NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057990

Metagenome / Metatranscriptome Family F057990

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057990
Family Type Metagenome / Metatranscriptome
Number of Sequences 135
Average Sequence Length 70 residues
Representative Sequence MNPEFLEGRKTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW
Number of Associated Samples 120
Number of Associated Scaffolds 135

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 22.96 %
% of genes near scaffold ends (potentially truncated) 51.85 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.519 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(24.444 % of family members)
Environment Ontology (ENVO) Unclassified
(59.259 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.815 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.61%    β-sheet: 0.00%    Coil/Unstructured: 67.39%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 135 Family Scaffolds
PF13499EF-hand_7 53.33
PF00036EF-hand_1 8.15
PF13405EF-hand_6 4.44
PF13202EF-hand_5 2.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003910|JGI26437J51864_10076345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300004463|Ga0063356_106428928All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea503Open in IMG/M
3300005941|Ga0070743_10101701All Organisms → cellular organisms → Eukaryota966Open in IMG/M
3300005941|Ga0070743_10155956All Organisms → cellular organisms → Eukaryota757Open in IMG/M
3300005988|Ga0075160_10149259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1291Open in IMG/M
3300006803|Ga0075467_10218064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1051Open in IMG/M
3300006874|Ga0075475_10278497All Organisms → cellular organisms → Eukaryota695Open in IMG/M
3300007094|Ga0102532_1114029All Organisms → cellular organisms → Eukaryota1432Open in IMG/M
3300007231|Ga0075469_10146055All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → PX clade → Phaeophyceae → Ectocarpales → Ectocarpaceae → Ectocarpus → Ectocarpus siliculosus646Open in IMG/M
3300007241|Ga0075170_1316185All Organisms → cellular organisms → Eukaryota603Open in IMG/M
3300007550|Ga0102880_1116394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata702Open in IMG/M
3300008832|Ga0103951_10065252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1399Open in IMG/M
3300008835|Ga0103883_1056099All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300008931|Ga0103734_1053279All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Ascidiacea → Phlebobranchia → Cionidae → Ciona → Ciona intestinalis617Open in IMG/M
3300008933|Ga0103736_1047620All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea562Open in IMG/M
3300008934|Ga0103737_1030211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea692Open in IMG/M
3300008935|Ga0103738_1043800All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300009080|Ga0102815_10829170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea527Open in IMG/M
3300009422|Ga0114998_10191832All Organisms → cellular organisms → Eukaryota973Open in IMG/M
3300009432|Ga0115005_10899894All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata714Open in IMG/M
3300009433|Ga0115545_1128637All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata897Open in IMG/M
3300009434|Ga0115562_1307682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea542Open in IMG/M
3300009436|Ga0115008_10195092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1454Open in IMG/M
3300009436|Ga0115008_10433118All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata935Open in IMG/M
3300009436|Ga0115008_10489521All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata878Open in IMG/M
3300009436|Ga0115008_10812790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea686Open in IMG/M
3300009440|Ga0115561_1174541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata829Open in IMG/M
3300009441|Ga0115007_10161711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1439Open in IMG/M
3300009472|Ga0115554_1411600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300009526|Ga0115004_10300001All Organisms → cellular organisms → Eukaryota953Open in IMG/M
3300009593|Ga0115011_10421903All Organisms → cellular organisms → Eukaryota1043Open in IMG/M
3300009599|Ga0115103_1079514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1080Open in IMG/M
3300009599|Ga0115103_1302713All Organisms → cellular organisms → Eukaryota746Open in IMG/M
3300009606|Ga0115102_10755104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea775Open in IMG/M
3300009608|Ga0115100_10466312All Organisms → cellular organisms → Eukaryota671Open in IMG/M
3300009608|Ga0115100_10867435All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Oomycota → Saprolegniales → Saprolegniaceae → Saprolegnia → Saprolegnia parasitica674Open in IMG/M
3300009677|Ga0115104_10056884All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Ascidiacea → Phlebobranchia → Cionidae → Ciona → Ciona intestinalis544Open in IMG/M
3300009705|Ga0115000_10179447All Organisms → cellular organisms → Eukaryota1403Open in IMG/M
3300010309|Ga0102890_1118861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea547Open in IMG/M
3300010883|Ga0133547_11255576All Organisms → Viruses → Predicted Viral1410Open in IMG/M
3300012408|Ga0138265_1109369All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1087Open in IMG/M
3300012416|Ga0138259_1537241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea580Open in IMG/M
3300012504|Ga0129347_1190616All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata565Open in IMG/M
3300012965|Ga0129346_1044988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata738Open in IMG/M
3300012967|Ga0129343_1417097All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea603Open in IMG/M
3300013233|Ga0172420_10450378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea963Open in IMG/M
3300013308|Ga0157375_10821787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1077Open in IMG/M
3300016776|Ga0182046_1212073All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta506Open in IMG/M
3300017710|Ga0181403_1055954All Organisms → cellular organisms → Eukaryota823Open in IMG/M
3300017756|Ga0181382_1121530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea695Open in IMG/M
3300017783|Ga0181379_1124642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea930Open in IMG/M
3300017951|Ga0181577_10742848All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300017957|Ga0181571_10776032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea569Open in IMG/M
3300018049|Ga0181572_10785379All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta568Open in IMG/M
3300018426|Ga0181566_10354926All Organisms → cellular organisms → Eukaryota1050Open in IMG/M
3300018690|Ga0192917_1040655All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea705Open in IMG/M
3300018765|Ga0193031_1040340All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Sophophora → melanogaster group → ananassae subgroup → ananassae species complex → Drosophila ananassae760Open in IMG/M
3300018766|Ga0193181_1020053All Organisms → cellular organisms → Eukaryota924Open in IMG/M
3300018871|Ga0192978_1026159All Organisms → cellular organisms → Eukaryota1083Open in IMG/M
3300018871|Ga0192978_1030674All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta1004Open in IMG/M
3300018888|Ga0193304_1037395All Organisms → cellular organisms → Eukaryota918Open in IMG/M
3300018980|Ga0192961_10202178All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea595Open in IMG/M
3300018980|Ga0192961_10230407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata549Open in IMG/M
3300018980|Ga0192961_10237234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata539Open in IMG/M
3300018981|Ga0192968_10199787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea501Open in IMG/M
3300018989|Ga0193030_10083116All Organisms → cellular organisms → Eukaryota952Open in IMG/M
3300018989|Ga0193030_10255717All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta574Open in IMG/M
3300018996|Ga0192916_10161234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea667Open in IMG/M
3300019017|Ga0193569_10153374All Organisms → cellular organisms → Eukaryota1042Open in IMG/M
3300019019|Ga0193555_10221458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea625Open in IMG/M
3300019033|Ga0193037_10142176All Organisms → cellular organisms → Eukaryota779Open in IMG/M
3300019036|Ga0192945_10273107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300019037|Ga0192886_10320933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea516Open in IMG/M
3300019048|Ga0192981_10097630All Organisms → cellular organisms → Eukaryota1145Open in IMG/M
3300019053|Ga0193356_10248236All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata628Open in IMG/M
3300019053|Ga0193356_10274574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata594Open in IMG/M
3300019055|Ga0193208_10663859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea541Open in IMG/M
3300019108|Ga0192972_1058765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata729Open in IMG/M
3300019131|Ga0193249_1113240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata612Open in IMG/M
3300019149|Ga0188870_10147561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea533Open in IMG/M
3300019149|Ga0188870_10150278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata526Open in IMG/M
3300019150|Ga0194244_10086155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300020161|Ga0211726_10562938All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata592Open in IMG/M
3300020165|Ga0206125_10124404All Organisms → cellular organisms → Eukaryota1062Open in IMG/M
3300020175|Ga0206124_10236479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata711Open in IMG/M
3300020179|Ga0194134_10106647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1358Open in IMG/M
3300020205|Ga0211731_10970551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1722Open in IMG/M
3300020382|Ga0211686_10275063All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea691Open in IMG/M
3300021091|Ga0194133_10509788All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Drosophila → repleta group → mulleri subgroup → mojavensis species complex → Drosophila mojavensis619Open in IMG/M
3300021345|Ga0206688_10217628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata646Open in IMG/M
3300021348|Ga0206695_1781638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata682Open in IMG/M
3300021350|Ga0206692_1363036All Organisms → cellular organisms → Eukaryota580Open in IMG/M
3300021350|Ga0206692_1713664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300021887|Ga0063105_1055398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata698Open in IMG/M
3300021898|Ga0063097_1009976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1009Open in IMG/M
3300021913|Ga0063104_1011260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea983Open in IMG/M
3300021921|Ga0063870_1070457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea573Open in IMG/M
3300021942|Ga0063098_1174940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea504Open in IMG/M
3300021943|Ga0063094_1120014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea730Open in IMG/M
3300021954|Ga0063755_1100694All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea575Open in IMG/M
3300022074|Ga0224906_1171301All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea604Open in IMG/M
3300022926|Ga0255753_1298929All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta624Open in IMG/M
3300023439|Ga0256752_1042406All Organisms → Viruses → Predicted Viral1043Open in IMG/M
3300025138|Ga0209634_1203292All Organisms → cellular organisms → Eukaryota755Open in IMG/M
3300025640|Ga0209198_1173618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea574Open in IMG/M
3300025887|Ga0208544_10078334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1530Open in IMG/M
3300025887|Ga0208544_10316318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Sophophora → melanogaster group → ananassae subgroup → ananassae species complex → Drosophila ananassae604Open in IMG/M
3300026466|Ga0247598_1161425All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Annelida → Polychaeta → Sedentaria → Scolecida → Capitellidae → Capitella → Capitella teleta527Open in IMG/M
3300027264|Ga0255580_1164198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300027781|Ga0209175_10245751All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Acalyptratae → Ephydroidea → Drosophilidae → Drosophilinae → Drosophilini → Drosophila → Sophophora → melanogaster group → ananassae subgroup → ananassae species complex → Drosophila ananassae760Open in IMG/M
3300027791|Ga0209830_10246748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata812Open in IMG/M
3300027810|Ga0209302_10116216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata1334Open in IMG/M
3300027833|Ga0209092_10524593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata602Open in IMG/M
3300027849|Ga0209712_10708341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300027906|Ga0209404_10944253All Organisms → cellular organisms → Eukaryota589Open in IMG/M
3300028647|Ga0272412_1356405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300030564|Ga0210256_10953907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea812Open in IMG/M
3300030635|Ga0247627_10054562All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea873Open in IMG/M
3300030671|Ga0307403_10592815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea601Open in IMG/M
3300030702|Ga0307399_10213042All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata895Open in IMG/M
3300031579|Ga0308134_1145586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea543Open in IMG/M
3300031710|Ga0307386_10777239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300031735|Ga0307394_10344142All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea594Open in IMG/M
3300031735|Ga0307394_10426533All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea532Open in IMG/M
3300031739|Ga0307383_10623680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata545Open in IMG/M
3300032360|Ga0315334_10945519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata746Open in IMG/M
3300032470|Ga0314670_10593591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea573Open in IMG/M
3300032521|Ga0314680_10687519All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea646Open in IMG/M
3300032666|Ga0314678_10487690All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea555Open in IMG/M
3300032711|Ga0314681_10732338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea544Open in IMG/M
3300032725|Ga0314702_1384003All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea527Open in IMG/M
3300032727|Ga0314693_10581434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata608Open in IMG/M
3300032751|Ga0314694_10481798All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea529Open in IMG/M
3300032752|Ga0314700_10578877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300032820|Ga0310342_101701064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea753Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine24.44%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.96%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater6.67%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.93%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.44%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.70%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.22%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.22%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.22%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.96%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.96%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.48%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.48%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.48%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.48%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine1.48%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.74%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.74%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.74%
Hydrothermal Fe-Rich MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Fe-Rich Mat0.74%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine0.74%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.74%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.74%
CoralHost-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral0.74%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.74%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003910Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LWEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005988Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNAEngineeredOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006874Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300007094Freshwater lake microbial communities from Singapore - a non-axenic Oscillatoriales culture (M13A)EnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007241Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 7/17/14 B RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007550Estuarine microbial communities from the Columbia River estuary - metaG 1549A-3EnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008835Eukaryotic communities of water from the North Atlantic ocean - ACM44EnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009440Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009526Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300010309Estuarine microbial communities from the Columbia River estuary - metaG 1552A-3EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013233Combined Assembly of Gp0198154, Gp0198156, Gp0198157, Gp0198161EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017957Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101407AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018049Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018871Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001026 (ERX1789475-ERR1719345)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018996Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782178-ERR1712156)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019019Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002929EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020179Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0mEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300021091Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40mEnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021898Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-55S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021942Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-61M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021943Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-27M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022926Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaGEnvironmentalOpen in IMG/M
3300023439Hydrothermal Fe-rich mat microbial community from TAG Site, Mid-Atlantic Ridge, Atlantic Ocean - 665-MMA12EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027264APAL treatment metatranscriptome co-assemblyHost-AssociatedOpen in IMG/M
3300027781Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 9/18/14 C2 DNA (SPAdes)EngineeredOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028647Metatranscriptome of activated sludge microbial communities from WWTP in Nijmegen, Gelderland, Netherland - WWTP Weurt (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300030564Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR020S0 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030635Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Bnb4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI26437J51864_1007634513300003910Freshwater Lake SedimentVSRNPEFLEGRKTRDEILADFLNNFDGAKGNNDGNVSKAEWVDYYTDLSMSTPSDEYFVRMMESTWQVPEEENS*
Ga0063356_10642892813300004463Arabidopsis Thaliana RhizosphereMNPEFIEGRKSREQILTEFMNNFEGVKGNRDGIITKEEFTDYYTDLSMSVPSDEYFVRMMESTW*
Ga0070743_1010170123300005941EstuarineMNPEFLEGRKTKHEILAEFLNNFDGARGNNDGCVTWNEFYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0070743_1015595623300005941EstuarineMNPEFLEGRKTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0075160_1014925933300005988Wastewater EffluentMNPEFIEGRKTREQILGDFLNNFEGAKGNRDGTITKEEFFDYYTDLSMSVPSDEYFVRMMESTW*
Ga0075467_1021806413300006803AqueousQININDISGIYDVSMNPEFLEGRKTRDEILADFLNNFDGARGNNDGCVTKKEWDDYYTDLSMSTPSDEYFVRMMESTW*
Ga0075475_1027849733300006874AqueousVSCNPEFVEGRKTKEQILADFLNQFDGSRGNNDGVVTWDEWQEYYAELSMSTPSDEYFVRMMEQTWQVPEDEETPLVKQTVQHL
Ga0102532_111402933300007094Freshwater LakeMMDQDNTGNINIQDITRIYDVSRNPEFLEGRKTRDEILADFLNNFDGARGNNDGNISKAEWDDYYTDLSMSTPSDEYFVRMMESTWQVPEEENS*
Ga0075469_1014605513300007231AqueousMTMVNKAFSMLDTDGSGQININDISGIYDVSMNPEFLEGRKTRDEILADFLNNFDGARGNNDGCVTKKEWDDYYTDLSMSTPSDEYFVRMMESTW*
Ga0075170_131618513300007241Wastewater EffluentLNIQDLLAVYDVSMNPEFIEGRKTREQILGDFLNNFEGAKGNRDGTITKEEFFDYYTDLSMSVPSDEYFVRMMESTW*
Ga0102880_111639423300007550EstuarineMNPEFLEGRKTKHEIPAEFLNNFDGARGNNDGCVTWNEFYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0103951_1006525213300008832MarineMNPEFLEGRKTKDEILAEFLNNFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW*
Ga0103883_105609913300008835Surface Ocean WaterGIYDVSMNAGFLEGRKTKEEILAEFLNGFDGARGNNDGIVTWEEFYDYYADLSMSTPSDEYFVRMMESTW*
Ga0103734_105327913300008931Ice Edge, Mcmurdo Sound, AntarcticaIKEFLEGKKTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDHSMSTPSDEYFVRMMESSW*
Ga0103736_104762013300008933Ice Edge, Mcmurdo Sound, AntarcticaTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0103737_103021113300008934Ice Edge, Mcmurdo Sound, AntarcticaMNPEFLEGKKTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0103738_104380023300008935Ice Edge, Mcmurdo Sound, AntarcticaVLNIYDVSMNPEFLEGKKTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0102815_1082917013300009080EstuarineKTKHEILAEFLNNFDGARGNNDGCVTWKEFYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0114998_1019183213300009422MarineMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW*
Ga0115005_1089989413300009432MarineLEGRKTRDEILATFLNNFDGPRGNNDGCVTWDEFCDYYSDLGMSTPSDEYFVRMMETT
Ga0115545_112863733300009433Pelagic MarineMNPEFLEGRKTRDDILGDFLNNFDGAKGNNDGIVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW*
Ga0115562_130768213300009434Pelagic MarinePEFLEGKRTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFARMMEAAW*
Ga0115008_1019509223300009436MarineMNPEFLEGKKTKEEILAEFLNNFDGPRGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVKIMESTW*
Ga0115008_1043311813300009436MarineMVNKAFAMMDRDQSGVINIQDIGGIYDVSMNPEFLEGRKTREEILQDFLNNFDGARGNNDGQVTKQEWDDYYTDLSMSTPSDEYFVRMMESTW*
Ga0115008_1048952123300009436MarineMNPEFLEGRKTRDEILGDFLNNFDGAKGNNDACVTMQEFADYYTDLSMSTPSDEYFVRMMESTW*
Ga0115008_1081279013300009436MarineGRKTKDEILVEFLNNFDGARGNNDGILTWEEFYDYYSDLAMSTPSDEYFVKMMESAW*
Ga0115561_117454123300009440Pelagic MarineSNTGVITISDVAGIYDVSMNPEFLEGRKSRDEILSDFLSNFEGRSNIEGAAKGDGNITFQEFCDYYTDLSMSTPSDEYFVRMMESTW*
Ga0115007_1016171123300009441MarineMVQKAFAMLDKSNTGVITISDVAGIYDVSMNPEFLEGRKSRDEILSDFLSNFEGRSNIEGAAKGDGNITFQEFCDYYTDLSMSTPSDEYFVRMMESTW*
Ga0115554_141160013300009472Pelagic MarineDVAGIYDVSMNPEFLEGRKTKDEILVEFLNNFDGARGNNDGILTWEEFYDYYSDLAMSTPSDEYFVKMMESAW*
Ga0115004_1030000133300009526MarineVIHIYDVSMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0115011_1042190333300009593MarineLEGRKTKDEILAEFLNNFDGPRGNNDGCVTWDEFCDYYSDLGMSTPSDEYFVRMMETTWQVPEHEDS*
Ga0115103_107951423300009599MarineMNPEFLEGRKTRDEILGDFLNNFDGAKGNNDACVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW*
Ga0115103_130271323300009599MarineMNPEFLEGRKTRDEILGDFLNNFDGAKGNNDGVVTMQEFADYYTDLSMSTPSDEYFVRMMESTW*
Ga0115102_1075510413300009606MarineGIYDVSMNPEFLEGRKTRDEILQDFLNNFDGAKGNNDGIVTMQEWTDYYTDLSMSTPSDEYFVRMMESTW*
Ga0115100_1046631213300009608MarineKDGSGKVTISDIAGIYDVSMNPEFLEGKKTKDEILAEFLNNFDGARGNNDGILTWEEFYDYYCDLSMSTPSDEYFVKMMESTW*
Ga0115100_1086743523300009608MarineMNPEFLEGLKTRDEILGDFLNNFDGAKGNNDGVVTMQEFADYYTDLSMSTPSDEYFVRMMESTW*
Ga0115104_1005688413300009677MarineGIYDVSMNPEFLEGKKTKDEILGEFLNNFDGSKGNNDGVVTWNEFYDYYSDLSMSTPSDEYFVRMMESAW*
Ga0115000_1017944733300009705MarineVIHIYDVSMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW*
Ga0102890_111886113300010309EstuarineEFLEGRKTKHEILAEFLNNFDGARGNNDGCVTWNEFYDYYSDLSMSTPSDEYFVRMMESSW*
Ga0133547_1125557623300010883MarineLEGRKTKDEILAEFLNNFDGPRGNNDGCVTFAEFCDYYSDLGMSTPSDEYFVRMMETTW*
Ga0138265_110936923300012408Polar MarineMNPEFLEGRKTRDDILGDFLNNFDGAKGNNDGIVTVNEFTDYYTDLSMSTPSDEYFVRMMESTW*
Ga0138259_153724113300012416Polar MarineMNPEFLEGKKTKDEILGEFLNNFDGAAGNNDGIVTWAEWYDYYSDLSMSTPSDEYFVRMMESAW*
Ga0129347_119061613300012504AqueousITVSDIHGIYDVSMNPEFLEGKKTKDEILAEFLNNFDGVRGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESAW*
Ga0129346_104498823300012965AqueousMNPEFLEGKKTKDEILAEFLNNFDGVRGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESAW*
Ga0129343_141709713300012967AqueousHIYDVSMNPEFLEGKKSKEEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW*
Ga0172420_1045037823300013233MarineMVQKAFTMLDKDCSGQVTIQDIIGIYDVSMNPEFIEGRKTKEEILGAFLNEFDGARGNNDGVITQAEFFDYYTDLSMSTPSDEYFVRMMESAW*
Ga0157375_1082178713300013308Miscanthus RhizosphereMNPEFIEGRKTREQILNEFLNNFEGVKGNSIISKQEFYDYYTDLSMSIPSDEYFVRMMESTW*
Ga0182046_121207313300016776Salt MarshPEFLEGKKTKDEILGEFLNNFDGNRGNNDGCLTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0181403_105595423300017710SeawaterMLDKDQSGKITVSDIAGVYDVSMNPEFLEGRKTKDEILGEFLNGFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0181382_112153033300017756SeawaterSMNPEFLEGRKTKDEILVEFLNNFDGARGNNDGIVTWEEFYEYYADLSMSTPSEEYFVKMMESTW
Ga0181379_112464243300017783SeawaterMNPEFLEGRKTKDEILAEFLNNFDGARGNNDGVVTWEEFYDYYSDLSMSTPSEEYFVKMMESTW
Ga0181577_1074284823300017951Salt MarshIKVNDIDGIYDVSMNPEFLEGRKTKHEILAEFLNNFDGARGNNDGCVTWNEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0181571_1077603213300017957Salt MarshIYDVSMNPEFLEGRKTKHEILAEFLNNFDGARGNNDGCVTWNEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0181572_1078537913300018049Salt MarshSMNPEFLEGKKTKDEILGEFLNNFDGNRGNNDGCLTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0181566_1035492623300018426Salt MarshMNPEFLEGRKTKHEILAEFLNNFDGARGNNDGCVTWNEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0192917_104065513300018690MarineEGRKTRDEILSDFLNNFDGARGNNDGVITRAEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193031_104034013300018765MarineGVINIDDIGAIYDVSMNPEFLEGRKTREEILHDFLNNFDGARGNNDGAVTKQEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193181_102005323300018766MarineMNPEFLEGRKGKDEILMEFLNNFDGPRGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0192978_102615923300018871MarineMNPEFLEGRKTRDEILSDFLNNFDGAKGNNDGIVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0192978_103067413300018871MarineLEGRKTRDEILAEFLNNFDGPRGNNDGCVTWDEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0193304_103739523300018888MarineMNPEFLEGRKTRDEILQDFLNNFDGARGNNDGVVTRAEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0192961_1020217823300018980MarineGKKTKEQILGEFLNNFDGAAGNNDSVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW
Ga0192961_1023040723300018980MarineSGNGEITVSDIAGIYDVSQSPEFLEGRKTRDEILGEFLNNFDGPRGNNDGKITWAEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0192961_1023723423300018980MarineGEITVSDIAGIYDVSQSPEFLEGRKTRDEILGEFLNNFDGPRGNNDGKITWAEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0192968_1019978723300018981MarineEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMEST
Ga0193030_1008311623300018989MarineMNPEFLEGRKTRDEILSDFLNNFDGAKGNKDGVVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0193030_1025571713300018989MarineYDVSQSPEFLEGRKTRDEILAEFLNNFDGPRGNNDGTVTWDEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0192916_1016123413300018996MarineKTRDEILSDFLNNFDGARGNNDGVITRAEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193569_1015337423300019017MarineMNPEFLEGRKTRDEILQDFLNNFDGARGNNDGVVTRQEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193555_1022145823300019019MarineLEGRMSREEILQAFLNNFDGAKGNNDGVVSKKEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193037_1014217623300019033MarineVSKNPEFLEGRATKEQILTNFLNQFDGARGNDDGCVTLDEFMDYYRDVGMSVPSDEYFV
Ga0192945_1027310713300019036MarineDVAMNPEFLEGKKTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW
Ga0192886_1032093323300019037MarinePDFLENRLSKEQILENFLNQFDGARGNNDGIVTVDEFMDYYTDVSMSCPSDEYFVQMMESTW
Ga0192981_1009763023300019048MarineMNPEFLEGRKTRDEILGDFLNNFDGAKGNNDGVVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0193356_1024823613300019053MarineMNPEFLEGRKTREEILHDFLNNFDGARGNNDGAVTKQEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193356_1027457423300019053MarineMDTDGSGQLTISDIAGIYDVSMNPEFLEGRKTRDEILSDFLNNFDGARGNNDGVVTRAEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0193208_1066385923300019055MarineGRKTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0192972_105876523300019108MarineMNPEFLEGRKTRDDILGDFLNNFDGAKGNNDGIVTVQEFTDYYTDLSMSTPSDEYFVRMMESTW
Ga0193249_111324023300019131MarineITVGDIAGIYDVSMNAEFLEGRKTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0188870_1014756113300019149Freshwater LakeVSMNPEFLEGRKTKDEILGEFLNGFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0188870_1015027823300019149Freshwater LakeMNPEFLEGKKTKEEILAEFLNNFDGPRGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0194244_1008615533300019150MarineLNPEFLEGRKTKDEILGEFLNGFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0211726_1056293813300020161FreshwaterMVNKAFRMMDQDNTGNINIQDITRIYDVSRNPEFLEGRKTRDEILADFLNNFDGARGNNDGNVSKAEWDDYYTDLSMSTPSDEYFVRMMESTWQVPEEENS
Ga0206125_1012440423300020165SeawaterMNPEFLEGRKTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0206124_1023647913300020175SeawaterDKDASGKITVSDVAGIYDVSMNPEFLEGRKTKDEILVEFLNNFDGARGNNDGILTWEEFYDYYSDLAMSTPSDEYFVKMMESAW
Ga0194134_1010664723300020179Freshwater LakeMVAKAFAMLDKNGSGELSIHDIIGIYDVSRNPEFLESRKTKEEILNDFLSNFEGARGDRNGSITKAEFFDYYTDLSTCLPSEEYFVRMMESTW
Ga0211731_1097055123300020205FreshwaterLNPEFVEQKKTKDQILNELLGNFEGAKGNGDGTVTFQEFFDYYSDLSMSVPNDEYFVRMLESAW
Ga0211686_1027506313300020382MarineMNPEFLEGRKAKDEILMEFLNNFDGPRGNNDGTVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0194133_1050978813300021091Freshwater LakeLSPRRAAMVAKAFAMLDKNGSGELSIHDIIGIYDVSRNPEFLESRKTKEEILNDFLSNFEGARGDRNGSITKAEFFDYYTDLSTCLPSEEYFVRMMESTW
Ga0206688_1021762823300021345SeawaterGNGVITVSDIAGIYDVSQSPEFLEGRKTRDEILGEFLNNFDGPRGNNDGKVTWEEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0206695_178163823300021348SeawaterMNPEFLEGRKTRDEILGDFLNNFDGAKGNNDSCVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0206692_136303623300021350SeawaterMNPEFLEGRKTRDEILSDFLNNFDGAKGNKDGVVTMQEFCDYYTDLSMSTPSDEYFV
Ga0206692_171366413300021350SeawaterITVSDIAGIYDVSQSPEFLEGRKTRDEILGEFLNNFDGPRGNNDGKVTWEEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0063105_105539813300021887MarineMNPEFLEGRKTRDDILGDFLNNFDGAKGNNDGIVTMQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0063097_100997623300021898MarineMLDKSNTGVITISDVAGIYDVSMNPEFLEGRKSRDEILSDFLSNFEGRSNIEGAAKGDGNITFQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0063104_101126023300021913MarineMVQKAFAMLDKSNTGVITISDVAGIYDVSMNPEFLEGRKSRDEILSDFLSNFEGRSNIEGAAKGDGNITFQEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0063870_107045713300021921MarineITVSDVINIYDVAMNPEFLEGKKTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW
Ga0063098_117494013300021942MarineDIGGIYDVSMNPEFLEGRKTREEILQDFLNNFDGARGNNDGQVTKQEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0063094_112001413300021943MarineLEGRKTKDEILAEFLNNFDGPRGNNDGCVTFAEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0063755_110069413300021954MarineINIYDVAMNPEFLEGKKTKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW
Ga0224906_117130123300022074SeawaterPEFLEGRKSKDEILMEFLNNFDGPRGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTWQCPENEDSDVTR
Ga0255753_129892913300022926Salt MarshRDGSGKVTISDIAGIYDVSMNPEFLEGKKTKDEILGEFLNNFDGNRGNNDGCLTWEEFYDYYSDLSMSTPSDEYFVRMMESTW
Ga0256752_104240623300023439Hydrothermal Fe-Rich MatMVQKAFSMLDKDCSGQVTIQDIIGIYDVSMNPEFIEGRKTKEDILGAFLNEFDGARGNNDGVITQAEFFDYYTDLSMSTPSDEYFVRMMESAW
Ga0209634_120329223300025138MarineMNPEFLEGRKTKDEILAEFLNNFDGARGNNDGVVTWEEFVDYYSDLSMCTPSDEYFVRMMETTW
Ga0209198_117361823300025640Pelagic MarineKTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0208544_1007833423300025887AqueousMTMVNKAFSMLDTDGSGQININDISGIYDVSMNPEFLEGRKTRDEILADFLNNFDGARGNNDGCVTKKEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0208544_1031631813300025887AqueousMTMVNKAFAMLDRDGSGQININDISGIYDVSMNPEFLEGRKTRDEILADFLNNFDGARGNNDGCVTKKEWDDYYTDLSMSTPSDEYFVRMMESTW
Ga0247598_116142513300026466SeawaterAGIYDVSMNPEFLEGRKTKDEILAEFLNNFDGARGNNDGVVTWEEFYDYYSDLSMSTPSEEYFVKMMESTW
Ga0255580_116419813300027264CoralMNPEFIEGRKTKEEILSAFLNEFDGPRGNNDGIITRAEFFDYYTDLSMSIPSDEYFVRMMESTW
Ga0209175_1024575113300027781Wastewater EffluentMNPEFIEGRKTREQILGDFLNNFEGAKGNRDGTITKEEFFDYYTDLSMSVPSDEYFVRMMESTW
Ga0209830_1024674823300027791MarineMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0209302_1011621623300027810MarineMKAFAMLDRDGSGAIQVSDIAGIYDVSMNPEFLEGRKSRDDILMDFLGNFEGARGNKDGIITTEEFCDYYTDLSMSTPSDEYFVRMMESTW
Ga0209092_1052459313300027833MarineMNPEFLEGKKTKEEILAEFLNNFDGPRGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVKIMESTW
Ga0209712_1070834123300027849MarineLEGRKTRDEILATFLNNFDGPRGNNDGCVTWDEFCDYYSDLGMSTPSDEYFVRMMETTW
Ga0209404_1094425313300027906MarineLEGRKTKDEILAEFLNNFDGPRGNNDGCVTWDEFCDYYSDLGMSTPSDEYFVRMMETTWQVPEHEDS
Ga0272412_135640513300028647Activated SludgeMYDVSCHKDFIEGRKTKEQIVNEFLNTFDGAKGNNDGTIAKTEWYDYYTDLSISLPSDDYFVQMMES
Ga0210256_1095390723300030564SoilLTEFLNNFEGAKSKGKGDGVVTQAEFTDYYTDLSMSCPSDEYFVRMMESSWQVPENDDDQTVKATVKLLLVEVR
Ga0247627_1005456233300030635SoilMSPDYIEGRKTKEQILVEFLNNFEGAKGNRDGVISMSEFFDYYTDLSMSCPSDEYFVRMMESTWQIPEDDDQTACKATV
Ga0307403_1059281523300030671MarineTVSDICNIYDVSQNPDFLENRLSKEQILENFLNQFDGARGNNDGVVTFAEFVDYYTDLSMSIPSD
Ga0307399_1021304223300030702MarineMNPEFLEGRKTRDDILGDFLNNFDGAKGNNDGIVTVNEFTDYYTDLSMSTPSDEYFVRMMESTW
Ga0308134_114558613300031579MarineMNPEFLEGKKSKEQILGEFLNNFDGAAGNNDGVVTWEEWYDYYSDLSMSTPSDEYFVRMMESSW
Ga0307386_1077723913300031710MarineKITVSDIAGIYDVSMNPEFLEGKKTKDEILADFLNNFDGPRGNNDGCVEWKEFVDYYTDLSMSTPSDEYFVRMMESSW
Ga0307394_1034414213300031735MarineMNPEFLEGRKTRDDILGDFLNNFDGAKGNNDGIVTVQEFTDYYTDLSMSTPSDEYFVRMM
Ga0307394_1042653323300031735MarineKITVSDVIHIYDVSMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0307383_1062368013300031739MarineKITVSDIAGIYDVSMNPEFLEGRKAKDEILMEFLNNFDGPRGNNDGTVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0315334_1094551923300032360SeawaterMNPEFLEGKKTKDQILAEFLNNFDGAKGNNDGIVTWEEWYDYYSDLSMSTPSDEY
Ga0314670_1059359113300032470SeawaterLEGKKTKDEILAEFLNNFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0314680_1068751913300032521SeawaterSDVAGIYDVSMNPEFLEGRKTKDEILVEFLNNFDGARGNNDGILTWEEFYDYYSDLAMSTPSDEYFVKMMESAW
Ga0314678_1048769013300032666SeawaterASGKITVSDVIHIYDVSMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0314681_1073233813300032711SeawaterEGKRTKDEILAEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVRMMEAAW
Ga0314702_138400313300032725SeawaterTKDEILAEFLNNFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0314693_1058143413300032727SeawaterTDGSAKITVSDINGIYDVSMNPEFLEGKKGKDEILAEFLNNFDGARGNNDGVVTWEEFYDYYSDLSMSTPSDEYFVRMMESSW
Ga0314694_1048179813300032751SeawaterPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0314700_1057887723300032752SeawaterDVSMNPEFLEGKKTKEEILMEFLNNFDGARGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTW
Ga0310342_10170106413300032820SeawaterEFLEGKKTKEEILAEFLNNFDGPRGNNDGIVTWEEFYDYYSDLSMSTPSDEYFVKMMESTWQVPENEDSDITRQTVKMLYSEVKSRIL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.