NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F058091

Metagenome / Metatranscriptome Family F058091

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F058091
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 160 residues
Representative Sequence VEFWKREAYDIAYKITGGNNLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFS
Number of Associated Samples 109
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 48.89 %
% of genes from short scaffolds (< 2000 bps) 71.11 %
Associated GOLD sequencing projects 93
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (90.370 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(28.889 % of family members)
Environment Ontology (ENVO) Unclassified
(36.296 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(47.407 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 64.85%    β-sheet: 0.00%    Coil/Unstructured: 35.15%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF11325DUF3127 39.26
PF04404ERF 5.19
PF01507PAPS_reduct 1.48
PF03237Terminase_6N 1.48
PF00132Hexapep 1.48
PF14602Hexapep_2 1.48
PF09588YqaJ 0.74
PF13148DUF3987 0.74
PF00777Glyco_transf_29 0.74
PF05869Dam 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.78 %
UnclassifiedrootN/A2.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10085514All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1234Open in IMG/M
3300000124|BS_KBA_SWE12_21mDRAFT_c10029625All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1610Open in IMG/M
3300002300|B570J29639_101022All Organisms → cellular organisms → Bacteria2381Open in IMG/M
3300003512|SACTD2sed_1005798All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage795Open in IMG/M
3300005420|Ga0068879_1437948All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage748Open in IMG/M
3300005525|Ga0068877_10014941Not Available5601Open in IMG/M
3300005527|Ga0068876_10251952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1012Open in IMG/M
3300005527|Ga0068876_10789197All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300005581|Ga0049081_10083292All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1198Open in IMG/M
3300005758|Ga0078117_1000213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11601Open in IMG/M
3300005805|Ga0079957_1004614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11403Open in IMG/M
3300005940|Ga0073913_10009581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1303Open in IMG/M
3300006005|Ga0073910_1003117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300006030|Ga0075470_10073871All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1033Open in IMG/M
3300006641|Ga0075471_10129718All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1342Open in IMG/M
3300006734|Ga0098073_1006227All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300006734|Ga0098073_1019147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300006790|Ga0098074_1006377All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4259Open in IMG/M
3300006790|Ga0098074_1026920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1697Open in IMG/M
3300006802|Ga0070749_10015732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4813Open in IMG/M
3300006802|Ga0070749_10047973All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2607Open in IMG/M
3300006802|Ga0070749_10176213All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1233Open in IMG/M
3300006802|Ga0070749_10201850All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1139Open in IMG/M
3300006805|Ga0075464_10349652All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage894Open in IMG/M
3300006805|Ga0075464_10403740All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage830Open in IMG/M
3300006863|Ga0075459_1004381All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2282Open in IMG/M
3300006863|Ga0075459_1031542All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage888Open in IMG/M
3300006875|Ga0075473_10037421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1868Open in IMG/M
3300006917|Ga0075472_10132464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1221Open in IMG/M
3300007177|Ga0102978_1008095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2216Open in IMG/M
3300007234|Ga0075460_10069656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1295Open in IMG/M
3300007344|Ga0070745_1136043All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage939Open in IMG/M
3300007344|Ga0070745_1155222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300007345|Ga0070752_1183684All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage842Open in IMG/M
3300007346|Ga0070753_1058902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1559Open in IMG/M
3300007346|Ga0070753_1173307All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage809Open in IMG/M
3300007363|Ga0075458_10078411All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1031Open in IMG/M
3300007539|Ga0099849_1091618All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1219Open in IMG/M
3300007541|Ga0099848_1072314All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1355Open in IMG/M
3300007544|Ga0102861_1066048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage948Open in IMG/M
3300007960|Ga0099850_1064633All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1541Open in IMG/M
3300007960|Ga0099850_1207548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage768Open in IMG/M
3300007974|Ga0105747_1021392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1774Open in IMG/M
3300008055|Ga0108970_11564035All Organisms → cellular organisms → Bacteria5054Open in IMG/M
3300008114|Ga0114347_1042630All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3720Open in IMG/M
3300008116|Ga0114350_1080049All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1840Open in IMG/M
3300008117|Ga0114351_1025290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5699Open in IMG/M
3300008120|Ga0114355_1075699All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1925Open in IMG/M
3300008120|Ga0114355_1243808All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300008120|Ga0114355_1243862All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300008122|Ga0114359_1014572All Organisms → cellular organisms → Bacteria3334Open in IMG/M
3300008259|Ga0114841_1102868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1236Open in IMG/M
3300008259|Ga0114841_1138426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage986Open in IMG/M
3300008263|Ga0114349_1055113All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1900Open in IMG/M
3300008264|Ga0114353_1179847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1025Open in IMG/M
3300008265|Ga0114361_1019880All Organisms → cellular organisms → Bacteria3204Open in IMG/M
3300008266|Ga0114363_1053329All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1599Open in IMG/M
3300008266|Ga0114363_1130551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300008266|Ga0114363_1140496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage813Open in IMG/M
3300008450|Ga0114880_1157131All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage811Open in IMG/M
3300009051|Ga0102864_1049135All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1140Open in IMG/M
3300009056|Ga0102860_1005585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2999Open in IMG/M
3300009056|Ga0102860_1026302All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1516Open in IMG/M
3300009149|Ga0114918_10367405All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage790Open in IMG/M
3300010300|Ga0129351_1155345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage901Open in IMG/M
3300010318|Ga0136656_1028437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2029Open in IMG/M
(restricted) 3300013127|Ga0172365_10594232All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage633Open in IMG/M
(restricted) 3300013129|Ga0172364_10101502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2003Open in IMG/M
(restricted) 3300013130|Ga0172363_10386726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage910Open in IMG/M
(restricted) 3300013131|Ga0172373_10299464All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1037Open in IMG/M
3300013372|Ga0177922_10102342Not Available7331Open in IMG/M
3300013372|Ga0177922_10427471All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2737Open in IMG/M
3300013372|Ga0177922_11100751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300017707|Ga0181363_1029491All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1040Open in IMG/M
3300017736|Ga0181365_1004106All Organisms → cellular organisms → Bacteria3541Open in IMG/M
3300017967|Ga0181590_10205208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1478Open in IMG/M
3300017969|Ga0181585_10243572All Organisms → Viruses → Predicted Viral1270Open in IMG/M
3300018424|Ga0181591_10184318All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1652Open in IMG/M
3300018424|Ga0181591_10819140All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300018682|Ga0188851_1030141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage600Open in IMG/M
3300019784|Ga0181359_1087749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1157Open in IMG/M
3300020183|Ga0194115_10126816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1370Open in IMG/M
3300020501|Ga0208590_1000035All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage31674Open in IMG/M
3300021356|Ga0213858_10043304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2174Open in IMG/M
3300021961|Ga0222714_10223826All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1071Open in IMG/M
3300021961|Ga0222714_10603911All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage547Open in IMG/M
3300021962|Ga0222713_10252055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1149Open in IMG/M
3300021963|Ga0222712_10182635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1388Open in IMG/M
3300022198|Ga0196905_1008836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3397Open in IMG/M
3300022200|Ga0196901_1119162All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage904Open in IMG/M
3300023116|Ga0255751_10332939All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage778Open in IMG/M
3300023180|Ga0255768_10032270All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4125Open in IMG/M
3300025057|Ga0208018_100774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7283Open in IMG/M
3300025585|Ga0208546_1062258All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage873Open in IMG/M
3300025630|Ga0208004_1073747All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage860Open in IMG/M
3300025635|Ga0208147_1013753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2212Open in IMG/M
3300025646|Ga0208161_1079966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage949Open in IMG/M
3300025646|Ga0208161_1103429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage780Open in IMG/M
3300025655|Ga0208795_1125093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage665Open in IMG/M
3300025671|Ga0208898_1115619All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage785Open in IMG/M
3300025674|Ga0208162_1077001All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1041Open in IMG/M
3300025732|Ga0208784_1018813All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2265Open in IMG/M
3300025732|Ga0208784_1143588All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300025848|Ga0208005_1031457All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1638Open in IMG/M
3300025889|Ga0208644_1267698All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage697Open in IMG/M
3300026993|Ga0209975_1000022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11465Open in IMG/M
3300027131|Ga0255066_1040226All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300027205|Ga0208926_1068147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300027547|Ga0209864_1008225All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1156Open in IMG/M
3300027608|Ga0208974_1081066All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage887Open in IMG/M
3300027659|Ga0208975_1022360All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2066Open in IMG/M
3300027785|Ga0209246_10034247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1937Open in IMG/M
3300027793|Ga0209972_10060203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2027Open in IMG/M
3300027793|Ga0209972_10174763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1012Open in IMG/M
3300027808|Ga0209354_10114138All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1102Open in IMG/M
3300027917|Ga0209536_101276646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage899Open in IMG/M
3300029753|Ga0135224_1025055All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage616Open in IMG/M
3300031539|Ga0307380_10458452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1133Open in IMG/M
3300031565|Ga0307379_11206794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300031707|Ga0315291_10051369All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4648Open in IMG/M
3300031746|Ga0315293_10386021All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1105Open in IMG/M
3300031758|Ga0315907_10197005All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1689Open in IMG/M
3300031758|Ga0315907_10470867All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage999Open in IMG/M
3300031786|Ga0315908_10546710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage964Open in IMG/M
3300031787|Ga0315900_10050297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4403Open in IMG/M
3300031857|Ga0315909_10153905All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1888Open in IMG/M
3300031952|Ga0315294_10317648All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1490Open in IMG/M
3300031999|Ga0315274_10358551All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1710Open in IMG/M
3300032046|Ga0315289_10205857All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2142Open in IMG/M
3300032053|Ga0315284_10266237All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2177Open in IMG/M
3300032093|Ga0315902_10127165All Organisms → cellular organisms → Bacteria2701Open in IMG/M
3300032093|Ga0315902_10694398All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage829Open in IMG/M
3300033816|Ga0334980_0000733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage15186Open in IMG/M
3300034375|Ga0348336_028247Not Available2702Open in IMG/M
3300034418|Ga0348337_013886All Organisms → Viruses → Predicted Viral4427Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous28.89%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton11.11%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake9.63%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment6.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.19%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.44%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.70%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.70%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.22%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand2.22%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.48%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.48%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.48%
Lake WaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water0.74%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.74%
Macrotidal RiverEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Macrotidal River0.74%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.74%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment0.74%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.74%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.74%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.74%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.74%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000124Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBA sample SWE 12_21mEnvironmentalOpen in IMG/M
3300002300Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnionEnvironmentalOpen in IMG/M
3300003512Macrotidal river microbial communities from the South Alligator River system, Northern Australia - Sample CTD2 sed R1EnvironmentalOpen in IMG/M
3300005420Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005758Cyanobacteria communities in tropical freswater systems - freshwater lake in SingaporeEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006005Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006734Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006790Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007177Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projectsEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007544Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008122Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTREnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008265Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009051Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02EnvironmentalOpen in IMG/M
3300009056Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010318Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNAEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300017707Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018682Metatranscriptome of marine microbial communities from Baltic Sea - GS680_0p1EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020501Freshwater microbial communities from Lake Mendota, WI - 27SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023116Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaGEnvironmentalOpen in IMG/M
3300023180Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaGEnvironmentalOpen in IMG/M
3300025057Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025635Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025848Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026993Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027131Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027205Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027547Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027659Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300029753Marine harbor viral communities from the Indian Ocean - SRH3EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031786Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124EnvironmentalOpen in IMG/M
3300031787Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1008551423300000116MarineVEFWNKEAYHIAYKITGGHPLXNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYRDIRSLTGISLDTIHKAIKKFKNDLNIYACLHWDSKSSPEFSAT*
BS_KBA_SWE12_21mDRAFT_1002962533300000124MarineVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQLYRSSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHRSTAINRHCQSSPEFRNA*
B570J29639_10102223300002300FreshwaterVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
SACTD2sed_100579813300003512Macrotidal RiverVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP*
Ga0068879_143794813300005420Freshwater LakeVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0068877_10014941113300005525Freshwater LakeVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0068876_1025195213300005527Freshwater LakeEAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0068876_1078919713300005527Freshwater LakeVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPH
Ga0049081_1008329243300005581Freshwater LenticVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRTA*
Ga0078117_1000213123300005758Lake WaterVEFWKKEAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDDMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQYQTI*
Ga0079957_100461483300005805LakeVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0073913_1000958123300005940SandVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA*
Ga0073910_100311733300006005SandVEFWKKEAYIIAHKITGGNNLHQDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRTA*
Ga0075470_1007387113300006030AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINK
Ga0075471_1012971813300006641AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0098073_100622713300006734MarineEAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSISIPCGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP*
Ga0098073_101914733300006734MarineAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP*
Ga0098074_100637733300006790MarineVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNTYACLHWDSKSSPEFSAT*
Ga0098074_102692033300006790MarineVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSISIPCGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP*
Ga0070749_1001573283300006802AqueousVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNTYACIHWDSKSSPEFSAT*
Ga0070749_1004797343300006802AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKNDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0070749_1017621333300006802AqueousVDFWRKQAYDISFKITGGHPLYNDLVPHVYILLSKLNIPEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIADDDGYNETQYQQILDTYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGISLDTINKAINKFKYDLHHSSFSSRDG
Ga0070749_1020185023300006802AqueousVEFWKREAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDEMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI*
Ga0075464_1034965233300006805AqueousVEFWKREAYDIAYKITGGNELYHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPE
Ga0075464_1040374023300006805AqueousVEFWKREAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDEMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPE
Ga0075459_100438143300006863AqueousVEFWKREAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDDMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI*
Ga0075459_103154213300006863AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0075473_1003742133300006875AqueousVEFWKKEAYDIAYKITGGNYLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDDMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI*
Ga0075472_1013246413300006917AqueousGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0102978_100809523300007177Freshwater LakeVEFWKREAYDIAYKITGGNNLYHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSFISGDCQSSPDFCNSRHQAI*
Ga0075460_1006965643300007234AqueousVEFWKKEAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKNDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0070745_113604313300007344AqueousITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSSQH*
Ga0070745_115522213300007344AqueousIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDEFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSPQH*
Ga0070752_118368423300007345AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDEFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSSQH*
Ga0070753_105890233300007346AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDEFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSPQH*
Ga0070753_117330723300007346AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSSQH*
Ga0075458_1007841113300007363AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI*
Ga0099849_109161823300007539AqueousVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDG
Ga0099848_107231433300007541AqueousVEFWKKEAYNIAYKITGGNELYHDLVPHIYILLSKLDIREQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPEGFDKIADDDTYHETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSHFCGNSPSFHELRNA*
Ga0102861_106604813300007544EstuarineVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSF
Ga0099850_106463313300007960AqueousVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDT
Ga0099850_120754823300007960AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDEFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTSESSPEFSSPQH*
Ga0105747_102139233300007974Estuary WaterVEFWKREAYDIAYKITGGNELYHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0108970_1156403553300008055EstuaryVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINIFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0114347_104263053300008114Freshwater, PlanktonLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0114350_108004913300008116Freshwater, PlanktonVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0114351_1025290103300008117Freshwater, PlanktonVEFWKREAYDIAYKITGGNNLHHDLVPHVYLLLAKLEIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0114355_107569923300008120Freshwater, PlanktonVEFWKREAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0114355_124380813300008120Freshwater, PlanktonVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFK
Ga0114355_124386213300008120Freshwater, PlanktonVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFK
Ga0114359_101457223300008122Freshwater, PlanktonVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0114841_110286843300008259Freshwater, PlanktonVEFWKREAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSS
Ga0114841_113842633300008259Freshwater, PlanktonVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSS
Ga0114349_105511343300008263Freshwater, PlanktonLHHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDSDEELFCKEITKMRLMGMTYREIKGLTGINLDTTNKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0114353_117984723300008264Freshwater, PlanktonFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0114361_101988063300008265Freshwater, PlanktonVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI*
Ga0114363_105332953300008266Freshwater, PlanktonVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSS
Ga0114363_113055133300008266Freshwater, PlanktonVEFWKKEAYNIAYKITGGNELYHDLVPHIYILLSKLDIREQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSS
Ga0114363_114049613300008266Freshwater, PlanktonVEFWKREAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKH
Ga0114880_115713133300008450Freshwater LakeVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFK
Ga0102864_104913553300009051EstuarineVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIH
Ga0102860_100558513300009056EstuarineAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI*
Ga0102860_102630243300009056EstuarineVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKF
Ga0114918_1036740513300009149Deep SubsurfaceLDIKQEDLPRVFARWAYNQYNWKESKFNQLYRSSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRSA*
Ga0129351_115534523300010300Freshwater To Marine Saline GradientESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDQFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSSQH*
Ga0136656_102843713300010318Freshwater To Marine Saline GradientVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNTYACLYWDSKSSPEFSAT*
(restricted) Ga0172365_1059423223300013127SedimentLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDRIADEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSIISGHCKGSPEFLNARHQAV*
(restricted) Ga0172364_1010150243300013129SedimentVEFWKKEAYLIAYKITGGNTLHNDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDRIADEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSIISGHCKGSPEFLNARHQAV*
(restricted) Ga0172363_1038672623300013130SedimentVEFWKKEAYLIAYKITGGNILHNDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDRIADEDVYNETQYQQILDAYLEQSTDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSIISGHCKGSPEFLNARHQAV*
(restricted) Ga0172373_1029946443300013131FreshwaterVEFWKKEAYLIAYKITGGNILHNDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDRIADEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMSYREIKGLTGINLDTIN
Ga0177922_10102342173300013372FreshwaterVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSI
Ga0177922_1042747113300013372FreshwaterGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA*
Ga0177922_1110075113300013372FreshwaterLSDVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDEMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI*
Ga0181363_102949113300017707Freshwater LakeVEFWKREAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDEMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINK
Ga0181365_100410643300017736Freshwater LakeVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKKQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA
Ga0181590_1020520833300017967Salt MarshYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGQSSPEFSTP
Ga0181585_1024357223300017969Salt MarshVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESIFNQLFRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP
Ga0181591_1018431823300018424Salt MarshVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLDNYACLNWDGQSSPEFSTP
Ga0181591_1081914013300018424Salt MarshIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSVSIPCGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGQSSPEFSTP
Ga0188851_103014113300018682Freshwater LakeVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQLYRSSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHRSTAINRHCQSSPEFRNA
Ga0181359_108774933300019784Freshwater LakeVEFWKREAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDEMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI
Ga0194115_1012681613300020183Freshwater LakeVEFWKKEAYLIAYKITGGNTLYNDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDRIADEDVYNETQYQRILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSLISGHCEGSPEFLNARHQAI
Ga0208590_1000035413300020501FreshwaterVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0213858_1004330463300021356SeawaterVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSISVPSGFDKIDDGMMYQETKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGQSSPEFSTP
Ga0222714_1022382643300021961Estuarine WaterVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTIKKAINKF
Ga0222714_1060391113300021961Estuarine WaterVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPEFCNARHQAI
Ga0222713_1025205513300021962Estuarine WaterVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSYLISGDCQSSPEFCNARHQAI
Ga0222712_1018263523300021963Estuarine WaterVEFWKREAYDIAYKITGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDDMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQAI
Ga0196905_100883663300022198AqueousVEFWKKEAYNIAYKITGGNELYHDLVPHIYILLSKLDIREQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPEGFDKIADDDTYHETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSHFCGNSPSFHELRNA
Ga0196901_111916213300022200AqueousVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNTYACLHWDSKSSPEFSAT
Ga0255751_1033293913300023116Salt MarshVEFWEREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSISVPSGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP
Ga0255768_1003227083300023180Salt MarshHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLFRGSVSIPCGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGQSSPEFSTP
Ga0208018_10077473300025057MarineVEFWNREAYDIAYKITGGNPLYLDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSISIPCGFDKIDDGMMYQESKYQKILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP
Ga0208546_106225823300025585AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0208004_107374723300025630AqueousVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNTYACIHWDSKSSPEFSAT
Ga0208147_101375343300025635AqueousLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0208161_107996633300025646AqueousVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIH
Ga0208161_110342913300025646AqueousAYKITGGNELYHDLVPHIYILLSKLDIREQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPEGFDKIADDDTYHETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHNSSHFCGNSPSFHELRNA
Ga0208795_112509323300025655AqueousVEFWNKEAYHIAYKITGGHPLYNDLVPHVYLLLSKLHIKESDLPRVFARWAWNQYTWKESKFNQLHRPGISVPSGFDKLDDGMMYQETRYQRILDNYMDQNPDDDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLHWDSKSSPEFSAT
Ga0208898_111561913300025671AqueousRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSSQH
Ga0208162_107700123300025674AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDEFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNYACLNWDGKSSPEFSTP
Ga0208784_101881333300025732AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0208784_114358813300025732AqueousNYLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDDMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHNSSFISGDCQGSPEFGHAQHQTI
Ga0208005_103145713300025848AqueousLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0208644_126769813300025889AqueousVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKNDIHHSSFI
Ga0209975_100002253300026993Freshwater LakeVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI
Ga0255066_104022613300027131FreshwaterHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0208926_106814713300027205EstuarineVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDT
Ga0209864_100822523300027547SandVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA
Ga0208974_108106613300027608Freshwater LenticIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRTA
Ga0208975_102236023300027659Freshwater LenticVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRTA
Ga0209246_1003424763300027785Freshwater LakeVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKKQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAIN
Ga0209972_1006020313300027793Freshwater LakePHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0209972_1017476323300027793Freshwater LakeEAYIIANKITGGNHLHHDLVPHVYLLLAKLDIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI
Ga0209354_1011413833300027808Freshwater LakeVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKKQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRTA
Ga0209536_10127664613300027917Marine SedimentVEFWNKEAYHIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSPQH
Ga0135224_102505513300029753Marine HarborLVEFCFPVTIGGGNNLFHDLVPHVFLLLAKLDIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIADDEMYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQGSPEFGHAKHQTI
Ga0307380_1045845213300031539SoilVEFWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQEDLPRVFARWAYNQYNWKESKFNQLYRSSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHRSTAIN
Ga0307379_1120679413300031565SoilWKKEAYIIAHKITGGNNLHHDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQLYRSSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRNA
Ga0315291_1005136933300031707SedimentVEFWKKEAYIIAHKITGGNNLHQDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSITIDRHCQSSPEFRTA
Ga0315293_1038602123300031746SedimentVEFWKKEAYIIAHKITGGNNLHQDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCS
Ga0315907_1019700513300031758FreshwaterLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0315907_1047086733300031758FreshwaterVEFWKKEAYIIANKITGGNHLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFC
Ga0315908_1054671013300031786FreshwaterHDLVPHVYLLLAKLEIKPQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKHDIHNSSFISGDCQSSPEFCNAQHQTI
Ga0315900_1005029743300031787FreshwaterVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0315909_1015390543300031857FreshwaterNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEDDVYNESQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0315294_1031764833300031952SedimentVEFWKKEAYIIAHKITGGNNLHQDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA
Ga0315274_1035855133300031999SedimentVEFWKKEAYIIAHKITGGNNLHHDLVPHIYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA
Ga0315289_1020585733300032046SedimentVEFWKKEAYIIAHKITGGNNLHHDLVPHIYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDHVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA
Ga0315284_1026623733300032053SedimentVEFWKKEAYIIAHKITGGNNLHQDLVPHVYLLLSKLDIKQQDLPRVFARWAYNQYNWKESKFNQMYRLSVPIPEGFDKMQEDNVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDLHCSTIINRHCQSSPEFRTA
Ga0315902_1012716573300032093FreshwaterVEFWKREAYDIAYKITGGNNLHHDLVPHVFLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSMLIPDGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFS
Ga0315902_1069439813300032093FreshwaterVEFWKREAYDIAYKITGGNNLHHDLVPHVYLLLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFS
Ga0334980_0000733_1878_23003300033816FreshwaterLAKLNIKEQDLPRVFARWAYNQYNWKESKFNQLYRGSVPIPEGFDKIAEEDVYNETQYQQILDAYLEQSPDNDEELFCKEITKMRLMGMTYREIKGLTGINLDTINKAINKFKYDIHHSSFISGDCQSSPHFSDARHQAI
Ga0348336_028247_895_14043300034375AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDEFMDDNSENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKKFKNDLNNFACLNWTGESSPEFSSPQH
Ga0348337_013886_2_4303300034418AqueousVEFWEREAYDIAYKITGGNPLYRDLVPHIYLLLSKLDIRESDLPRVFARWGWNQYTWKESKFNQLYRGSIYLSEGYDKIDNSMMYQESKYQQILDQFMDDNPENDQILFCKEITKMHLCGMTYREIRSLTGISLDTIHKAIKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.