Basic Information | |
---|---|
Family ID | F057814 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 135 |
Average Sequence Length | 50 residues |
Representative Sequence | MIEKIGAVHLIKSYGGEGRKYPEVPRVKYMVLPKCGTKYKKVGLNTNLI |
Number of Associated Samples | 68 |
Number of Associated Scaffolds | 135 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 64.00 % |
% of genes near scaffold ends (potentially truncated) | 11.11 % |
% of genes from short scaffolds (< 2000 bps) | 18.52 % |
Associated GOLD sequencing projects | 68 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.20 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (96.296 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (85.185 % of family members) |
Environment Ontology (ENVO) | Unclassified (97.778 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (88.148 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 0.00% Coil/Unstructured: 90.91% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 135 Family Scaffolds |
---|---|---|
PF00067 | p450 | 9.63 |
PF07714 | PK_Tyr_Ser-Thr | 1.48 |
PF01593 | Amino_oxidase | 0.74 |
PF00190 | Cupin_1 | 0.74 |
PF03462 | PCRF | 0.74 |
PF07859 | Abhydrolase_3 | 0.74 |
COG ID | Name | Functional Category | % Frequency in 135 Family Scaffolds |
---|---|---|---|
COG2124 | Cytochrome P450 | Defense mechanisms [V] | 9.63 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 5.93 |
COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.74 |
COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.74 |
COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 96.30 % |
All Organisms | root | All Organisms | 3.70 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005617|Ga0068859_101610661 | Not Available | 717 | Open in IMG/M |
3300015324|Ga0182134_1147091 | Not Available | 504 | Open in IMG/M |
3300015327|Ga0182114_1091119 | Not Available | 638 | Open in IMG/M |
3300015327|Ga0182114_1120532 | Not Available | 570 | Open in IMG/M |
3300015328|Ga0182153_1061481 | Not Available | 709 | Open in IMG/M |
3300015330|Ga0182152_1041508 | Not Available | 824 | Open in IMG/M |
3300015335|Ga0182116_1075454 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 725 | Open in IMG/M |
3300015336|Ga0182150_1111165 | Not Available | 593 | Open in IMG/M |
3300015337|Ga0182151_1135381 | Not Available | 548 | Open in IMG/M |
3300015338|Ga0182137_1004467 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1749 | Open in IMG/M |
3300015338|Ga0182137_1092475 | Not Available | 668 | Open in IMG/M |
3300015349|Ga0182185_1044153 | Not Available | 1150 | Open in IMG/M |
3300015350|Ga0182163_1180010 | Not Available | 661 | Open in IMG/M |
3300015352|Ga0182169_1091967 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 964 | Open in IMG/M |
3300015352|Ga0182169_1231491 | Not Available | 602 | Open in IMG/M |
3300015353|Ga0182179_1187174 | Not Available | 656 | Open in IMG/M |
3300015354|Ga0182167_1088833 | Not Available | 1121 | Open in IMG/M |
3300017414|Ga0182195_1078744 | Not Available | 755 | Open in IMG/M |
3300017693|Ga0182216_1166778 | Not Available | 567 | Open in IMG/M |
3300017693|Ga0182216_1171564 | Not Available | 560 | Open in IMG/M |
3300028055|Ga0268338_1014987 | Not Available | 708 | Open in IMG/M |
3300028142|Ga0268347_1009000 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 758 | Open in IMG/M |
3300028142|Ga0268347_1025670 | Not Available | 555 | Open in IMG/M |
3300032468|Ga0214482_1006089 | Not Available | 1836 | Open in IMG/M |
3300032791|Ga0314748_1006358 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae | 1987 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 85.19% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 11.11% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.22% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 1.48% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
3300009990 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaG | Host-Associated | Open in IMG/M |
3300015270 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015284 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017421 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300020223 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_31MAY2016_LD2 MG | Host-Associated | Open in IMG/M |
3300028050 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028053 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028055 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028142 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028248 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028475 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
3300028477 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032514 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032791 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032823 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032970 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033530 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068859_1016106612 | 3300005617 | Switchgrass Rhizosphere | RNFTMIEKIGAVHLIKFYDGEDRKYLEVPRIKYLVLPKYRTKYQK* |
Ga0068859_1025578731 | 3300005617 | Switchgrass Rhizosphere | KKIEAVHLIKSYDGEGMKYPEVSRIKYRVVPKYGTKYQKVRPNTNLI* |
Ga0068863_1009882171 | 3300005841 | Switchgrass Rhizosphere | MIEKIGAVHLIKSYGDERRKYLEVSKIKYLVLPKCRTKYQKIGPNTNLI* |
Ga0105133_1093741 | 3300009981 | Switchgrass Associated | LIKSFSGEGRKYLEILRIKYLVLPKYRTKYQKVRLDTNLIYNLFSL* |
Ga0105132_1290211 | 3300009990 | Switchgrass Associated | EDVHLIKSYSGEDRKYLEVPRIKYLIIPKSRTKYQKVGPNTNLI* |
Ga0182183_10734271 | 3300015270 | Switchgrass Phyllosphere | MIEKIGVVYLIKFYGGEGRKYPEVLRLKNLVLSKYGTKYQKVGPNTNLINFYKYFP* |
Ga0182100_10099011 | 3300015280 | Switchgrass Phyllosphere | MIKKIGVVNLIKSYGGESRKYPEVPRIKYLVLPKYGTKYQKVRPTTNLI* |
Ga0182100_10222482 | 3300015280 | Switchgrass Phyllosphere | MRKFIMIEKIEVVHLIKSYGGEDRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI* |
Ga0182101_10035562 | 3300015284 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKSYGGEGRKYPEVPRVKYLILTKCGTKYQKMGLNTNLISFL* |
Ga0182105_10689241 | 3300015290 | Switchgrass Phyllosphere | AVHRIKSNGGEDRKYLEIPRIKYLVLPKYETKYQNVGPNTNLIYFL* |
Ga0182104_10634832 | 3300015297 | Switchgrass Phyllosphere | MIEKIGAVHLIKFYGDEGRKYLEVPKIKYLVLLKYEIKYQKARPDTNLI* |
Ga0182184_10755672 | 3300015301 | Switchgrass Phyllosphere | MIEKIGAVHLIKSYGGEGRKYPEVPRVKYMVLPKCGTKYKKVGLNTNLI* |
Ga0182182_10310032 | 3300015311 | Switchgrass Phyllosphere | MRKFTMIEKIDVVHLIKSYGGEGRKYPEIPRVKYLILTKCGTKYQKMGLDTNLI* |
Ga0182168_11336681 | 3300015312 | Switchgrass Phyllosphere | SNICNKRNFIMIEKTGAIYLIKSYGGEGRKYPKVPRVKYVILPKYGTKYQKVGPNTNLIYFL* |
Ga0182164_11277511 | 3300015313 | Switchgrass Phyllosphere | MEKFTMIEKIGAVHLIKSYGDEGRKYLKVSKIKYLVLPKCRTKYQKMGLNTNLI* |
Ga0182121_10185731 | 3300015316 | Switchgrass Phyllosphere | TWVNIMRKFTMIEKIEVVHLIKSYGGESSKYPEATRVKYLILPKCGTKYQKMGLNINLI* |
Ga0182121_10445451 | 3300015316 | Switchgrass Phyllosphere | LKKIEAVHLIKSYDGEGMKYPEVPRIKHLVVPKYETKYQKVRPNINLIYF |
Ga0182121_10660171 | 3300015316 | Switchgrass Phyllosphere | MIEKIGAVYLIKSYGGEDSKYLEVSGIKYFYLVLPKCGIKYQNLGSNINLI* |
Ga0182136_10166261 | 3300015317 | Switchgrass Phyllosphere | MRAVYLIKSYGGEGRKYLEVPRVKYMILQKCETKYQNVGPNTNLI* |
Ga0182136_10481201 | 3300015317 | Switchgrass Phyllosphere | LKKIGAVYLIKFYGGQDRKYPEVPMVKYLVFPKCGTKYQKIGLNTNLI* |
Ga0182136_10913821 | 3300015317 | Switchgrass Phyllosphere | MIKKIGAVNLIKSYGGESRKYPEVPRIKYIVLPKYGIKYQKVRPTTNLI* |
Ga0182130_10069122 | 3300015319 | Switchgrass Phyllosphere | MQGNKAIQQYMRNFTMIEKIGTVHLIKSYGSEGRKYHEVRRIKYLVLPKCGTKYQKVG |
Ga0182130_10870451 | 3300015319 | Switchgrass Phyllosphere | MIEKIGAVHLIKSYGDEGRKYLEVSKIKYLVLPKCRTKYQKMGPNTKLI* |
Ga0182165_10001285 | 3300015320 | Switchgrass Phyllosphere | VVVHLIKSYGGENRKYLEVLRIKYMILPKCGTKYQKMRLDINLI* |
Ga0182165_11230991 | 3300015320 | Switchgrass Phyllosphere | LKKIGVVHLIKSYGSEGRKYPEVPRIMYLVLPKCETKYQKVGPNTNLI* |
Ga0182134_11470911 | 3300015324 | Switchgrass Phyllosphere | LKKIGAVHLIKFYGDERRKYLEVPKIKYLVLLKYEIKYQKARPDTN |
Ga0182114_10911191 | 3300015327 | Switchgrass Phyllosphere | MRNFTIIEKIGAVYLIKFYGGESRKYPEVPRVKYLVLPKYWTKYQK* |
Ga0182114_10938331 | 3300015327 | Switchgrass Phyllosphere | MIEKIEAVHRIKSNGGEDRKYLEVPRIKYLVLPKYETKYQNVGPNTNLIYFL* |
Ga0182114_11205321 | 3300015327 | Switchgrass Phyllosphere | MIEKIGAVYLIKSYCGEGRKYPEVPRVKYLILPKCETKYQNQWDQ |
Ga0182153_10614811 | 3300015328 | Switchgrass Phyllosphere | MIEKIGAVHLIKSYGGEGLHPEVPRLKYLVLSKYGTKYQK* |
Ga0182153_10655602 | 3300015328 | Switchgrass Phyllosphere | MIEKIGAVHLIKSYGSEGRKYPEVYRIKYLVLSKYGTKYQKVETNTNLI* |
Ga0182135_10014173 | 3300015329 | Switchgrass Phyllosphere | MIEKIGAVHLIKSYGGEGMKYLKVPMKKYLVLPKCGTKYQKVGLNTNLI* |
Ga0182152_10415081 | 3300015330 | Switchgrass Phyllosphere | LKKIEAVHLIKSYGGEDRKYLEIFRIKHQVLSKCGTKHQKVGPNTN |
Ga0182131_10187721 | 3300015331 | Switchgrass Phyllosphere | MRNFTRIEKIGAVHLVKSYGGESRKYPEVPRVKYLILTKCGTKYEKWWEQVVI* |
Ga0182131_10916691 | 3300015331 | Switchgrass Phyllosphere | MIEKIGAIYLIKSYGGEGRKYPEVHGGWGGGVKYLVLPKCGTKYQKMGPITNLI* |
Ga0182117_10249481 | 3300015332 | Switchgrass Phyllosphere | MRDFTRIEKIGAVHLVKSYGGEGRKHPEVPRVKYLILTKCRTKYEKWWEQVVI* |
Ga0182117_10679041 | 3300015332 | Switchgrass Phyllosphere | VHLIKSYDDEGKKYLVLPKCRTKYQKIGPNTNLI* |
Ga0182147_10011221 | 3300015333 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKSYGGEGRKYPEVHRVKYLILTKCGTKYQKMGLDTNLI* |
Ga0182132_10020311 | 3300015334 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKSYGGEGRKYPEVPRVKYLILTKCGTKYQKMRLDTNLI* |
Ga0182132_11142322 | 3300015334 | Switchgrass Phyllosphere | MIEKIGIVRLIKSYGGKGRKYPKVFRIKYLVVSKCGTKYQKVGSNTNLF* |
Ga0182132_11628941 | 3300015334 | Switchgrass Phyllosphere | MRNFTRIEKIGTVHLVKSYGGEGRKYTEVPRVKYLILIKCGTKYEKWWEQVVI* |
Ga0182116_10186552 | 3300015335 | Switchgrass Phyllosphere | MIEKIEVVHLIKSYGGEGRKYPEVHRVKYLILTKCGTKYQKMGLNINLI* |
Ga0182116_10754542 | 3300015335 | Switchgrass Phyllosphere | RNFTMIEKIGAVHLIKSYGGEGLHPEVHRLKYLVLSKYGTKYQK* |
Ga0182150_10635271 | 3300015336 | Switchgrass Phyllosphere | MRNFTRIEKIGAVHLVKSYGGEDRKYPEVPRVKYLILTKCGTKYEKWWEQVVT* |
Ga0182150_10740101 | 3300015336 | Switchgrass Phyllosphere | MQGNKAIQQYMRNFTMIEKIGTVHLIKSYGSEGRKYLEVRRIKYLVLPKCGTKYQK |
Ga0182150_11111651 | 3300015336 | Switchgrass Phyllosphere | MIEKIVAVHLIKLYGGESRKYPEVLRVKYLILSKYGTKYQKVARKKIKIKFNLFL* |
Ga0182151_11353811 | 3300015337 | Switchgrass Phyllosphere | MIEKIGAVRLIKSYRGEYRKCLEVPRIKYVVLRKCGTKHQKVG |
Ga0182137_10044672 | 3300015338 | Switchgrass Phyllosphere | MIKKIGAVHLIKSYGGECRKYLEIPRIKYLVLPNCGTKYQKNEIEY* |
Ga0182137_10924752 | 3300015338 | Switchgrass Phyllosphere | EKIGAVHLIKLYGGEGRKYPEVPTVKYLILSKYETKYQKVARKKSR* |
Ga0182137_11275721 | 3300015338 | Switchgrass Phyllosphere | MRNFTMIEKIGAARLIKSYRGEYRKCLEVRRIKYVVLRKCGTKHQKMGSNTN |
Ga0182137_11703782 | 3300015338 | Switchgrass Phyllosphere | MIEKTGAVHLIKSYGGEGRKYLEVVRIKYLVLPKCATKNQKMEPNNNLIYFL* |
Ga0182149_10712882 | 3300015339 | Switchgrass Phyllosphere | MIEKIGVVYLIKSYGGEGKKFLEVFGIKYLVLLKCGIKYQKVESNINLI* |
Ga0182149_11616791 | 3300015339 | Switchgrass Phyllosphere | HLIKSYGDEGRKYLEVPRIKYLVLPKCEIKYQKMGLNTNLV* |
Ga0182133_10635091 | 3300015340 | Switchgrass Phyllosphere | MIEKTGAVHLIKSYGGEGRKYLEVVRIKYLVLPKCATKYQKMEPNNNLI* |
Ga0182115_10011872 | 3300015348 | Switchgrass Phyllosphere | MIEKIGTVHLIKSYGGEDRKYPEVSKIKYLVLPKCGIKYQKMGSNNNLI* |
Ga0182115_10174111 | 3300015348 | Switchgrass Phyllosphere | RNFIMIEKIGAVHLIKSYGSEGRKYPEVYRIKYLVLSKCGTKYRKMGPNANLIYFFINT* |
Ga0182115_11411991 | 3300015348 | Switchgrass Phyllosphere | MIEKIGAGHLIKSYSGEGRKYLEVFRIKYLVLPKCETKYQKMGLNINLIYFL* |
Ga0182115_11908151 | 3300015348 | Switchgrass Phyllosphere | MIEKIGAVYLIKSYGGEDSKYLEVSGIKYFYLVLPKCEIKYQNVGSNINLI* |
Ga0182185_10321891 | 3300015349 | Switchgrass Phyllosphere | KIGAVYLIKSYGGEDSKYLEVSGIKYFYLVLPKCGIKYQNVGSNINLI* |
Ga0182185_10441532 | 3300015349 | Switchgrass Phyllosphere | MIEKIGVIHLIKSYNGKGRKYPKISRVKYLVLPKGGTKYQKIETKY* |
Ga0182185_10517751 | 3300015349 | Switchgrass Phyllosphere | MIEKIETIHLIKSKDGENRKYIKYLVLPKCGIKYQKMEPNTNLI* |
Ga0182185_10530171 | 3300015349 | Switchgrass Phyllosphere | MIEKIGVVHLIKSYGSEGGKYLKVLRIKYLVLPKCGTKYQKVGPNTNLI* |
Ga0182185_10589481 | 3300015349 | Switchgrass Phyllosphere | MIEKIGNVHLIKFYDGEGRKYPEVPRVKYMVLPKCETKYKKLRLNTNLI* |
Ga0182185_11244731 | 3300015349 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKSYGGEGRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI* |
Ga0182185_11457681 | 3300015349 | Switchgrass Phyllosphere | MIKSYGGECRKYPEVPRIKYLVLPKCGTKYQKVGSNINL |
Ga0182163_10879632 | 3300015350 | Switchgrass Phyllosphere | MVEKKIGVVYLIKSYSGEGKKYLEVLGIKYLVLLKCGIKYQKVELNINLIYFL* |
Ga0182163_11105921 | 3300015350 | Switchgrass Phyllosphere | MIEKIEAVHRIKSNGGEDRKYLEVPRIKYLVLPKYETKYQNVGPNANLIYFL* |
Ga0182163_11800101 | 3300015350 | Switchgrass Phyllosphere | MRNFTMIEKIGAVHLIKFYGGESRKYPEVPRVKYLVLPKYWTKYQK* |
Ga0182169_10903281 | 3300015352 | Switchgrass Phyllosphere | MIEKIGAVYLIKSYGGEDSKYLEVSGIKYFYLVLPKCGIKYQNVGSNINLI* |
Ga0182169_10919672 | 3300015352 | Switchgrass Phyllosphere | MIEKIGAVHMIKSYDSEDSKYLEVSRIKYLVLPKCGIKYQKWDRIII* |
Ga0182169_10934161 | 3300015352 | Switchgrass Phyllosphere | MEKFTMIEKIGAVHLIKSYGDEGRKYLEVSKIKYLVLPKCRTKYQKMGLNTNLI* |
Ga0182169_11224593 | 3300015352 | Switchgrass Phyllosphere | VQLIKSYGGEGRKYLKVPRIKYLVLPKCETNYHKIEPNTNLI* |
Ga0182169_11991601 | 3300015352 | Switchgrass Phyllosphere | MRNFTMIEKIGTVHLIKSYGSEGRKYHEVRRIKYLVLPKCGTKYQKVG |
Ga0182169_12314911 | 3300015352 | Switchgrass Phyllosphere | LKKIGAVHLIKFYGGEDRKYLEVPSIKYLILPKRGTKYQKV |
Ga0182169_12750801 | 3300015352 | Switchgrass Phyllosphere | LKKIGAVHLIKPHGGEGRKYPEIPRVKYLVFTKYGTKYQKMGLNTNLI* |
Ga0182169_12939901 | 3300015352 | Switchgrass Phyllosphere | EKIGAVHLVKSYGGEGRKYPEVPRIKYLIITKCGTKYEKWWEQVVI* |
Ga0182169_13071661 | 3300015352 | Switchgrass Phyllosphere | MIEKIETIHLIKSKGGENRKYIKYLVLPKCGIKYQKMELNTNLI* |
Ga0182169_13111641 | 3300015352 | Switchgrass Phyllosphere | FFREILQ*LEKIGAVHLIKFYDGENKKYLKVPRIKYMVLPKYGTKYQKVRPTTNLI* |
Ga0182179_10234081 | 3300015353 | Switchgrass Phyllosphere | HLIKSYGGKGRKYPEVPRIKYLIPPKCGTKYQKVGSNTNLI* |
Ga0182179_10268832 | 3300015353 | Switchgrass Phyllosphere | MRKFIMIEKIEVVHMIKSYGGEDRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI* |
Ga0182179_10684952 | 3300015353 | Switchgrass Phyllosphere | MIEKMRAVYLIKSYGGEGRKYLEVPRVKYMILQKCEAKYQNVGPNTNLI* |
Ga0182179_11289772 | 3300015353 | Switchgrass Phyllosphere | MIGTVHLMKFYSGEGRKYPEVPRVKYLILQKCGTKYQKVVLNTNLI* |
Ga0182179_11871741 | 3300015353 | Switchgrass Phyllosphere | LKKIGAAHLIKFYSGEGRKYPEVPRIKYLILPKCGTKYQKVGPN |
Ga0182179_12018072 | 3300015353 | Switchgrass Phyllosphere | MRNFTMIEKIGAVRLIKSYRGEYRKCLEVPRIKYVVLRKCGTKHQKVGSN |
Ga0182179_12356821 | 3300015353 | Switchgrass Phyllosphere | AVHLIKFYGGEGRKYLEVPSIKYLVLPKRGTKYQKVGPNTNLI* |
Ga0182167_10012141 | 3300015354 | Switchgrass Phyllosphere | MIKKIGAVHLIKSYGGECRKYLEIPRIKYLVLPNCGSKYKKMRSNTNLKKLR* |
Ga0182167_10054413 | 3300015354 | Switchgrass Phyllosphere | MIEKMRAVYLIKSYGGEGRKYLEVPRVKYMILQKCEAKYQNIGPNTNLI* |
Ga0182167_10430152 | 3300015354 | Switchgrass Phyllosphere | MIEKIESVHRIKSNGGEDRKYLEVPRIKYLVLPKYETKYQNVGPNANLIYFL* |
Ga0182167_10806961 | 3300015354 | Switchgrass Phyllosphere | MRNFTRIEKIGADHLVKSYGGEGRKYPEVPKVKCLILTKCGTKYEKWWEQVVI* |
Ga0182167_10888332 | 3300015354 | Switchgrass Phyllosphere | VIEKIGAVHLIKLYGGEDRKYPKVPRIKYMILSKYGTKYQKVARKKSR* |
Ga0182167_10961801 | 3300015354 | Switchgrass Phyllosphere | ILKRNFTMIEKIGVVHLIKFYGSECGKYLKVHRIKYLVLPKCGTKYQKVGLNTNFI* |
Ga0182167_11046333 | 3300015354 | Switchgrass Phyllosphere | MIEKIETIHLIKSKGGENRKYIKYLILPKCGIKYQKMEPNTNLI* |
Ga0182167_11834621 | 3300015354 | Switchgrass Phyllosphere | GAVHLIKSYCDECRKYPEVPRVKYPVLPKYGIKYQKSGTNTNLI* |
Ga0182167_12208911 | 3300015354 | Switchgrass Phyllosphere | LKKIGAVHLIKSYGGEGRKYPKVPRVKYVILPKYGTKYQKVGPNTNLIYFL* |
Ga0182167_12700551 | 3300015354 | Switchgrass Phyllosphere | RNFTMIEKIGAVHLIKSYGSEGKKYLEVHRIKYLVLPKYGTKYQKVEPNTNLILFNFYKYFP* |
Ga0182199_11655182 | 3300017412 | Switchgrass Phyllosphere | MRNFTMIEKNRSRPLIKSYDAEDRKYPEVSMIKDLVLPKYGTKYQKVRPILI |
Ga0182195_10787442 | 3300017414 | Switchgrass Phyllosphere | MIEKIGVVHLIKSYGSGGRKYPEVPRIKYLVLPKCGTKYQKLGPKY |
Ga0182213_10618111 | 3300017421 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKSYGGEGRKYPEIPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0182201_10089421 | 3300017422 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKAYGGEGSKYPEVPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0182200_10443462 | 3300017439 | Switchgrass Phyllosphere | MIEKIGAVHLIKSYGDEGRKYLEVSKIKYLVLPKCRTKYQKMGPNTNLI |
Ga0182214_10801242 | 3300017440 | Switchgrass Phyllosphere | MKKIGAVHLIKFYGGDGRKYLEVSRIKYLVLPKCGTKYQKVELNTILI |
Ga0182215_10947561 | 3300017447 | Switchgrass Phyllosphere | MRKFTMIEKIDVVHLIKSYGGEGRKYPEVPRVKYLILTKCGTKYQKMGLNTNLI |
Ga0182216_11178242 | 3300017693 | Switchgrass Phyllosphere | LIKSYGAESRKYLEIPRIKYLVFPKYGTKYQKVELNTNLIYFL |
Ga0182216_11667781 | 3300017693 | Switchgrass Phyllosphere | KRNFIMTEKIGAVYLIKSYGAESRKYLEIPRIKYLVLPKYGTKYQK |
Ga0182216_11715641 | 3300017693 | Switchgrass Phyllosphere | LKKIGAVYLIKFYGGQDRKYPEVPMVKYLVFPKCGTKYQK |
Ga0182216_11898801 | 3300017693 | Switchgrass Phyllosphere | SVLISLVVLSHHVIQNYKRNFTMIEKKGAIHLIKFCCDEGRKYLKVAKIKYLVLPKYRTKYQKVGPNTNLI |
Ga0182118_1006701 | 3300020223 | Switchgrass Phyllosphere | MRKFTMIEKIEVVHLIKSYGGEGRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0268328_10366482 | 3300028050 | Phyllosphere | MIKKIGAVNLIKSYGGESRKYPEVPRIKYLVLPKYGTKYQKIGPNTNLI |
Ga0268346_10375441 | 3300028053 | Phyllosphere | MRNFIMIEKIXAIYLIKSYDGEDRKYSEVPMVKYMILPKYGTKYQKMRPNTNLI |
Ga0268338_10045132 | 3300028055 | Phyllosphere | NKKKIDTWVNITRKFTMIEKIEVVHPIKSYGGEGRKYPEIPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0268338_10149871 | 3300028055 | Phyllosphere | MIEKIGAVHLIKLYGGEGRKYPEVPRVKYLILSKYGTKYQKVARKKSR |
Ga0268330_10351551 | 3300028056 | Phyllosphere | MRNFIIIEKIXAIYLIKSYDGEDRKYSEVPMVKYMILPKYGTKYQKMRPNTNLI |
Ga0268330_10516951 | 3300028056 | Phyllosphere | NFTMIEKIGTVHLIKSYGGEGKKYLEVHRIKYLVLLKYGTKYQKVEPNTNLILFNFYKYF |
Ga0268330_10594561 | 3300028056 | Phyllosphere | KVGAVHLIKSYGGKGRKYPEVPRIKYLIPPKCGTKYQKVGSNTNLI |
Ga0268347_10090003 | 3300028142 | Phyllosphere | LKKIGAVHLIKSYGGEGRKYPKVPRVKYVILPKYGTKYQKVGPN |
Ga0268347_10256702 | 3300028142 | Phyllosphere | NFTMIEKIGAVHLIKSYGDEVRKYPEVPRIKYLILPKCRTKYQKV |
Ga0268341_10273751 | 3300028154 | Phyllosphere | VPXRQEKSVSINKIGAVHLIKSYSGEGKKYLQISRIKYLILSKCGTKYQKVRSKTNLI |
Ga0268312_10342911 | 3300028248 | Phyllosphere | MIEKTGAVHLIKSYGGEGRKYLEVVRIKYLVLPKCATKYQKMELNNNLI |
Ga0268315_10180991 | 3300028472 | Phyllosphere | LKKIGAVHIIKFYGGESMKYPEVPRGKVPSTPKYGIKYQKVGSNTNLI |
Ga0268319_10117732 | 3300028473 | Phyllosphere | IGAAHLIESYGGEGRKYLEIPRIKYLVFPKYGTKYQKVELNTNLIYFL |
Ga0268327_10179971 | 3300028475 | Phyllosphere | MIEKIEVVHLIKSYGGEGRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0268309_10074311 | 3300028477 | Phyllosphere | HLIKSYGGKGRKYPEVPRIKYLIPPKYGTKYQKVGSNTNLI |
Ga0214488_10401631 | 3300032467 | Switchgrass Phyllosphere | MRKFIMIEKIEVVHMIKSYGGEDRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0214488_11209741 | 3300032467 | Switchgrass Phyllosphere | MIKSYDGEGRKYPEVPRVKYMVLSKCGTKYQKVVLNTNLIYFL |
Ga0214482_10060891 | 3300032468 | Switchgrass Phyllosphere | MIEKIGTVHLIKSYGGEDRKYPEVSKIKYLVLPKCGIKYQKM |
Ga0214491_10029872 | 3300032469 | Switchgrass Phyllosphere | MIEKIGTVHLIKSYGGEDRKYPEVSKIKYLVLPKCGIKYQKMGSNNNLI |
Ga0214491_11086152 | 3300032469 | Switchgrass Phyllosphere | MIEKIEVVHLIKSYGGEDRKYPEVPRVKYLILTKCGTKYQKMGLDTNLI |
Ga0214502_11061941 | 3300032514 | Switchgrass Phyllosphere | MIEKIGIVHMIKSYGGEGRKYPEVHKIKYLVLPKYGIKYQKIGSNNNLI |
Ga0321339_10031261 | 3300032551 | Switchgrass Phyllosphere | MMEKIGAVHLIKFYGGEGRKYPEVHRIKYLVLTKYGIKYQNSGINANLI |
Ga0314725_10271351 | 3300032789 | Switchgrass Phyllosphere | MQGNKAIQQYMRNFTMIEKIGTVHLIKSYGSEGRKYPEVRRIKYLVLPKCGTKYQKVGLNTNLI |
Ga0314725_10276851 | 3300032789 | Switchgrass Phyllosphere | KTLSSFTMIEKIGAVHLIESYGGEGRKYLGVPRIKYMVLKCGIKYQKVGSNTNLI |
Ga0314748_10063581 | 3300032791 | Switchgrass Phyllosphere | LYILRNFTMVEKIEAVHLIKSYGGEARKYLEVSRIKYLVLPKCGTEY |
Ga0314723_10632491 | 3300032823 | Switchgrass Phyllosphere | TMIEKIGAVHLIESYGGEGRKYLGVPRIKYMVLKCGIKYQKVGSNTNLI |
Ga0314716_1279042 | 3300032970 | Switchgrass Phyllosphere | MIEKIGAIHMIKSYGGECRKYPEVPRIKYLVLPKCGTKYQKVGSNINLI |
Ga0314760_11663031 | 3300033530 | Switchgrass Phyllosphere | MQGNKAIQQYMRNFTMIEKIGTVHLIKSYGSEGRKYHEVRRIKYLVLPKCGTK |
⦗Top⦘ |