKSEGKTVSEAINDFLKEFIK*
Ga0164293_1103284523300013004FreshwaterMKKIRSIRVSEQLWRRAQAKARAEGKTVSEAINDFLKEYVK*
Ga0163212_104768013300013087FreshwaterLKAKVMSLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK*
(restricted) Ga0172367_1011549563300013126FreshwaterVQVQQEGEEMKKIRSIRVSDQLWAKAQAKARAEGKSLSEAINDFLKQYVK*
(restricted) Ga0172367_1035304233300013126FreshwaterMKKIRSIRVSEQLWRKAQAKARAEGKSLSEAINDFLKGYVK*
(restricted) Ga0172367_1043468433300013126FreshwaterSVQVQQEGEEMKKIRSIRVSDQLWAKAQAKARAEGKSLSEAINDFLKQYVK*
(restricted) Ga0172373_1035469013300013131FreshwaterMTGKKARSVRVSDQVWAKAKAKAKAEGMTVSEVIVDF
(restricted) Ga0172373_1083952513300013131FreshwaterMKKIRSVRVSDQLWRKAQAKAKAEGKSLSEAINDFLKGY
(restricted) Ga0172372_1027286813300013132FreshwaterMTGKKARSVRVSDQVWAKAKAKAKAEGMTVSEVIVDFLKAYIK*
Ga0177922_1012159643300013372FreshwaterMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK*
Ga0177922_1121136923300013372FreshwaterMKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFIK*
(restricted) Ga0172376_1049427133300014720FreshwaterMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKGYVK*
Ga0181347_119823713300017722Freshwater LakeMKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKE
Ga0181365_112686213300017736Freshwater LakeNRSVRIAEQLWRKAQAKAKAEGKTASEVIVDFLKEYIK
Ga0181343_107169723300017766Freshwater LakeMVGKKIRSVRVSDQLWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0181349_100028623300017778Freshwater LakeMVGKKIRSVRVSDQVWAKAKSKAKSEGKSVSEVIVDFLKGYIK
Ga0181348_114536413300017784Freshwater LakeSKAKVMKLKKIRSVRVSDQLWRRAQAKARAEGKSLSEAINDFLKEYVK
Ga0181355_127989823300017785Freshwater LakeMKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFIK
Ga0187845_128876013300018815FreshwaterMCVVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSLSEVIVDFLKGYIK
Ga0187844_1003097033300018868FreshwaterMVGKKIRSVRVSDQVWAKAKAKAQSEGKSLSEVIVDFLKGYIK
Ga0181359_1000086103300019784Freshwater LakeMCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0181359_109008323300019784Freshwater LakeMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0194111_1048324623300020083Freshwater LakeMKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194110_1074629433300020084Freshwater LakeMKAKEMKMKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0211734_1135514133300020159FreshwaterMVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKGYIK
Ga0211726_1049014113300020161FreshwaterGWCIMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK
Ga0194115_1017292953300020183Freshwater LakeMKKIRSIRVSDQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194118_1031314913300020190Freshwater LakeMNLLKAKVMKLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194118_1055171323300020190Freshwater LakeVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194131_1008295253300020193Freshwater LakeMNLMKAKVMKLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0208465_102105223300020570FreshwaterMKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFIK
Ga0194129_1040358613300020578Freshwater LakeKIRSVRVSDQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194129_1051047323300020578Freshwater LakeLKKIRSVRVSDQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194133_1042358023300021091Freshwater LakeMKLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0194122_1042055833300021092Freshwater LakeMNLMKAKVMSLKKIRSVRVADQLWRKAKAKARAEGKSLSEAINDFLKEYVK
Ga0222713_1003197923300021962Estuarine WaterMTPKPARSVRVSQKLWQQAKAKAKSEGKTVSEIIIDSLKEYVK
Ga0222713_1037529253300021962Estuarine WaterMKKIRSIRVSEQLWRRAQAKAKSEGKTVSEAINDFLKEFV
Ga0222712_10049095103300021963Estuarine WaterMVGKKIRSVRVSDQLWRKAMAKAHSEGKSVSEVIVDFLKGYIK
Ga0222712_1025070523300021963Estuarine WaterMKKIRSVRVSEQLWRKAQAKAKAEGKTVSEVIVDFLKEFVK
Ga0181354_109938013300022190Freshwater LakeMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFL
Ga0196905_100879323300022198AqueousMKKIRSVRVSDQLWARAKARARSEGKTISEVIVDFLKEFVK
Ga0196901_106164013300022200AqueousMKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKEFVK
Ga0181351_104887083300022407Freshwater LakeMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLN
Ga0214917_10001938333300022752FreshwaterMKKIRSIRVSEQLWRRAMAKAKSEGKTVSEVIVDFLKEFVK
Ga0214921_10002940353300023174FreshwaterMCGVVMVGKKIRSVRVSDQVWAKAKSKAQSEGKSVSEVIVDFLKGYIK
Ga0208424_1000399143300025445AqueousMKKIRSVRVSEQLWRRAQAKAKAEGKTVSEVIVDFLKEFVK
Ga0208004_1000462233300025630AqueousVKKIRSVRVSDQLWARAKAKARSEGKTISEVIVDFLKEFVK
Ga0208795_106935613300025655AqueousMKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKE
Ga0208795_108489533300025655AqueousVIGKKKRSVRVSDQVWFKAKAKAALEGTTVSEVIVDFLKGYIK
Ga0208916_1000097963300025896AqueousMKLKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK
Ga0208916_1001031243300025896AqueousMKKIRSIRVSEQLWRRAQAKARSEGKTVSEAINDFLKEFVK
Ga0255089_104699613300027130FreshwaterMKKNRSVRIAEQLWRKAQAKAKAEGKTASEVIVDFLKEYIK
Ga0208975_106488643300027659Freshwater LenticNLLRAKVMKLKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK
Ga0209296_105903943300027759Freshwater LakeMVGKKIRSVRVSDQVWAKAKAKAKSEGKSVSEVIVDFLKGYIK
Ga0209134_1031463223300027764Freshwater LakeCIMKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFVK
Ga0209246_1023620213300027785Freshwater LakeLKKIRSVRVSDQLWRRAQAKARAEGKSLSEAINDFLKEYVK
Ga0209400_103145323300027963Freshwater LakeMCGVVMVGKKIRSVRVSEQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK
(restricted) Ga0247834_102230713300027977FreshwaterMKKIRSVRVSNQLWRKAQAKARAEGKSLSEAINDFLKEYVK
(restricted) Ga0247839_119159943300028553FreshwaterMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFL
(restricted) Ga0247831_129381023300028559FreshwaterMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLK
Ga0315907_10002694183300031758FreshwaterMKKIRSIRVSEQLWRRAMVKAKSEGKTVSEVIVDFLKEFVK
Ga0315900_10070417113300031787FreshwaterMTGKKARSVRVSDQVWAKAKAKAKEEGTTVSELIVDFLKAYIK
Ga0315909_1004270683300031857FreshwaterMKKIRSVRVSDQLWRKAQARARAEGKSLSEAINDFLKEYVK
Ga0315909_1025044573300031857FreshwaterMCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFL
Ga0315909_1054875813300031857FreshwaterKKGGCIMKKIRSVRVSDQLWRKAQAKARAEGKSLSEAINDFLKEYVK
Ga0315904_1090035213300031951FreshwaterMKKIRSIRVSEQLWRKAMAKAKSEGKTVSEVIVDFLKEFVK
Ga0315901_1013225443300031963FreshwaterMKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFVK
Ga0315902_1037597933300032093FreshwaterMKLKKIRSVRVSDQLWRKAQAKARSEGKTVSEAINDFLKEFIK
Ga0316627_10060791533300033482SoilMQMQSKGKQMKKIRSVRVSDQLWAKAKAKAKSEGKTVSEVIVDFLKEFVK
Ga0334994_0168489_513_6593300033993FreshwaterMCGVVMIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0334979_0000761_14283_144143300033996FreshwaterMVGKKVRSVRVSDQLWARAMAKAKSEGKSVSEVIVDFLKEYIK
Ga0334979_0091823_1629_17543300033996FreshwaterMKKIRSIRVSEQLWRKAQAKAWSEGKTVSEAINDFLKEFIK
Ga0334979_0134963_7_1383300033996FreshwaterMKLKKIRSIRVSEQLWRKAQAKARSEGKTVSEAINDFLKEFIK
Ga0334979_0614715_439_5703300033996FreshwaterMKLKKIRSIRVSEQLWRRAQAKARAEGKTVSEAINDFLKEYVK
Ga0334995_0065431_1542_16733300034062FreshwaterMIGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0334995_0622125_244_3723300034062FreshwaterMMKKIRSIRVSDQLWAKAKAKARSEGKTVSEVIVDYLKEFVK
Ga0310130_0089906_766_8913300034073Fracking WaterVKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDFLKEFVK
Ga0310130_0269639_2_1063300034073Fracking WaterMKKIRSVRVSDQLWARAKAKARSEGKTVSEVIVDF
Ga0335036_0018089_3852_39983300034106FreshwaterMCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEDKSVSEVIVDFLKGYIK
Ga0335066_0381420_1_1143300034112FreshwaterRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0335049_0784877_74_2203300034272FreshwaterMCGVVMVGKKIRSVRVSDQLWAKAKAKAQSEGKSVSEVIVDFLKGYIK
Ga0335007_0624409_491_6163300034283FreshwaterMCGVVMVGKKIRSVRVSDQVWAKAKAKAQSEGKSVSEVIVDF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.