NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058124

Metagenome / Metatranscriptome Family F058124

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058124
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 51 residues
Representative Sequence VTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER
Number of Associated Samples 111
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.44 %
% of genes near scaffold ends (potentially truncated) 42.96 %
% of genes from short scaffolds (< 2000 bps) 94.07 %
Associated GOLD sequencing projects 103
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (71.852 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.741 % of family members)
Environment Ontology (ENVO) Unclassified
(32.593 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.185 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 46.05%    β-sheet: 0.00%    Coil/Unstructured: 53.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF03473MOSC 20.74
PF05690ThiG 6.67
PF03476MOSC_N 5.19
PF08241Methyltransf_11 5.19
PF07883Cupin_2 3.70
PF12088DUF3565 2.96
PF03006HlyIII 2.96
PF14145YrhK 2.22
PF00102Y_phosphatase 1.48
PF13669Glyoxalase_4 1.48
PF07136DUF1385 1.48
PF03795YCII 1.48
PF13847Methyltransf_31 1.48
PF07885Ion_trans_2 0.74
PF01039Carboxyl_trans 0.74
PF00376MerR 0.74
PF12681Glyoxalase_2 0.74
PF03575Peptidase_S51 0.74
PF14023DUF4239 0.74
PF13673Acetyltransf_10 0.74
PF01680SOR_SNZ 0.74
PF01565FAD_binding_4 0.74
PF00801PKD 0.74
PF02073Peptidase_M29 0.74
PF13466STAS_2 0.74
PF00561Abhydrolase_1 0.74
PF03459TOBE 0.74
PF07859Abhydrolase_3 0.74
PF06224HTH_42 0.74
PF13527Acetyltransf_9 0.74

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 135 Family Scaffolds
COG0214Pyridoxal 5'-phosphate synthase subunit PdxSCoenzyme transport and metabolism [H] 7.41
COG2022Thiazole synthase ThiGH, ThiG subunit (thiamin biosynthesis)Coenzyme transport and metabolism [H] 6.67
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 6.67
COG3217N-hydroxylaminopurine reductase subunit YcbX, contains MOSC domainDefense mechanisms [V] 5.19
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 2.96
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.48
COG2453Protein-tyrosine phosphataseSignal transduction mechanisms [T] 1.48
COG3872Uncharacterized conserved protein YqhQ, DUF1385 familyFunction unknown [S] 1.48
COG5599Protein tyrosine phosphataseSignal transduction mechanisms [T] 1.48
COG0657Acetyl esterase/lipaseLipid transport and metabolism [I] 0.74
COG0777Acetyl-CoA carboxylase beta subunitLipid transport and metabolism [I] 0.74
COG0825Acetyl-CoA carboxylase alpha subunitLipid transport and metabolism [I] 0.74
COG2309Leucyl aminopeptidase (aminopeptidase T)Amino acid transport and metabolism [E] 0.74
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.74
COG4799Acetyl-CoA carboxylase, carboxyltransferase componentLipid transport and metabolism [I] 0.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.59 %
UnclassifiedrootN/A27.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664021|ICCgaii200_c1060529All Organisms → cellular organisms → Bacteria1678Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101671751Not Available511Open in IMG/M
3300001534|A15PFW1_10308253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300002568|C688J35102_119965911All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300002568|C688J35102_120673115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1330Open in IMG/M
3300002568|C688J35102_120776655All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300002568|C688J35102_120778254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1553Open in IMG/M
3300002568|C688J35102_120819056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1683Open in IMG/M
3300003659|JGI25404J52841_10106077Not Available590Open in IMG/M
3300004006|Ga0055453_10254353Not Available560Open in IMG/M
3300004081|Ga0063454_100022019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2047Open in IMG/M
3300004114|Ga0062593_102498521All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300004114|Ga0062593_102621232Not Available573Open in IMG/M
3300004153|Ga0063455_101341918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria548Open in IMG/M
3300004156|Ga0062589_101692630Not Available630Open in IMG/M
3300004156|Ga0062589_101961270All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300004157|Ga0062590_100733144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300004463|Ga0063356_101724369Not Available938Open in IMG/M
3300004479|Ga0062595_100730644Not Available801Open in IMG/M
3300004479|Ga0062595_101027700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium711Open in IMG/M
3300005093|Ga0062594_100059016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2027Open in IMG/M
3300005163|Ga0066823_10011202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1272Open in IMG/M
3300005294|Ga0065705_10222908All Organisms → cellular organisms → Bacteria1310Open in IMG/M
3300005329|Ga0070683_101626617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales621Open in IMG/M
3300005329|Ga0070683_101902598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium572Open in IMG/M
3300005330|Ga0070690_100557129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium865Open in IMG/M
3300005334|Ga0068869_101447983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300005335|Ga0070666_11110483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300005336|Ga0070680_100560102All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005337|Ga0070682_101345041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidimicrobium → Acidimicrobium ferrooxidans → Acidimicrobium ferrooxidans DSM 10331608Open in IMG/M
3300005337|Ga0070682_101701879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300005339|Ga0070660_100188100All Organisms → cellular organisms → Bacteria1672Open in IMG/M
3300005340|Ga0070689_100465138All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300005340|Ga0070689_100671794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium903Open in IMG/M
3300005341|Ga0070691_10091333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1502Open in IMG/M
3300005343|Ga0070687_101262296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300005345|Ga0070692_10107481All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300005353|Ga0070669_101500300Not Available586Open in IMG/M
3300005356|Ga0070674_100155301Not Available1731Open in IMG/M
3300005356|Ga0070674_100863750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium786Open in IMG/M
3300005438|Ga0070701_10965913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300005459|Ga0068867_101133182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300005526|Ga0073909_10096051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1164Open in IMG/M
3300005535|Ga0070684_100916543All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300005545|Ga0070695_100114970All Organisms → cellular organisms → Bacteria1832Open in IMG/M
3300005560|Ga0066670_10591929Not Available676Open in IMG/M
3300005564|Ga0070664_100694479All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300005577|Ga0068857_101866639Not Available588Open in IMG/M
3300005578|Ga0068854_100528369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria997Open in IMG/M
3300005614|Ga0068856_101103795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium811Open in IMG/M
3300005843|Ga0068860_101427491All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300005844|Ga0068862_102010929All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300005886|Ga0075286_1041499Not Available629Open in IMG/M
3300005983|Ga0081540_1005437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9505Open in IMG/M
3300006574|Ga0074056_11560389All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300006755|Ga0079222_10413665All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300006881|Ga0068865_100373095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1162Open in IMG/M
3300009545|Ga0105237_10555620Not Available1155Open in IMG/M
3300009553|Ga0105249_12353891All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Saccharomycotina → Saccharomycetes → Saccharomycetales → Trichomonascaceae → Sugiyamaella → Sugiyamaella lignohabitans605Open in IMG/M
3300010039|Ga0126309_10118486All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1386Open in IMG/M
3300010333|Ga0134080_10390873Not Available642Open in IMG/M
3300010371|Ga0134125_10626287All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300010371|Ga0134125_11363301Not Available773Open in IMG/M
3300010373|Ga0134128_12212225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium606Open in IMG/M
3300010375|Ga0105239_13171995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300010396|Ga0134126_10375114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1655Open in IMG/M
3300010399|Ga0134127_10881884Not Available949Open in IMG/M
3300010403|Ga0134123_10624002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1040Open in IMG/M
3300012200|Ga0137382_10342157Not Available1048Open in IMG/M
3300012208|Ga0137376_11041073Not Available701Open in IMG/M
3300012496|Ga0157353_1026799Not Available591Open in IMG/M
3300012892|Ga0157294_10026474All Organisms → cellular organisms → Bacteria1178Open in IMG/M
3300012910|Ga0157308_10383929Not Available540Open in IMG/M
3300012915|Ga0157302_10026007All Organisms → cellular organisms → Bacteria → Terrabacteria group1512Open in IMG/M
3300012915|Ga0157302_10520406Not Available518Open in IMG/M
3300012955|Ga0164298_10051358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1984Open in IMG/M
3300012957|Ga0164303_10272483Not Available982Open in IMG/M
3300012984|Ga0164309_10903048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium720Open in IMG/M
3300012986|Ga0164304_10642686All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300012987|Ga0164307_10747937All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300013297|Ga0157378_11692003All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300013766|Ga0120181_1030169Not Available1304Open in IMG/M
3300013768|Ga0120155_1005977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4618Open in IMG/M
3300014058|Ga0120149_1149505Not Available643Open in IMG/M
3300014745|Ga0157377_10298899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1062Open in IMG/M
3300018431|Ga0066655_10641495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300018431|Ga0066655_10810283Not Available637Open in IMG/M
3300019361|Ga0173482_10524317Not Available580Open in IMG/M
3300019869|Ga0193705_1053598Not Available827Open in IMG/M
3300019886|Ga0193727_1005698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5041Open in IMG/M
3300020005|Ga0193697_1005882All Organisms → cellular organisms → Bacteria2994Open in IMG/M
3300020015|Ga0193734_1042087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea849Open in IMG/M
3300021445|Ga0182009_10054339All Organisms → cellular organisms → Bacteria1705Open in IMG/M
3300022756|Ga0222622_10271297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1157Open in IMG/M
3300022756|Ga0222622_10670337All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300025885|Ga0207653_10297968Not Available625Open in IMG/M
3300025899|Ga0207642_10137641All Organisms → cellular organisms → Bacteria1283Open in IMG/M
3300025899|Ga0207642_11057411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300025903|Ga0207680_11147546Not Available555Open in IMG/M
3300025907|Ga0207645_10760215Not Available659Open in IMG/M
3300025912|Ga0207707_11238887All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300025917|Ga0207660_10174857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1664Open in IMG/M
3300025917|Ga0207660_11399110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300025919|Ga0207657_10304736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1261Open in IMG/M
3300025921|Ga0207652_10626588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium963Open in IMG/M
3300025927|Ga0207687_11861581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300025928|Ga0207700_10440046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1147Open in IMG/M
3300025945|Ga0207679_10280879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1428Open in IMG/M
3300026023|Ga0207677_10459568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1092Open in IMG/M
3300026067|Ga0207678_11373789Not Available625Open in IMG/M
3300026078|Ga0207702_11118615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium782Open in IMG/M
3300027775|Ga0209177_10020647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1622Open in IMG/M
3300027775|Ga0209177_10333021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidimicrobium → Acidimicrobium ferrooxidans → Acidimicrobium ferrooxidans DSM 10331589Open in IMG/M
3300028381|Ga0268264_10444258All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300028708|Ga0307295_10005053All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3036Open in IMG/M
3300028708|Ga0307295_10135543Not Available678Open in IMG/M
3300028710|Ga0307322_10108445Not Available718Open in IMG/M
3300028717|Ga0307298_10061003Not Available1042Open in IMG/M
3300028720|Ga0307317_10135891All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300028755|Ga0307316_10052730All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300028755|Ga0307316_10114506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria948Open in IMG/M
3300028784|Ga0307282_10611791Not Available528Open in IMG/M
3300028802|Ga0307503_10396938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria720Open in IMG/M
3300028807|Ga0307305_10051461All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1897Open in IMG/M
3300028819|Ga0307296_10379304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium772Open in IMG/M
3300028819|Ga0307296_10766533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300028824|Ga0307310_10720396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300031226|Ga0307497_10384168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300031903|Ga0307407_11645352Not Available510Open in IMG/M
3300031938|Ga0308175_100002794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria11979Open in IMG/M
3300031938|Ga0308175_100492009All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300031996|Ga0308176_10356773All Organisms → cellular organisms → Bacteria1445Open in IMG/M
3300031996|Ga0308176_11533808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium710Open in IMG/M
3300031996|Ga0308176_12106456Not Available602Open in IMG/M
3300032074|Ga0308173_10245387All Organisms → cellular organisms → Bacteria1514Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere7.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil5.19%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.44%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.44%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.22%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.22%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.22%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.96%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.48%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.48%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.48%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.48%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.74%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.74%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.74%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664021Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001534Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003659Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006574Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013766Permafrost microbial communities from Nunavut, Canada - A26_65cm_6MEnvironmentalOpen in IMG/M
3300013768Permafrost microbial communities from Nunavut, Canada - A35_65cm_0MEnvironmentalOpen in IMG/M
3300014058Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25MEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300020005Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2EnvironmentalOpen in IMG/M
3300020015Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICCgaii200_106052912228664021SoilVTPTLFAQTMWLCAGLSPLWPWTITGRYTGSPAVRFAKRAYA
INPhiseqgaiiFebDRAFT_10167175113300000364SoilLSAGADGRCIGGSNRERLGVTPTLFSWTVWLCAGLSPFWPWTISGRYTGSPAVKFAKRAGTWANRER*
A15PFW1_1030825313300001534PermafrostTWTVWLCVGLSPLWPWTLTGRHTGSPAVRFAKRAYAWAIR*
C688J35102_11996591113300002568SoilMTPSLLTWTVWLCAGLSPLWPWTVTGRYTGSPAVRLAKRAYAWAS
C688J35102_12067311523300002568SoilMTPQLFTWTVWLCAGLSPFWPWTVTGRYTGSPAVSFAKRAYAWAHR*
C688J35102_12077665533300002568SoilMTPSLMTWTVWVCAGLSPLWPWTVTGRYTGSPALKLARRAYAWAHR*
C688J35102_12077825413300002568SoilMTPTLFVWTVWACAGLLPFWPWDIRGRHTGSPAVRLVKRAGTWGTR*
C688J35102_12081905643300002568SoilTPTLFIWAVWAYAGLSPFWPWDIRGRHTGSPAVRLVKRAGTWAIRER*
JGI25404J52841_1010607723300003659Tabebuia Heterophylla RhizospherePSHTLWVGCVRRGADGRCRGASNRELLGVTPTLFTWTVWLCAGLSPFWPWTISGRYTGSPAVRFARRAGLWARER*
Ga0055453_1025435313300004006Natural And Restored WetlandsVTPTLFTWTVWLCAAVSPFWPWDIRGRHTGSPALRLAKRAGSWATRER*
Ga0063454_10002201943300004081SoilMTPTLFIWAVWAYAGLSPFWPWDIRGRHTGSPAVRLVKRAGTWAIRER*
Ga0062593_10249852113300004114SoilVSAGADGKGGDSANERKRLGVTPTLFSWTVWLCAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWASRQR*
Ga0062593_10262123213300004114SoilVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGSWANRE
Ga0063455_10134191833300004153SoilDGMTPTLFIWAVWAYAGLSPFWPWDIRGRHTGSPAVRLVKRAGTWAIRER*
Ga0062589_10169263013300004156SoilLSAGADGRCLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0062589_10196127023300004156SoilVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGS
Ga0062590_10073314413300004157SoilMTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPALRFARRALSRER*
Ga0063356_10172436933300004463Arabidopsis Thaliana RhizosphereSVTAGLFTWTVWLCAGLSPLWPWTITGRYTGSPAARFARRVRTWANRQH*
Ga0062595_10073064423300004479SoilVLVGASNRECLGVTPTLFTWTVWACVGLSPFWPWTVSGRYTGSPAVRLAKRAGTWASRER
Ga0062595_10102770013300004479SoilRGVTPSLLTWMIWLCAGVSPLWPWTVTGRYTGSPAVRLAKRAYAWANR*
Ga0062594_10005901623300005093SoilLSAGADGRCTGGTNRELLGVTPMLFSWTMWACAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWARER*
Ga0066823_1001120213300005163SoilWELSAGADGRFRGATNRKWLGVTPTLFTWTVWLWAASTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0065705_1022290823300005294Switchgrass RhizosphereLSAGADGRCIGASNRERLGVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRASTWANRER*
Ga0070683_10162661723300005329Corn RhizosphereMTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPALRVARRAVSRER*
Ga0070683_10190259823300005329Corn RhizosphereMLFSWTMWACAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWARE
Ga0070690_10055712923300005330Switchgrass RhizosphereMTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAVSRAR*
Ga0068869_10144798313300005334Miscanthus RhizosphereTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0070666_1111048313300005335Switchgrass RhizosphereEVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER
Ga0070680_10056010223300005336Corn RhizosphereLSAGADGRCLGATNRERLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0070682_10134504123300005337Corn RhizosphereMTPTLFTWTVWLCAGLSPLWPWTIDGRYTGSPAVRFAKRAVSRAR*
Ga0070682_10170187913300005337Corn RhizosphereVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0070660_10018810013300005339Corn RhizosphereVFGANNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRE
Ga0070689_10046513823300005340Switchgrass RhizosphereVGLVRGGGREVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0070689_10067179423300005340Switchgrass RhizosphereMLFSWTMWACAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWARER*
Ga0070691_1009133333300005341Corn, Switchgrass And Miscanthus RhizosphereLVRGGGREVFGANNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0070687_10126229613300005343Switchgrass RhizosphereFLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0070692_1010748133300005345Corn, Switchgrass And Miscanthus RhizosphereVTPTLFIWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0070669_10150030023300005353Switchgrass RhizosphereVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGS
Ga0070674_10015530123300005356Miscanthus RhizosphereVGLVRGGGREVFGANNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0070674_10086375023300005356Miscanthus RhizosphereVGLVRGGGREVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPVVRFAKRAGAWANRER*
Ga0070701_1096591323300005438Corn, Switchgrass And Miscanthus RhizosphereMTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAVSRAR*
Ga0068867_10113318223300005459Miscanthus RhizosphereFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0073909_1009605123300005526Surface SoilVTPTLFSWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGTWANRER*
Ga0070684_10091654323300005535Corn RhizosphereVTPTLFTWTVWLCAGLSPFWPWTISGRYTGSPAVRFARRAGAWANRER*
Ga0070695_10011497033300005545Corn, Switchgrass And Miscanthus RhizosphereLSAGADGRCLGATNREFLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0066670_1059192923300005560SoilVSAGADGRCVGASNRARLGVTPTLFTWMVWLCAGLSPFWPWTIRGRYTGSPAVRLAKRAGTWAIRER*
Ga0070664_10069447923300005564Corn RhizosphereMTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPALRVARRAVSRER*
Ga0068857_10186663923300005577Corn RhizosphereREPSRRTRSGWELSAGADGRCTGGTNRELLGVTPMLFSWTMWACAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWARER*
Ga0068854_10052836913300005578Corn RhizosphereRWDLSAGADGRCIGASNREWLGVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGSWASRER*
Ga0068856_10110379513300005614Corn RhizosphereWTVWLCAGLSPFWPWTIDGRYTGSPALRVARRAVSRER*
Ga0068860_10142749123300005843Switchgrass RhizosphereRDRGVTPSLLTWMVWLCAGVSPLWPWTITGRYTGSPAIRLAKRAYAWANR*
Ga0068862_10201092923300005844Switchgrass RhizosphereVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER*
Ga0075286_104149923300005886Rice Paddy SoilVTPTLFTWTVWLCAGVLPFWPWTISGRYTGSPVVRLAKRAGSWATRER*
Ga0081540_1005437143300005983Tabebuia Heterophylla RhizosphereLTGARPSHTLWVGCVRRGADGRCRGASNRELLGVTPTLFTWTVWLCAGLSPFWPWTISGRYTGSPAVRFARRAGLWARER*
Ga0074056_1156038923300006574SoilLSAGADGRFRGATNRKWLGVTPTLFTWTVWLWAASTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0079222_1041366523300006755Agricultural SoilMTPTLFTWTVWFCAGVSPFWPWTIDGRYTGSPALKFAKRVVGRAR*
Ga0068865_10037309513300006881Miscanthus RhizosphereMVWLCAGVSPLWPWTITGRYTGSPAIRLAKRAYAWANR*
Ga0105237_1055562023300009545Corn RhizosphereVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGSWASRER*
Ga0105249_1235389123300009553Switchgrass RhizosphereVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAG
Ga0126309_1011848623300010039Serpentine SoilMSAMLFAQTMWLCAGLSPLWPWTVTGRYTGSPAVRFAKRAYVWANR*
Ga0134080_1039087313300010333Grasslands SoilMVFSWTMWLCAGLSPFWPWTVSGRYTGSPAIRFAK
Ga0134125_1062628723300010371Terrestrial SoilVFGANNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0134125_1136330113300010371Terrestrial SoilMVWLCAGVSPLWPCTITGRYTGSPAIRLAKRAYAWANR*
Ga0134128_1221222523300010373Terrestrial SoilVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTTDGRYTGSPAVRFAKRAGAWANRER*
Ga0105239_1317199523300010375Corn RhizosphereVTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAVSRAR*
Ga0134126_1037511443300010396Terrestrial SoilMTPTLFTWTVWLCAGLSPLWPWTIDGRYTGSPAVRFA
Ga0134127_1088188423300010399Terrestrial SoilVFGANNREWLGVTPTLFTWAVWLWAASTPFWPWSITGRYTGSPAVRFAKRANAWANRER*
Ga0134123_1062400213300010403Terrestrial SoilSGNNRDRRGMTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAVSRAR*
Ga0137382_1034215733300012200Vadose Zone SoilVTPTLFSWTVWLCAGLSPFWPWTISGRYTGSPAVRFAKRAGTWANRER*
Ga0137376_1104107313300012208Vadose Zone SoilVTPTLFSWTVWLCAGLSPFWPWTIRGRHTGSPAVRLAKRAGTWATRER*
Ga0157353_102679923300012496Unplanted SoilWLCAGLSPLWPWTISGRYTGSPAVRCAKYVYEWATR*
Ga0157294_1002647433300012892SoilVSAGADGKGGDSANERKRLGVTPTLFSWTVWLCAGLSPFWPWTVSGRYTGSPAVRFA
Ga0157308_1038392913300012910SoilVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGSWANRER*
Ga0157302_1002600743300012915SoilDGKGGDSANERKRLGVTPTLFSWTVWLCAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWASRQR*
Ga0157302_1052040623300012915SoilVSAGADGRWLGATNREALGVTPTLFTWTVWLCAGLSPFWPWTIGGRYTGSPAVRFAKRAGSWANRER*
Ga0164298_1005135823300012955SoilVTPTLFSWTVWLCAGLSPFWPWTIRGRYTGSPAVRLAKRARLWAIRER*
Ga0164303_1027248323300012957SoilVTPTLFTWAVWLWAASTPFWPWSISGRYTGSPAVRFAKRANAWANRER*
Ga0164309_1090304813300012984SoilVTPTLFTWTVWFCAGLSPFWPWSIRGRYTGSPAVRLAKRAGIWATRER*
Ga0164304_1064268623300012986SoilVTPTLFIWTVWLCAGLSPFWPWTIDGRYTGSPAIRFAKRAGAWANRER*
Ga0164307_1074793723300012987SoilVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRLAKRAGIWATRPR*
Ga0157378_1169200323300013297Miscanthus RhizosphereMVLAADRSSERDRGVTPSLLTWMVWLCAGVSPLWPWTITGRYTGSPAIRLAKRAYAWANR
Ga0120181_103016913300013766PermafrostAPALLTWTVWLCVGLSPLWPWTLTGRHTGSPAVRFAKRAYAWAIR*
Ga0120155_100597763300013768PermafrostVTPSLFTWTVWLCVGLSPLWPWTITGRYTGSPAVRFAKRAYAWANR*
Ga0120149_114950513300014058PermafrostVTPTLFTWTVWLCVGLSPLWPWTITGRYTGSPAVRFAKRAYAWAN
Ga0157377_1029889923300014745Miscanthus RhizosphereMTPTLFTWTVWLCAGLSPLWPWTIDGRYTGSPALRVARRAVSRER*
Ga0066655_1064149523300018431Grasslands SoilMTPALLTWTVWICAGLSPLWPWTVTGRYTGSPAVKIAKRAYAWASR
Ga0066655_1081028323300018431Grasslands SoilVSAGADGRCVGASNRARLGVTPTLFTWTVWLCAGLSPFWPWTIRGRYTGSPAVRLAKRAGTWATRER
Ga0173482_1052431713300019361SoilVTPTLFTWTVWLCAGLSPFWPWTISGRYTGSPAVRFAKRAGTWASRQR
Ga0193705_105359813300019869SoilMLFAQTLWLCAGLSPLWPWTVTGRYTGSPAVRFAKRAY
Ga0193727_100569823300019886SoilVTPTLFSWTVWLCAGLSPFWPWTIRGRHTGSPAVRLAKRAGVWATRER
Ga0193697_100588243300020005SoilVTPTLFTWMVWLCAGLSPFWPWSVSGRYTGSPAVRLAKRAGIWATRER
Ga0193734_104208733300020015SoilVTPTLFSWTMWFCAGVSPFWPWTVSGRYTGSPAVRFAKRA
Ga0182009_1005433923300021445SoilMTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPALRVARRAVSRER
Ga0222622_1027129713300022756Groundwater SedimentVRLGVTPTLFTWMVWLCAGLSPFWPWSISGRYTGSPAVRLAKRAGIWATRER
Ga0222622_1067033723300022756Groundwater SedimentVTPTLFTWMVWLCAGLSPFWPWSVGGRYTGSPAVRLAKRAGIWATRER
Ga0207653_1029796823300025885Corn, Switchgrass And Miscanthus RhizosphereVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAW
Ga0207642_1013764133300025899Miscanthus RhizosphereVFGANNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKR
Ga0207642_1105741123300025899Miscanthus RhizosphereMTPTLFTWTVWLCAGLSPLWPWTIDGRYTGSPAVRFAKRAVSRAR
Ga0207680_1114754623300025903Switchgrass RhizosphereVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFA
Ga0207645_1076021523300025907Miscanthus RhizosphereVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWA
Ga0207707_1123888723300025912Corn RhizosphereVLGATNRELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER
Ga0207660_1017485733300025917Corn RhizosphereMTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAVSRAR
Ga0207660_1139911023300025917Corn RhizosphereVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER
Ga0207657_1030473613300025919Corn RhizosphereELLGVTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAGAWANRER
Ga0207652_1062658823300025921Corn RhizosphereNNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER
Ga0207687_1186158113300025927Miscanthus RhizosphereNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER
Ga0207700_1044004633300025928Corn, Switchgrass And Miscanthus RhizosphereMLFSWTMWACAGLSPFWPWTVSGRYTGSPAVRFAKRAGTWARER
Ga0207679_1028087933300025945Corn RhizosphereMTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPALRVARRAVSRER
Ga0207677_1045956813300026023Miscanthus RhizosphereSAGADGRCLGATNRERLGVTPTLFSWTVWLCAGLSPLWPWTIDGRYTESPAVRFAKRAGAWANRER
Ga0207678_1137378923300026067Corn RhizosphereMTPTLFSWTVWLCAGLSPFWPWTIDGRYTGSPAVRFAKRAVSRAR
Ga0207702_1111861523300026078Corn RhizosphereFSWTVWLCAGLSPFWPWTIDGRYTGSPALRVARRAVSRER
Ga0209177_1002064713300027775Agricultural SoilMTPTLFTWTVWLCAGLSPLWPWTIDGRYTGSPAVRFAKRAVS
Ga0209177_1033302113300027775Agricultural SoilMTPTLFTWTVWLCAGLSPFWPWTIDGRYTGSPAVKFAKRAGAWATRER
Ga0268264_1044425823300028381Switchgrass RhizosphereVFGANNRDWLGVTPTLFTWTVWLWAALTPFWPWSISGRYTGSPAVRFAKRANAWANRER
Ga0307295_1000505353300028708SoilVRLGVTPTLFTWMVWLCAGLSPFWPWSVSGRYTGSPAVRLAKRAGIWATRER
Ga0307295_1013554313300028708SoilVTPALFAWTVWLCAGLSPLWPWTLTGRYTGSPAVRFAKRAYAWANR
Ga0307322_1010844523300028710SoilVRLGVTPTLFTWMVWLCAGLSPFWPWSISGRYTGSP
Ga0307298_1006100313300028717SoilVRLGVTPTLFTWMVWLCAGLSPFWPWSISGRYTGSPAVRLAKRA
Ga0307317_1013589133300028720SoilPTLFSWTMWFCAGVSPFWPWTVSGRYTGSPAVRFAKRAGTWATRGR
Ga0307316_1005273033300028755SoilGPPARYTGRELRVTPALFAWTVWLCAGLSPLWPWTLTGRYTGSPAVRFAKRAYAWANR
Ga0307316_1011450613300028755SoilLWLCAGLSPLWPWTVTGRYTGSPAVRFAKRAYVWANR
Ga0307282_1061179113300028784SoilRERGVTPSLLTWMVWLCAGVSPLWPWTVTGRYTGSPAVRLAKRAYAWANR
Ga0307503_1039693823300028802SoilVTPTLFSWTVWLCAGLSPFWPWTIRGRHTGSPAVRLAKRAGTWATRER
Ga0307305_1005146143300028807SoilVTPTLFSWTMWFCAGVSPFWPWTVSGRYTGSPAVRFAKRAGTWATRGR
Ga0307296_1037930413300028819SoilRGVTPSLLTWMVWLCAGVSPLWPWTVTGRYTGSPAVRLAKRAYAWANR
Ga0307296_1076653313300028819SoilWLCAGLSPFWPWTIRGRHTGSPAVRLAKRAGTWATRER
Ga0307310_1072039623300028824SoilTLWLCAGLSPLWPWSVTGRYTGSPAVRFAKRAYVWANR
Ga0307497_1038416823300031226SoilRGASNRERLGVTPTLFSWTVWLCAGLSPFWPWTIRGRHTGSPAVRLAKRAGIWATRER
Ga0307407_1164535213300031903RhizosphereMTPEILTWTVWLFVGLVWPFWPWTVTGRHTGSPALKLAKRAYAWATANGNR
Ga0308175_10000279443300031938SoilVTPTLFTWMVWLCAGLSPFWPWSISGRYTGSPAVRLAKRAGTWATRER
Ga0308175_10049200913300031938SoilRDRRGVTPTLFTWTVWFCAGLSPFWPWTVDGRYTGSPALRFARRAANRVR
Ga0308176_1035677313300031996SoilRDRRGVTPTLFTWTVWFCAGLSPFWPWTVDGRYTGSPALRFVRRAANRVR
Ga0308176_1153380823300031996SoilMTPTLFSWTVWLCAGLSPFWPWTINGRYTGSPAVKFAKRAGAWATRER
Ga0308176_1210645623300031996SoilVTPTLFTWTVWFCAGLSPFWPWTVDGRYTGSPALRFARR
Ga0308173_1024538733300032074SoilVTPTLFTWTVWFCAGLSPFWPWTVDGRYTGSPALRFARRAANRVR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.