NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057633

Metagenome / Metatranscriptome Family F057633

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057633
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 45 residues
Representative Sequence MKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG
Number of Associated Samples 110
Number of Associated Scaffolds 133

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 78.95 %
% of genes near scaffold ends (potentially truncated) 55.88 %
% of genes from short scaffolds (< 2000 bps) 85.29 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.059 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(22.794 % of family members)
Environment Ontology (ENVO) Unclassified
(29.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.324 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 54.79%    β-sheet: 0.00%    Coil/Unstructured: 45.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 133 Family Scaffolds
PF00685Sulfotransfer_1 19.55
PF02082Rrf2 13.53
PF07396Porin_O_P 2.26
PF10055DUF2292 1.50
PF13469Sulfotransfer_3 1.50
PF00381PTS-HPr 0.75
PF13379NMT1_2 0.75
PF02321OEP 0.75
PF00528BPD_transp_1 0.75

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 133 Family Scaffolds
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 13.53
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 13.53
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 13.53
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 13.53
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 13.53
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 13.53
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 13.53
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 13.53
COG3746Phosphate-selective porinInorganic ion transport and metabolism [P] 2.26
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.50
COG1925HPr or related phosphotransfer proteinSignal transduction mechanisms [T] 0.75


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.06 %
UnclassifiedrootN/A2.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_17428475All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3409Open in IMG/M
2170459008|GA8OVOZ01C3TCCAll Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium550Open in IMG/M
3300004114|Ga0062593_101720687All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium686Open in IMG/M
3300004463|Ga0063356_102504278All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium791Open in IMG/M
3300004463|Ga0063356_102504278All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium791Open in IMG/M
3300005167|Ga0066672_10050477All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2381Open in IMG/M
3300005171|Ga0066677_10354977All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium840Open in IMG/M
3300005175|Ga0066673_10024782All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2816Open in IMG/M
3300005175|Ga0066673_10080790All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1709Open in IMG/M
3300005175|Ga0066673_10530944All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium691Open in IMG/M
3300005176|Ga0066679_10415414All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium881Open in IMG/M
3300005177|Ga0066690_10265574All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1154Open in IMG/M
3300005179|Ga0066684_10319323All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1034Open in IMG/M
3300005179|Ga0066684_10654516All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium706Open in IMG/M
3300005179|Ga0066684_10827885All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium610Open in IMG/M
3300005347|Ga0070668_100104851All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2244Open in IMG/M
3300005356|Ga0070674_101045938All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium718Open in IMG/M
3300005364|Ga0070673_101982947All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium552Open in IMG/M
3300005367|Ga0070667_100419603All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1220Open in IMG/M
3300005367|Ga0070667_100605710All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1009Open in IMG/M
3300005434|Ga0070709_10140528All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300005434|Ga0070709_11209192All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium607Open in IMG/M
3300005434|Ga0070709_11286866All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium589Open in IMG/M
3300005435|Ga0070714_100675471All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium995Open in IMG/M
3300005436|Ga0070713_100920292All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium841Open in IMG/M
3300005437|Ga0070710_10404627All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium916Open in IMG/M
3300005437|Ga0070710_11333107All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium535Open in IMG/M
3300005439|Ga0070711_100045372All Organisms → cellular organisms → Bacteria → Proteobacteria2989Open in IMG/M
3300005444|Ga0070694_101672569All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium541Open in IMG/M
3300005540|Ga0066697_10065236All Organisms → cellular organisms → Bacteria2083Open in IMG/M
3300005543|Ga0070672_101742848All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium560Open in IMG/M
3300005561|Ga0066699_11087186All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium551Open in IMG/M
3300005575|Ga0066702_10384876All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium854Open in IMG/M
3300005575|Ga0066702_10479227All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium760Open in IMG/M
3300005587|Ga0066654_10149798All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1183Open in IMG/M
3300005598|Ga0066706_11110416All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium604Open in IMG/M
3300006028|Ga0070717_10990240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium765Open in IMG/M
3300006028|Ga0070717_10990240All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium765Open in IMG/M
3300006028|Ga0070717_11575909All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium595Open in IMG/M
3300006032|Ga0066696_10161933All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1403Open in IMG/M
3300006172|Ga0075018_10741814All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium534Open in IMG/M
3300006173|Ga0070716_100271348All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1166Open in IMG/M
3300006173|Ga0070716_100457168All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia932Open in IMG/M
3300006175|Ga0070712_100358421All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1195Open in IMG/M
3300006358|Ga0068871_100352030All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1303Open in IMG/M
3300006794|Ga0066658_10444440All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium706Open in IMG/M
3300006796|Ga0066665_10813377All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium735Open in IMG/M
3300006796|Ga0066665_11122835All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium599Open in IMG/M
3300006797|Ga0066659_10166242All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1583Open in IMG/M
3300006800|Ga0066660_10349588All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1200Open in IMG/M
3300006800|Ga0066660_10728882All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium811Open in IMG/M
3300006871|Ga0075434_101943139Not Available594Open in IMG/M
3300009137|Ga0066709_101292742All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1070Open in IMG/M
3300009792|Ga0126374_10633665All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium794Open in IMG/M
3300010326|Ga0134065_10150335All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium812Open in IMG/M
3300010366|Ga0126379_11388117All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium808Open in IMG/M
3300010366|Ga0126379_12102738All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium666Open in IMG/M
3300012198|Ga0137364_11399737All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium518Open in IMG/M
3300012199|Ga0137383_10880714All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium654Open in IMG/M
3300012201|Ga0137365_10043890All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3404Open in IMG/M
3300012205|Ga0137362_10118244All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2246Open in IMG/M
3300012207|Ga0137381_10215607All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1665Open in IMG/M
3300012209|Ga0137379_10485461All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1144Open in IMG/M
3300012349|Ga0137387_10851527All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium660Open in IMG/M
3300012361|Ga0137360_10433420All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1112Open in IMG/M
3300012362|Ga0137361_10031982All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4179Open in IMG/M
3300012362|Ga0137361_10411914All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1242Open in IMG/M
3300012885|Ga0157287_1106752All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium527Open in IMG/M
3300012922|Ga0137394_10324780All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1314Open in IMG/M
3300012929|Ga0137404_11026249All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium755Open in IMG/M
3300012985|Ga0164308_12215162All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium512Open in IMG/M
3300012989|Ga0164305_10421448All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1028Open in IMG/M
3300013308|Ga0157375_11958710All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium696Open in IMG/M
3300013308|Ga0157375_12141010All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium666Open in IMG/M
3300015373|Ga0132257_101878901All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium770Open in IMG/M
3300015374|Ga0132255_106106358All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium510Open in IMG/M
3300017959|Ga0187779_10845957All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium627Open in IMG/M
3300018431|Ga0066655_10813084All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium636Open in IMG/M
3300018433|Ga0066667_10098319All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1940Open in IMG/M
3300018468|Ga0066662_10627909All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1011Open in IMG/M
3300018482|Ga0066669_11518464All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium609Open in IMG/M
3300019356|Ga0173481_10007771All Organisms → cellular organisms → Bacteria2945Open in IMG/M
3300019362|Ga0173479_10230027All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium802Open in IMG/M
3300019866|Ga0193756_1034006All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium719Open in IMG/M
3300019872|Ga0193754_1035754All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium525Open in IMG/M
3300019874|Ga0193744_1052204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium783Open in IMG/M
3300019874|Ga0193744_1052204All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium783Open in IMG/M
3300019877|Ga0193722_1132992All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium560Open in IMG/M
3300019878|Ga0193715_1001870All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia4725Open in IMG/M
3300019881|Ga0193707_1024751All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1978Open in IMG/M
3300019887|Ga0193729_1065740All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1442Open in IMG/M
3300019887|Ga0193729_1071652All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1366Open in IMG/M
3300019890|Ga0193728_1345313All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium537Open in IMG/M
3300020580|Ga0210403_10385265All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1146Open in IMG/M
3300020581|Ga0210399_11579322All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300020583|Ga0210401_10562495All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1002Open in IMG/M
3300021168|Ga0210406_10977437All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium631Open in IMG/M
3300021178|Ga0210408_10144021All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1886Open in IMG/M
3300021406|Ga0210386_10739859All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium847Open in IMG/M
3300021413|Ga0193750_1005584All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium3289Open in IMG/M
3300021418|Ga0193695_1058650All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium836Open in IMG/M
3300021432|Ga0210384_10069487All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3173Open in IMG/M
3300021478|Ga0210402_11474592All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium608Open in IMG/M
3300022756|Ga0222622_11216134All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium555Open in IMG/M
3300023058|Ga0193714_1067112All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300025898|Ga0207692_10296110All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium983Open in IMG/M
3300025906|Ga0207699_11326637All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium532Open in IMG/M
3300025915|Ga0207693_10676431All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium801Open in IMG/M
3300025928|Ga0207700_10783255All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium853Open in IMG/M
3300025937|Ga0207669_10914818All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium733Open in IMG/M
3300025939|Ga0207665_10302980All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1195Open in IMG/M
3300025939|Ga0207665_11396038All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium558Open in IMG/M
3300025960|Ga0207651_11362895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium638Open in IMG/M
3300025986|Ga0207658_10434729All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1159Open in IMG/M
3300026075|Ga0207708_11919829All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium519Open in IMG/M
3300026308|Ga0209265_1088895All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium856Open in IMG/M
3300026308|Ga0209265_1230581All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium510Open in IMG/M
3300026316|Ga0209155_1050193All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1624Open in IMG/M
3300026322|Ga0209687_1305054All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300026325|Ga0209152_10069039All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1276Open in IMG/M
3300026330|Ga0209473_1138114All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia999Open in IMG/M
3300026530|Ga0209807_1012466All Organisms → cellular organisms → Bacteria4188Open in IMG/M
3300026530|Ga0209807_1163761All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium833Open in IMG/M
3300026540|Ga0209376_1253338All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium750Open in IMG/M
3300026547|Ga0209156_10026203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia3387Open in IMG/M
3300026547|Ga0209156_10390832All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium585Open in IMG/M
3300026550|Ga0209474_10004270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia12363Open in IMG/M
3300028881|Ga0307277_10114938All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1150Open in IMG/M
3300030972|Ga0075400_11525479All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium659Open in IMG/M
3300031446|Ga0170820_10468903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1437Open in IMG/M
3300031754|Ga0307475_10507548All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium968Open in IMG/M
3300032180|Ga0307471_100089705All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2743Open in IMG/M
3300032180|Ga0307471_102450265All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium660Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil22.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere15.44%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.41%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.47%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.47%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.74%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.74%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.74%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.74%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.74%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.74%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2170459008Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect DNA Tissue lysis 0-10cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019866Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021413Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1EnvironmentalOpen in IMG/M
3300021418Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300023058Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026308Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026530Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030972Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB4 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_035218002088090014SoilMKTFLLLAVSSVITAGVLPSLPAKIVLSAFVLMAVVSEAARRISG
F48_103591502170459008Grass SoilMKTFXFLGVSSVVTAAVLPSLPAKIILSAFVLMAVVSEAARRLSG
Ga0062593_10172068713300004114SoilEMKTFLLLAVSSVITAGVLPGLPAKIILSAFVLLAVVSEAARRLSE*
Ga0063356_10250427813300004463Arabidopsis Thaliana RhizosphereMKTFLLLAVGSVITAGALPSLPAKIILSAFVLMAVLTQAARRAPA
Ga0063356_10250427823300004463Arabidopsis Thaliana RhizosphereMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0066672_1005047713300005167SoilMKTFLLLAVSSVVTAGMLPSLPAKIILSAFVLMAVVSEAARRISG*
Ga0066677_1035497723300005171SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLLATLIEAAHRARKN
Ga0066673_1002478223300005175SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLMAVVSEAARRLSG*
Ga0066673_1008079013300005175SoilMMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAVVSEAARRL*
Ga0066673_1053094423300005175SoilMKTFLLLAVASVIIAGVLPSLPAKIILSAFVLLATLIEVARLCPHEPKK*
Ga0066679_1041541423300005176SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAVVSEAARRL*
Ga0066690_1026557423300005177SoilMKTFLLLAVGSVATAGALPSLPAKIILSAFVLTAVVSEAARRLSG*
Ga0066684_1031932333300005179SoilMKTFLLLAVASVIIAGVLPSLPAKIILSAFVLLATLIEFARLRPQEPKK*
Ga0066684_1065451623300005179SoilMKTFLLLAVGSVVAAGALPSLPAKIILSAFVLTAVLTQAARRAPAGYQD
Ga0066684_1082788523300005179SoilMMKTFLLLAVSSVVTAGMLPSLPAKIILCALVLMAVVSEAARRL*
Ga0070668_10010485113300005347Switchgrass RhizosphereMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAALAQAARRAPVGY
Ga0070674_10104593813300005356Miscanthus RhizosphereMMKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0070673_10198294713300005364Switchgrass RhizosphereMKTILLLALSSTVIAGVLPSLPAKIILSAFVLLAALTHAA
Ga0070667_10041960313300005367Switchgrass RhizosphereMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAALTQAARRAPVGY
Ga0070667_10060571013300005367Switchgrass RhizosphereKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0070709_1014052853300005434Corn, Switchgrass And Miscanthus RhizosphereLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0070709_1120919223300005434Corn, Switchgrass And Miscanthus RhizosphereMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG*
Ga0070709_1128686613300005434Corn, Switchgrass And Miscanthus RhizosphereMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRFSG*
Ga0070714_10067547113300005435Agricultural SoilTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG*
Ga0070713_10092029213300005436Corn, Switchgrass And Miscanthus RhizosphereLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG*
Ga0070710_1040462723300005437Corn, Switchgrass And Miscanthus RhizosphereMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEGARRLSG*
Ga0070710_1133310713300005437Corn, Switchgrass And Miscanthus RhizosphereMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAVLAQAAR
Ga0070711_10004537213300005439Corn, Switchgrass And Miscanthus RhizosphereMMKTFLFLGVSSVVTAAVLPSLPAKIILSAFILTVVLSEAVREAPPAIRMRVGFAAG
Ga0070694_10167256923300005444Corn, Switchgrass And Miscanthus RhizosphereMMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0066697_1006523623300005540SoilMMKTFLLLAVSSVIIAGVLPSLPAKIILSAFALLATLIEVARQRPPERKK*
Ga0070672_10174284823300005543Miscanthus RhizosphereMKMFLLLAVSAVIAAGMLPSLPAKIILIAFVLLAALIEGTRRVG
Ga0066699_1108718623300005561SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAAVSEAARRL*
Ga0066702_1038487623300005575SoilMMKTFLLLAVSSVVTAGMLPSLPAKIILCAFVLMAVVNEAARRL*
Ga0066702_1047922723300005575SoilMKTFLLLAVGSVVTAGALPSLPAKIILSALVLTAAVSEAARRL*
Ga0066654_1014979823300005587SoilMKTFLLLAVGTVITAGVLPSLPAKIILSAFVVLAALTGVARQARKNRKIT*
Ga0066706_1111041623300005598SoilMMKTFLLLAVSSVLTAAVLPSLPAKILLSAFVLLAALIEAAHR
Ga0070717_1099024013300006028Corn, Switchgrass And Miscanthus RhizosphereAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0070717_1099024033300006028Corn, Switchgrass And Miscanthus RhizosphereMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAVLAQAARRAPV
Ga0070717_1157590913300006028Corn, Switchgrass And Miscanthus RhizosphereMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAVLAQAARRAPVG
Ga0066696_1016193313300006032SoilLARINAIRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0075018_1074181413300006172WatershedsMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIVVLT
Ga0070716_10027134823300006173Corn, Switchgrass And Miscanthus RhizosphereMFLLLAVSSVVTAGVLPSLPAKIILSAFILMAVVSEAASRLSG*
Ga0070716_10045716813300006173Corn, Switchgrass And Miscanthus RhizosphereMKMFLLLAVSTVITAGVLPSLPAKIILIAFVLLAALIEGGRH
Ga0070712_10035842113300006175Corn, Switchgrass And Miscanthus RhizosphereNAIRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRFSG*
Ga0068871_10035203033300006358Miscanthus RhizosphereMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAVLAQAARRAP
Ga0066658_1044444013300006794SoilMKTFLLLAVGTVITAGVLPSLPAKIILSAFVVLAALTGLARQA
Ga0066665_1081337713300006796SoilMKTFLLLAVSSVVTAGALPSLPAKIILSAFVLLVALTEAARRLSG*
Ga0066665_1112283513300006796SoilMKTFLLLAVSSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0066659_1016624223300006797SoilMMKTFLLLAVSSVVTAGMLPSLPAKIILCAFVLMAVVSEAARRL*
Ga0066660_1034958823300006800SoilMMKTFLLLAVGSVATAGALPSLPAKIILSAFVLTAVVSEAARRLSG*
Ga0066660_1072888223300006800SoilMMKMFLLLAVGSVVTAGVLPSLPAKIILSAFVLLAVLMEATRRLRKN
Ga0075434_10194313913300006871Populus RhizosphereMKTSLLLAISSVVTAGVLPSLPAKIILSAFVLLAALTQA
Ga0066709_10129274233300009137Grasslands SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLMAVVSEAARRLS
Ga0126374_1063366513300009792Tropical Forest SoilMKTFLFLAIGSVITAGLLPSLPAKIILGTFVFLAVLNEAARRFR
Ga0134065_1015033533300010326Grasslands SoilQAGGEMKTFLLLAVGSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0126379_1138811713300010366Tropical Forest SoilMKKFLLLAVGSVVAAALLPSLPAKIILSAFVLLAVLNEAARRVRKNRTE*
Ga0126379_1210273823300010366Tropical Forest SoilMQKSGGKVMKTYLILLVSSVLTAGVLPSLPAKIILSAFVLMAALTHAARRAPL
Ga0137364_1139973723300012198Vadose Zone SoilVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG*
Ga0137383_1088071423300012199Vadose Zone SoilMKTFLLLAVGSVVTAGALPSLPAKIILIAFVLLVALTEAARRLSG*
Ga0137365_1004389043300012201Vadose Zone SoilMKTYLLLAVSSVVTAGVLPSLPAKIILSAFVLMAVLSEAARRLSG*
Ga0137362_1011824433300012205Vadose Zone SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAAVSEAARRLSG*
Ga0137381_1021560713300012207Vadose Zone SoilMKTFLLLAVGSVVTAGALPSLPAKMILSAFVLLVALTEAARRLSG*
Ga0137379_1048546123300012209Vadose Zone SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLLVALTEAARRLSG*
Ga0137377_1192329313300012211Vadose Zone SoilMTGEAVTQSGGEMKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0137387_1085152723300012349Vadose Zone SoilMKTLLLLAVSSVATAGALPSLPAKIILSTFVLLAVLAEAARRAP
Ga0137360_1043342023300012361Vadose Zone SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAVVSEAARRLSG*
Ga0137360_1134537523300012361Vadose Zone SoilMTGEAITQSGGEMKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0137361_1003198263300012362Vadose Zone SoilMKTFLLLAVSSVITAGVLPGLPAKIILSAFVLLAVVSEAARRLSG*
Ga0137361_1041191423300012362Vadose Zone SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSE*
Ga0157287_110675213300012885SoilMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAAMTQAARRAPVG
Ga0137394_1032478023300012922Vadose Zone SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAVRRLSG*
Ga0137404_1102624923300012929Vadose Zone SoilMMKTFLLLGVSSVVIAAVLPSLPAKFILSAFVLMAVVSEAARRLSG*
Ga0134110_1016186023300012975Grasslands SoilMMKTFLLLAVSSVIIAGVLPSLPAKIILSAFALLATLIEVARQRPPESKK*
Ga0164308_1221516213300012985SoilMKMFLLLAVGSVVTAGVLPSLPAKIILSAFVFLAALIEGIRRASKLRKNNS
Ga0164305_1042144813300012989SoilMKTILLLALSSTVIAGVLPSLPAKIILSAFVLLAALTHAAG
Ga0157375_1195871023300013308Miscanthus RhizosphereLARINAIRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG*
Ga0157375_1214101033300013308Miscanthus RhizosphereLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG*
Ga0132257_10187890113300015373Arabidopsis RhizosphereMKTFLLLAVSSVVTAGVLPPLPAKIILSAFVLIAALAQ
Ga0132255_10610635823300015374Arabidopsis RhizosphereMKMFLLLAVSTVIAAGMLPSLPAKIILIAFVILAALIEGGRRVGK
Ga0187779_1084595713300017959Tropical PeatlandMKTFLALLVSSVVTAGVLPSLPAKIILSAFVLMAALIQAARRAPVGYE
Ga0066655_1081308413300018431Grasslands SoilMKTFLLLAVGTVITAGVLPSLPAKIILSAFVVLTALTA
Ga0066667_1009831933300018433Grasslands SoilMMKTFLLLAVSSVIIAGVLPSLPAKIILSAFALLATLIEVARQHPPESKK
Ga0066662_1062790913300018468Grasslands SoilTFLLLAVSSVITAGVLPSLPAKIVLSAFVLLAVVSEAARRLSG
Ga0066669_1151846413300018482Grasslands SoilGRINASRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0173481_1000777133300019356SoilMKTFLLLAVSSVITAGVLPGLPAKIILSAFVLLAVVSEAARRLSG
Ga0173479_1023002723300019362SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSE
Ga0193756_103400633300019866SoilNAIRKVMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0193754_103575423300019872SoilRINAIRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG
Ga0193744_105220413300019874SoilMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAVL
Ga0193744_105220433300019874SoilRINAIRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0193722_113299213300019877SoilPVTQSGGNMMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG
Ga0193715_100187053300019878SoilMMKTFLLLAVSSVVTAGVLPSLPAKIILSAFVLMAVVSEAARRL
Ga0193707_102475133300019881SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAAR
Ga0193729_106574023300019887SoilMKIFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAGRRLSG
Ga0193729_107165233300019887SoilMMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0193728_134531323300019890SoilMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAVLTQA
Ga0210403_1038526523300020580SoilMKTFLLLAVGSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0210399_1157932213300020581SoilMKTFLLLSVSGVATAGALPSLPAKIILSAFVLLGALTQA
Ga0210401_1056249523300020583SoilMKTFLLLAVSSVITAGALPSLPAKIILSAFVLLAVVNEAARRLSG
Ga0210406_1097743713300021168SoilLKTFLLLAMSSVITAGVLPSLPAKIILSAFVLLAVVS
Ga0210408_1014402123300021178SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVMNEAARRLSG
Ga0210386_1073985923300021406SoilMKTFLLLAVSSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0193750_100558433300021413SoilMMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0193695_105865013300021418SoilMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAALTQAAR
Ga0210384_1006948723300021432SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVINEAARRLSG
Ga0210402_1147459213300021478SoilMMKTFLLLAVSSVVIAGVLPALPAKIILSAFVLIAALAQAAR
Ga0222622_1121613423300022756Groundwater SedimentMKTFLLLAVGTVITAGVLPSLPAKIILSAFVVLAALTGVV
Ga0193714_106711223300023058SoilMKTFLLLAVGTVITAGVLPSLPAKIILSAFVVLAALTGVVRQVRK
Ga0207692_1029611013300025898Corn, Switchgrass And Miscanthus RhizosphereLTQSGGKMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRFSG
Ga0207699_1132663713300025906Corn, Switchgrass And Miscanthus RhizosphereMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAALTQAARRAPVG
Ga0207693_1067643133300025915Corn, Switchgrass And Miscanthus RhizosphereMMKTFLLLAVSSVVTAGVLPALPAKIILSAFVLIAALAQAARRAPVGY
Ga0207700_1078325523300025928Corn, Switchgrass And Miscanthus RhizosphereMFLLLAVSSVVTAGVLPSLPAKIILSAFILMAIVSEAA
Ga0207669_1091481833300025937Miscanthus RhizosphereMMKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARR
Ga0207665_1030298013300025939Corn, Switchgrass And Miscanthus RhizosphereMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSE
Ga0207665_1139603823300025939Corn, Switchgrass And Miscanthus RhizosphereANRREMKMFLLLAVSSVVTAGVLPSLPAKIILSAFILMAVVSEAASRLSG
Ga0207651_1136289533300025960Switchgrass RhizosphereMMKTFLLLAVGSVITAGALPSLPAKIILSAFVLMAV
Ga0207658_1043472933300025986Switchgrass RhizosphereKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARRLSG
Ga0207708_1191982913300026075Corn, Switchgrass And Miscanthus RhizosphereMKTFLLLAVGSVITAGALPSLPAKIILSAFVLLAVVSEAARRLS
Ga0209265_108889533300026308SoilMMKTFLLLAVSSVIIAGVLPSLPAKILLSAFALLATLIEVARQRPPERKK
Ga0209265_123058123300026308SoilSSVITAGVLPSLPAKIILSAYVLMAVVSEAARRLSG
Ga0209155_105019313300026316SoilMMKTFLLLAVSSVIIAGVLPSLPAKIILSAFALLATLIEVARLRPPESKK
Ga0209687_130505413300026322SoilMMKTFLLLAVSSVVTAGALPSLPAKIILSAFVLMAVLTQ
Ga0209152_1006903923300026325SoilMKTFILLAVGTVITAGVLPTLPAKIILSAFVVLAAL
Ga0209473_113811423300026330SoilMKTFLLLAVGSVVAAGALPSLPAKIILSAFVLTAVLTQ
Ga0209807_101246623300026530SoilMKTFLLLAVASVIIAGVLPSLPAKIILSAFVLLATLIEVARLCPHEPKK
Ga0209807_116376113300026530SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAAVSEAARRL
Ga0209376_125333833300026540SoilMKTFLLLAVSSVVTAGALPNLPAKIILSAFVLMAVLTQAA
Ga0209156_1002620363300026547SoilMKTFLLLAVGSVVTAGALPSLPAKIILSAFVLTAVVSEAARRL
Ga0209156_1039083213300026547SoilMKTFLLLAVASVIIAGVLPSLPAKIILSAFVLLATLIEFARLRPQEPKK
Ga0209474_1000427013300026550SoilMKTFLLLAVSSVIIAGVLPSLPAKIILSAFALLATLIEVARQRPPERKK
Ga0307277_1011493833300028881SoilMKAFLLLGVSSVVTAAVLPSLPAKIILSAFVLMTALIEAAHRARKNRKII
Ga0075400_1152547923300030972SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVLSEAVREAPPA
Ga0170820_1046890323300031446Forest SoilMKTFLFLGVSSVVTAAVLPSLPAKIILSAFVLMAVVSEAARRLSG
Ga0307475_1050754813300031754Hardwood Forest SoilMKTFLLLAVSSVITAGVLPSLPAKIILTAFVLLAVVSEAARRLSG
Ga0307471_10008970543300032180Hardwood Forest SoilMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVNEAARRLSG
Ga0307471_10245026513300032180Hardwood Forest SoilSHAIRREMKTFLLLAVSSVITAGVLPSLPAKIILSAFVLLAVVSEAARRLSG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.