NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F057373

Metagenome / Metatranscriptome Family F057373

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F057373
Family Type Metagenome / Metatranscriptome
Number of Sequences 136
Average Sequence Length 113 residues
Representative Sequence MKLKLIVIFLISFVTISSQNMLSYEMGLPEVELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGAIPINPHNMLIGLGLLTISFSFVIS
Number of Associated Samples 103
Number of Associated Scaffolds 136

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 25.00 %
% of genes from short scaffolds (< 2000 bps) 80.88 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.471 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(42.647 % of family members)
Environment Ontology (ENVO) Unclassified
(81.618 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(98.529 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 53.28%    β-sheet: 0.00%    Coil/Unstructured: 46.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 136 Family Scaffolds
PF01832Glucosaminidase 47.06
PF06067DUF932 5.15
PF030614HBT 2.21
PF00034Cytochrom_C 0.74



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.68 %
UnclassifiedrootN/A46.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10060844All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1588Open in IMG/M
3300000116|DelMOSpr2010_c10100194All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1094Open in IMG/M
3300001460|JGI24003J15210_10014866Not Available3062Open in IMG/M
3300001460|JGI24003J15210_10103186All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium811Open in IMG/M
3300001472|JGI24004J15324_10041718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1414Open in IMG/M
3300001472|JGI24004J15324_10145434Not Available553Open in IMG/M
3300001589|JGI24005J15628_10019494All Organisms → cellular organisms → Bacteria2963Open in IMG/M
3300001967|GOS2242_1034443All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1622Open in IMG/M
3300003264|JGI26119J46589_1003712Not Available1992Open in IMG/M
3300005239|Ga0073579_1189360All Organisms → cellular organisms → Bacteria28502Open in IMG/M
3300006484|Ga0070744_10040119All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1379Open in IMG/M
3300006484|Ga0070744_10052350Not Available1195Open in IMG/M
3300006735|Ga0098038_1147155Not Available787Open in IMG/M
3300006735|Ga0098038_1153563Not Available766Open in IMG/M
3300006737|Ga0098037_1025139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2210Open in IMG/M
3300006749|Ga0098042_1037935All Organisms → cellular organisms → Bacteria1342Open in IMG/M
3300006749|Ga0098042_1086034All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium809Open in IMG/M
3300006752|Ga0098048_1004932Not Available5176Open in IMG/M
3300006793|Ga0098055_1170423All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium833Open in IMG/M
3300006802|Ga0070749_10300114All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium901Open in IMG/M
3300006810|Ga0070754_10128138All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1230Open in IMG/M
3300006919|Ga0070746_10090411All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300006922|Ga0098045_1100514Not Available682Open in IMG/M
3300006925|Ga0098050_1124278Not Available655Open in IMG/M
3300007554|Ga0102820_1098424Not Available703Open in IMG/M
3300007555|Ga0102817_1036510All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1079Open in IMG/M
3300007640|Ga0070751_1102597All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1181Open in IMG/M
3300007992|Ga0105748_10555009Not Available505Open in IMG/M
3300008999|Ga0102816_1169056Not Available680Open in IMG/M
3300009003|Ga0102813_1132282Not Available784Open in IMG/M
3300009467|Ga0115565_10330474All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium691Open in IMG/M
3300009550|Ga0115013_10225296Not Available1132Open in IMG/M
3300009550|Ga0115013_11151046Not Available562Open in IMG/M
3300010148|Ga0098043_1094927Not Available874Open in IMG/M
3300010149|Ga0098049_1243004Not Available548Open in IMG/M
3300012920|Ga0160423_10158185All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1588Open in IMG/M
3300012920|Ga0160423_10168274All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1533Open in IMG/M
3300017708|Ga0181369_1001004Not Available8031Open in IMG/M
3300017708|Ga0181369_1011744All Organisms → cellular organisms → Bacteria2227Open in IMG/M
3300017708|Ga0181369_1131575Not Available502Open in IMG/M
3300017709|Ga0181387_1009675Not Available1870Open in IMG/M
3300017710|Ga0181403_1084114Not Available662Open in IMG/M
3300017714|Ga0181412_1027286All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1555Open in IMG/M
3300017717|Ga0181404_1031465All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1361Open in IMG/M
3300017719|Ga0181390_1014381Not Available2702Open in IMG/M
3300017719|Ga0181390_1079749All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium905Open in IMG/M
3300017719|Ga0181390_1108220All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium736Open in IMG/M
3300017719|Ga0181390_1163446Not Available553Open in IMG/M
3300017724|Ga0181388_1012444All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2186Open in IMG/M
3300017724|Ga0181388_1017723All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1794Open in IMG/M
3300017724|Ga0181388_1151135Not Available552Open in IMG/M
3300017726|Ga0181381_1018069All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1618Open in IMG/M
3300017727|Ga0181401_1099460All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium741Open in IMG/M
3300017727|Ga0181401_1170226Not Available523Open in IMG/M
3300017728|Ga0181419_1148317Not Available562Open in IMG/M
3300017730|Ga0181417_1006189All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3204Open in IMG/M
3300017735|Ga0181431_1005540Not Available3138Open in IMG/M
3300017739|Ga0181433_1001428Not Available7869Open in IMG/M
3300017739|Ga0181433_1003408Not Available4829Open in IMG/M
3300017739|Ga0181433_1059351All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium963Open in IMG/M
3300017740|Ga0181418_1017582All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1884Open in IMG/M
3300017740|Ga0181418_1049019All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1053Open in IMG/M
3300017742|Ga0181399_1041895All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1215Open in IMG/M
3300017742|Ga0181399_1136403Not Available594Open in IMG/M
3300017743|Ga0181402_1048206All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1154Open in IMG/M
3300017746|Ga0181389_1027000All Organisms → cellular organisms → Bacteria1767Open in IMG/M
3300017748|Ga0181393_1033143All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1461Open in IMG/M
3300017748|Ga0181393_1108110Not Available712Open in IMG/M
3300017749|Ga0181392_1005128All Organisms → cellular organisms → Bacteria4522Open in IMG/M
3300017750|Ga0181405_1004453All Organisms → cellular organisms → Bacteria4244Open in IMG/M
3300017751|Ga0187219_1027897All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2000Open in IMG/M
3300017751|Ga0187219_1116524Not Available796Open in IMG/M
3300017752|Ga0181400_1043185All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300017752|Ga0181400_1058518All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1180Open in IMG/M
3300017756|Ga0181382_1129921All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium667Open in IMG/M
3300017756|Ga0181382_1201444Not Available503Open in IMG/M
3300017757|Ga0181420_1134274All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium745Open in IMG/M
3300017758|Ga0181409_1039510All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1473Open in IMG/M
3300017758|Ga0181409_1118000Not Available785Open in IMG/M
3300017760|Ga0181408_1013620All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2283Open in IMG/M
3300017762|Ga0181422_1082790All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1011Open in IMG/M
3300017763|Ga0181410_1080666All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium960Open in IMG/M
3300017765|Ga0181413_1058189All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1193Open in IMG/M
3300017767|Ga0181406_1160449Not Available673Open in IMG/M
3300017768|Ga0187220_1050563All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1251Open in IMG/M
3300017769|Ga0187221_1035246All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1666Open in IMG/M
3300017769|Ga0187221_1116165Not Available809Open in IMG/M
3300017770|Ga0187217_1080449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1118Open in IMG/M
3300017771|Ga0181425_1161853Not Available708Open in IMG/M
3300017772|Ga0181430_1048166Not Available1326Open in IMG/M
3300017773|Ga0181386_1062314All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1188Open in IMG/M
3300017779|Ga0181395_1088528All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium996Open in IMG/M
3300017781|Ga0181423_1035868All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2006Open in IMG/M
3300017782|Ga0181380_1020242Not Available2483Open in IMG/M
3300017783|Ga0181379_1048571All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1634Open in IMG/M
3300017786|Ga0181424_10123391All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1116Open in IMG/M
3300017786|Ga0181424_10345830Not Available612Open in IMG/M
3300017786|Ga0181424_10389278Not Available568Open in IMG/M
3300018980|Ga0192961_10256633Not Available512Open in IMG/M
3300020404|Ga0211659_10160888Not Available1017Open in IMG/M
3300020408|Ga0211651_10311057Not Available594Open in IMG/M
3300020442|Ga0211559_10385353Not Available648Open in IMG/M
3300020457|Ga0211643_10183924All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1028Open in IMG/M
3300020471|Ga0211614_10481771Not Available550Open in IMG/M
3300021169|Ga0206687_1000045Not Available519Open in IMG/M
3300021335|Ga0213867_1103826All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1015Open in IMG/M
3300021364|Ga0213859_10044486All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2107Open in IMG/M
3300021368|Ga0213860_10178574All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium936Open in IMG/M
3300021368|Ga0213860_10310204Not Available689Open in IMG/M
3300021378|Ga0213861_10536326Not Available548Open in IMG/M
3300021957|Ga0222717_10568230Not Available600Open in IMG/M
3300021959|Ga0222716_10562689Not Available630Open in IMG/M
(restricted) 3300023109|Ga0233432_10053289All Organisms → Viruses → Predicted Viral2535Open in IMG/M
(restricted) 3300023114|Ga0233405_10112981Not Available505Open in IMG/M
3300024228|Ga0228633_1094769All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium701Open in IMG/M
3300025083|Ga0208791_1036038Not Available914Open in IMG/M
3300025085|Ga0208792_1094606Not Available523Open in IMG/M
3300025101|Ga0208159_1013192All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2158Open in IMG/M
3300025120|Ga0209535_1035126All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2313Open in IMG/M
3300025120|Ga0209535_1068345All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1409Open in IMG/M
3300025127|Ga0209348_1023801All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2261Open in IMG/M
3300025127|Ga0209348_1124977Not Available776Open in IMG/M
3300025137|Ga0209336_10127586Not Available692Open in IMG/M
3300025137|Ga0209336_10129181Not Available686Open in IMG/M
3300025138|Ga0209634_1224688Not Available698Open in IMG/M
3300025671|Ga0208898_1124512All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium738Open in IMG/M
3300025853|Ga0208645_1105866All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1153Open in IMG/M
3300025886|Ga0209632_10046918All Organisms → Viruses → Predicted Viral2793Open in IMG/M
3300026471|Ga0247602_1080688All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium864Open in IMG/M
3300027280|Ga0208972_1089264Not Available547Open in IMG/M
3300027506|Ga0208973_1096779Not Available672Open in IMG/M
3300027631|Ga0208133_1042214All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1117Open in IMG/M
3300027859|Ga0209503_10024567All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2693Open in IMG/M
3300027859|Ga0209503_10358088Not Available716Open in IMG/M
3300028134|Ga0256411_1110654Not Available929Open in IMG/M
3300028197|Ga0257110_1199343Not Available775Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater42.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine24.26%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.88%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.41%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine4.41%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine2.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.94%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.21%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.47%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.47%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.47%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.47%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.47%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.74%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.74%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.74%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001967Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027EnvironmentalOpen in IMG/M
3300003264Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10EnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300006484Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006922Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007992Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2umEnvironmentalOpen in IMG/M
3300008999Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545EnvironmentalOpen in IMG/M
3300009003Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017783Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300020471Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002)EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023114 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_3_MGEnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027280Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_48_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027506Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_66_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028134Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_12 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1006084443300000116MarineMKLKLIVIFLIGFITISSQNMLSREIALDELQKVFPEVELNISKPQNKFVARKQVNNRALVFIGGAALTTIGTTQLIRARNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS*
DelMOSpr2010_1010019423300000116MarineMLSHEIALDELQKIFPKVELNLDKPQNKFVAGKQINERAIIFITGAXLTTYSTVQMIRAKNSXFRFDNPKGAIPIGPHSMLLGVGLLTISISFVF*
JGI24003J15210_1001486663300001460MarineMKLSNKVKEEIRDLAFIMTIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDKPKGAIPINPHNLLIGLGLFTMSFSFVIS*
JGI24003J15210_1010318623300001460MarineMKLSNKLKEEMKDLAFIMTIVLLFLLCFSVVSGQDVASYDIKLPRVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF*
JGI24004J15324_1004171853300001472MarineMKLSNKVKEEIRDLAFIMAILLLFILCFSVVSGQDVASYDIKLPGIELNLDKPQNKFVAGKQVNNRALVFIAGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS*
JGI24004J15324_1014543413300001472MarineMAILLLFILCFSVVSGQDVASYDIKLPGXELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLIGLGLFTMSFSFVIS*
JGI24005J15628_1001949453300001589MarineMKLSNKVKEEIRDLAFIMAILLLFILCFSVVSGQDVASYDIKLPGIELNLDKPQNKFVAGKQVNNRALVFIAGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLIGLGLFTISFSFVIS*
GOS2242_103444333300001967MarineMKLKLIVIFLISFVTISSQNMLSREIALGELQKVFPEVELNVSKPQNKFVARKQANNKALVFMAGATFTTIGTIQLIRARNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS*
JGI26119J46589_100371233300003264MarineMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDMASYDVKLPGIELNLDKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS*
Ga0073579_1189360343300005239MarineMKLKLIVIFLIGFITISSQNMLSREIALDELQKVFPEVELNLNKPYNKFVARKQVNNRALVFITGAALTTISTVQIIRARNSHFRFDHVKGAVPIGPHGILFGVGLFTMSFSFVIS*
Ga0070744_1004011943300006484EstuarineMKLSNKLKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPRVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF*
Ga0070744_1005235013300006484EstuarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELNLDKPQNKFVAKKQINEKAIVFITGTALTTLSTVQMIRAKNSHFRFDNPKGAISIGPYSMLLGVGLLTMSISFVF*
Ga0098038_114715513300006735MarineMKLKLIVIFLISFITVSSQNMLSRETALGELQKVFPEVELNISKPQNKFVARKQANNKALVFIEGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS*
Ga0098038_115356313300006735MarineMKVKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFIARKQANNRALVFIAGATFTTIGTTQLLRARNSSFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS*
Ga0098037_102513923300006737MarineMKVKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFIARKQANNRALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS*
Ga0098042_103793513300006749MarineMKVKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFIARKQANNRALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPI
Ga0098042_108603423300006749MarineMKLKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFIARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS*
Ga0098048_1004932113300006752MarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLIRARNSHFRFDRPKDAVPINPHNLLIGLGLFTMSFSFVIS*
Ga0098055_117042323300006793MarineMRIRLIVIFLISFITISSQNMLNYEVDLPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLIRARNSHFRFDRPKDAVPINPHNLLIGLGLFTMSFSFVIS*
Ga0070749_1030011413300006802AqueousMKLSNKVKEEIRDLTLIMSILILLLLCFSVVSGQSMSSYDIAIGEIQKVFPEVELNISKPQNKFVARKQVNNRALVFITGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNMLIGLGLFTISFSFVIS*
Ga0070754_1012813813300006810AqueousILFLLCFSVVSGQSMSSYDIAIGEIQKVFPEVELNISKPQNKFVARKQVNNRALVFITGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNMLIGLGLFTISFSFVIS*
Ga0070746_1009041123300006919AqueousMKLKLIVIFLISFITISSQNMLSREIALDELQKVFPEVELNLNKPYNKFVARKQVNNRALVFITGAALTTISTVQIIRARNSHFRFDHVKGAVPIGPHGILFGVGLFTMSFSFVIS*
Ga0098045_110051413300006922MarineMKLKLAVIFLISFVTISSQNMLSREIALEELQKISPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLIRARNSHFRFDRP
Ga0098050_112427823300006925MarineMKLKLAVIFLISFVTISSQNMLSREIALEELQKISPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLIRARNSHFRFDRPKDAVPINPHNLLIGLGLFTMSFSFVIS*
Ga0102820_109842413300007554EstuarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFS
Ga0102817_103651023300007555EstuarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF*
Ga0070751_110259723300007640AqueousMKLSNKVKGEIRDLTLIMSILILFLLCFSVVSGQSMSSYDIAIGEIQKVFPEVELNISKPQNKFVARKQVNNRALVFITGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNMLIGLGLFTISFSFVIS*
Ga0105748_1055500913300007992Estuary WaterIMAIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS*
Ga0102816_116905633300008999EstuarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELNLTKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF*
Ga0102813_113228233300009003EstuarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHG
Ga0115565_1033047423300009467Pelagic MarineSFITVSSQNMLSREIALDELQKVFPEVELNLNKPQNKFVARKQVNNRALVFITGAALTTISTVQIVRARNSHFRFDHVKGAVPIGPHSILFGVGLFTMSFSFVIS*
Ga0115013_1022529613300009550MarineMKLKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGTIPINPHNLLIGLGLLTISFSFVIS*
Ga0115013_1115104613300009550MarineMKLKLIVIFLISFVTISSQNMLSYEMGLPEIELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSSFRFDRPKNTIPINPHNMLIGLGLLTISFSFVIS*
Ga0098043_109492743300010148MarineMKLKLIVIFLISFITISSQNMLSYEAKLPEVELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS*
Ga0098049_124300413300010149MarineKLAVIFLISFVTISSQNMLSREIALEELQKISPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLKRARNSHFRFDRPKDAVPINPHNLLIGLGLFTMSFSFVIS*
Ga0160423_1015818523300012920Surface SeawaterMKLKLIIIFLINFVTISSQNMLSYEMGLPEVELNISKPQNKFVARKQVNNKALVFIAGATFTTIGTTQLLRARNSSFRFDRPKGTIPINPHNMLIGLGLFTISFSFVIS*
Ga0160423_1016827443300012920Surface SeawaterMKLSNKIKEEIKELLFLMAIVILFLLCFSMVSGQNMLDYKTELPEIELNLTKPQNKFVARKQVNNKALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNMLIGLGLLTISFSFVIS*
Ga0181369_100100473300017708MarineMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYNIDLPEIELSLEKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0181369_101174433300017708MarineMKIKLIVIFLISFITISSQSMLSYEMGLPEIELNISKPQNKFVARKQVNNKALVFITGAALTTISTVHIVRSRNSHFRFDHVKGAVPIGPHGILFGVGLFTMSFSFVIS
Ga0181369_113157523300017708MarineMKLKLIVIFLISFVTISSQSMLSYEMGLPEIELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSSFRFDRPENTIPINPHNMLIGLGLLTISFSFVIS
Ga0181387_100967553300017709SeawaterTVPIVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181403_108411423300017710SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLFTISFSFVIS
Ga0181412_102728643300017714SeawaterMKLKLIVIFLISFVTISSQNMLSRDIALGELQKIFPEVELNNSKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181404_103146513300017717SeawaterSQSMLSYEMGLPEIELNIPKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0181390_101438163300017719SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEIELNLTKPQNKFVAGKQVNEKAIIFITGAVLTTISTVQMVRARNSHFRFDNPKGAIPIGPHGMLFGIGLFTMSFSFVIS
Ga0181390_107974923300017719SeawaterMKLNNKVKEEIRDLALIMAILILFCLCFSVVSGQNMANYDIDLSKIELNLEKPQNKFVARKQVNEKAIIFMGGAALTTMGTVQLLRARNSHFRFDKPKGAIPINPHNLLIGLGLFTISFSFVIS
Ga0181390_110822013300017719SeawaterIFLISFVTISSQNMLSREIALDELQKVFPEVELNVSKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181390_116344613300017719SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELQKVFPEVELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181388_101244453300017724SeawaterMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181388_101772333300017724SeawaterMKLNNKVKEEIRDLALIMAILILFCLCFNVVSGQNMANYDIDLSKIELNLEKPQNKFVARKQVNEKAIIFMGGAALTTMGTVQLLRARNSHFRFDKPKGAIPINPHNLLIGLGLFTISFSFVIS
Ga0181388_115113523300017724SeawaterMKLKLIVIFLISFVTISSQNMLSRDIALGELQKIFPEVELNVSKPQNKFVAKKQVNEKAIIFITGAALTTISTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181381_101806933300017726SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0181401_109946013300017727SeawaterLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNISKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181401_117022633300017727SeawaterMKLKLIVIFLISFVTINSQNMLSREIALDELQKVFPEVELNVSKPQNKFVAKKQVNEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIP
Ga0181419_114831713300017728SeawaterMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVAGKQVNERAIVFIAGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS
Ga0181417_100618993300017730SeawaterMKLKLIVIFLISFVTISSQKQLSHEIALEELIKVFPEVELNLTKPQNKFVARKQANNKALVFIAGATFTTIGTTQLLRARNSSFRFDRPKNTIPINPHNMLIGLGLLTISFSFVIS
Ga0181431_100554023300017735SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIIFITGAALTTISTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181433_1001428143300017739SeawaterMKLSNKIKEEIRDLSLITAILILFCLCFSVVSAQNMLGYEMGLSEIELNLESASSKPQNKFVARKQANNRALVFIAGATFTTIGTIQLIRTRNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0181433_1003408143300017739SeawaterMRLSNKVKQEIKELLFLMVILILFLLGFSIVSGQNMADYDIDLPEIELNTFKPQNKFVARKQANNKALVFITGATFTTIGTVQLIRSKNSHFRFDNPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181433_105935123300017739SeawaterMKLKLIVIFLISFVTINSQSMLSYEMGLPEIELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLIRARNSHFRFDRPKGAVPINPHNLLIGLGLFTMSFSFVIS
Ga0181418_101758253300017740SeawaterMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVANYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181418_104901923300017740SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181399_104189533300017742SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELQKVFPEVELNVSKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181399_113640313300017742SeawaterMKLKLIVIFLISFVTINSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181402_104820633300017743SeawaterMKLKLIVIFLISFVTINSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGIGLLTMSISFVF
Ga0181389_102700013300017746SeawaterMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181393_103314313300017748SeawaterKTKRLYMKLKLIVIFLISFVTINSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPINPHNLLIGLGLFTISFSFVIS
Ga0181393_110811033300017748SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNNSKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181392_100512883300017749SeawaterMKLKLIVIFLISFVTINSQSMLSYEMGLPEIELNIPKPQNKFVARKQANNRALVFIAGATFTTIGTTQLIRARNSHFRFDRPKGAVPINPHNLLIGLGLFTMSFSFVIS
Ga0181405_1004453103300017750SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0187219_102789753300017751SeawaterMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPRVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0187219_111652423300017751SeawaterMKIKLIVIFLISFITISSQNMLNYKVDLPEVELNLTKPQNKFVAKKQINEKAIIFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181400_104318513300017752SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELQKVFPEVELNVSKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0181400_105851833300017752SeawaterVTISSQNMLSREIALDELQKVFPEVELNVSKPQNKFVTRKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181382_112992113300017756SeawaterMLSRDIALGELQKIFPEVELNVSKPQNKFVARKQANNRALVFIAGTALTTIGTVQMVRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181382_120144413300017756SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNNSKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSSFRFDRPKNTIPINPHNMLIGLGLLTISFSFVIS
Ga0181420_113427423300017757SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQVNEKAIIFITGAVLTTISTVQMVRARNSHFRFDNPKGAIPIGPHGMLFGIGLFTMSFSFVIS
Ga0181409_103951033300017758SeawaterIFLISFITISSQNMLNYKVDLPEVELNLTKPQNKFVAKKQINEKAIIFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181409_111800033300017758SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVKLNLTKPQNKVSTRNSVNERAIVFIAGATLTTISTVQMVRARNSHFRFDNPKGAIPIGPHGMLFGVGLFAMSFSFVIS
Ga0181408_101362013300017760SeawaterKKLYMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNNSKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181422_108279023300017762SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIIFITGAVLTTISTVQMVRARNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181410_108066623300017763SeawaterLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181413_105818933300017765SeawaterSQNMLSSEIALDKLKKAFPEVELNLNKPYNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0181406_116044933300017767SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNMLIGL
Ga0187220_105056323300017768SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTIQLIRTRNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0187221_103524613300017769SeawaterMKLKLIVIFLISFVTISSQNMLSRDIALGELQKIFPEVELNVSKPQNKFVARKQANNRALVFIAGTALTTIGTVQMVRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0187221_111616533300017769SeawaterMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0187217_108044923300017770SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVKLNLTKPQNKVSTRNSVNERAIVFIAGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS
Ga0181425_116185313300017771SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0181430_104816623300017772SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELQKVFPEIELNLSKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181386_106231413300017773SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0181395_108852823300017779SeawaterSFVTINSQSMLSYEMGLPEIELNIPKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLMGLGLFTISFSFVIS
Ga0181423_103586823300017781SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELNIPKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGAVPINPHNLLIGLGLFTISFSFVIS
Ga0181380_102024253300017782SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIIFITGAALTTISTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGIGLLTMSISFVF
Ga0181379_104857113300017783SeawaterMKLKLIVIFLISFVTISSQNMLSREIALDELKKVFPEVELNVSKPQNKFVAKKQVNEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0181424_1012339133300017786SeawaterVKEEIRDLALIMAILILFCLCFSVVSGQNMANYDIDLSKIELNLEKPQNKFVARKQVNEKAIIFMGGAALTTMGTVQLLRARNSHFRFDKPKGAIPINPHNLLIGLGLFTISFSFVIS
Ga0181424_1034583013300017786SeawaterMKLSNKVKEEIRDLALIMAILILFCLCFNVVSGQNMASYDIDLPEIELSLEKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSSFRFDRPKNTIPINPHNMLIGLGLLTISFSFVIS
Ga0181424_1038927823300017786SeawaterIFLISFITISSQNMLNYEVDLPEVKLNLTKPQNKVSTRNSVNERAIVFIAGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFFIS
Ga0192961_1025663313300018980MarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVKLNLTKPQNKVSTRNSVNERVIVFIAGATLTTISTVQIVRARNSNFRFDNPNVAIPIGPHGMLFGVGLFTMSFSFVIS
Ga0211659_1016088813300020404MarineMKLKLIVIFLISFVTISSQNMLSREIALGELQKVFPEVELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLL
Ga0211651_1031105723300020408MarineMKLKLIVIFLISFVTISSQNMLSYEMGLPEVELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGAIPINPHNMLIGLGLLTISFSFVIS
Ga0211559_1038535323300020442MarineMKLSNKIKQEIKELLFLMAILILFLLGFSIVSGQNMADYNIDLPEIELNTSKPQNKFVARKQVNNKALVFITGATFTTIGTVQLIRSKNSHFRFDNPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0211643_1018392413300020457MarineMKLKLIIIFLISFVTISSQNMLSYEMGLPEVELNISKPQNKFVARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS
Ga0211614_1048177113300020471MarineMKLSNKIKQEIKELLFLMVILILFLLGFSIVSGQNMANYDIDLPEIELNTFKPQNKFVARKQVNNKALVFITGATFTTIGTVQLIRSKNSHFRFDNPKGAIPINP
Ga0206687_100004523300021169SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQVNERAIVFIAGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS
Ga0213867_110382633300021335SeawaterMKLKLIVIFLIGFITISSQNMLSREIALDELQKVFPEVELNLNKPYNKFVARKQVNNRALVFITGAALTTISTVQIIRARNSHFRFDHVKGAVPIGPHGILFGVGLFTMSFSFVIS
Ga0213859_1004448613300021364SeawaterMKLSSKVKEEIRDLSLITALLILFCLCFSVVSGQNMSSYDIAIDEIQKVFPEVELNISKPQNKFVARKQVNNKALVFMSGATLTTIGTIQLIRARNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0213860_1017857423300021368SeawaterMKLSSKVKEEIRDLSLITALLILFCLCFSVVSGQSMLGYEMGLPEIELNLESASSKPQNKFVARKQANNRALVFMSGATFTAIGTIQLIRARNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0213860_1031020433300021368SeawaterMKLKLIVIFLISFVTISSQKQLSYEIALEELVKVFPEVELNTSKPQNKFVARKQANNKALVFIAGATFTTIGTTQLLRARNSHFRFDRPKGTIPINPHNLLIGLGLLTISFSFVIS
Ga0213861_1053632613300021378SeawaterMKLKLIVIFLISFITISSQNMLSSEIALDELKKVFPEVELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLIRARNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0222717_1056823023300021957Estuarine WaterMKLKLIVIFLISFVTISSQNMLSREIALDELQKVFPEVELNLSKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS
Ga0222716_1056268923300021959Estuarine WaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS
(restricted) Ga0233432_1005328983300023109SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQTNNRALVFIMGATLTTISTVQTVRARNSHFRFDNPKGAIPIGPHGMLFGVGLFAMSFSFVIS
(restricted) Ga0233405_1011298123300023114SeawaterMKIKLIVIFLISFITISSQNMLNYEVDLPEVELSLTKPQNKFVAGKQANNRALVFIMGATLTTISTVQIVRARNSHFRFDNPKSAIPIGPHGMLFGVGLFAMSFSFVIS
Ga0228633_109476923300024228SeawaterLFCLCFNVVSGQNMASYDIDLSEIELSLEKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTKNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0208791_103603833300025083MarineMKLKLAVIFLISFVTISSQNMLSREIALEELQKISPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLIRARNSHFRFDRPKDAVPINPHNLLIGLGLFTMSFSFVIS
Ga0208792_109460623300025085MarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELNISKPQNKFVARKQANNRALVFITGATFTTIGTTQLIRARNSHFRFDRPKDAVPINPHNLLIGLGLFTMSFSFVIS
Ga0208159_101319223300025101MarineMKVKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFIARKQANNKALVFIAGATFTTIGTVQLLRARNSHFRFDRPKGTIPINPHNMLIGLGLLTISFSFVIS
Ga0209535_103512653300025120MarineMKLSNKVKEEIRDLAFIMTIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLIGLGLFTMSFSFVIS
Ga0209535_106834533300025120MarineMKLSNKLKEEMKDLAFIMTIVLLFLLCFSVVSGQDVASYDIKLPRVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0209348_102380113300025127MarineFLLGFSIVSGQNMADYNIDLPEIELNTFKPQNKFVARKQVNNKALVFITGATFTTIGTVQLIRSKNSHFRFDNPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0209348_112497713300025127MarineMKLKLIVIFLISFVTINSQNMLSYEMGLPEVELNISKPQNKFVARKQANNKALVFIAGATFTTIGTIQLLRARNSSFRFDRPKNTIPINPHNMLIGLGLLTISFSFVIS
Ga0209336_1012758623300025137MarineMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPGVELNLDKPQNKFVARKQVNSRVLVFIAGTSLTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLIGLGLFTMSFSFVIS
Ga0209336_1012918113300025137MarineMKLSNKVKEEIRDLAFIMAILLLFILCFSVVSGQDVASYDIKLPGIELNLDKPQNKFVAGKQVNNRALVFIAGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNLLIGLGLLTISFSFVIS
Ga0209634_122468823300025138MarineMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDVASYDIKLPRVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0208898_112451213300025671AqueousMKLSNKVKEEIRDLTLIMSILILLLLCFSVVSGQSMSSYDIAIGEIQKVFPEVELNISKPQNKFVARKQVNNRALVFITGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNMLIGLGLFTISFSFVIS
Ga0208645_110586613300025853AqueousLLCFSVVSGQSMSSYDIAIGEIQKVFPEVELNISKPQNKFVARKQVNNRALVFITGTALTTIGTVQMIRTRNSHFRFDRPKGAIPINPHNMLIGLGLFTISFSFVIS
Ga0209632_1004691873300025886Pelagic MarineMKIKLIVIFLISFITVSSQNMLNYEVDLPEVELNISKPQNKFVARKQVNNRALVFITGAALTTISTVQIVRARNSHFRFDHVNGAVPIGPHGILFGVGLFTMSFSFVIS
Ga0247602_108068823300026471SeawaterMKLKLIVIFLISFVTINSQSMLSYEMGLPEIELNIPKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTKNSHFRFDRPKGAVPINPHNLLIGLGLFTMSFSFVIS
Ga0208972_108926423300027280MarineMKLSNKVKEEIRDLAFIMAIVLLFLLCFSVVSGQDMASYDVKLPGIELNLDKPQNKFVAGKQANNRALVFIIGATLTTISTVQIVRARNSNFRFDNPNVTIPIGPHGMLFGVGLFAMSFSFVIS
Ga0208973_109677923300027506MarineMKIKLIVIFLISFITISSQNMLNYEVDLPEVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0208133_104221423300027631EstuarineIFLISFITISSQNMLNYEVDLPEVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF
Ga0209503_1002456723300027859MarineMKLKLIVIFLISFVTISSQNMLSYEMGLSEIELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSSFRFDRPKNTIPINPHNLLIGLGLLTISFSFVIS
Ga0209503_1035808823300027859MarineMKLKLIVIFLISFVTISSQNMLSYEMGLSEVELNISKPQNKFVARKQANNRALVFIAGATFTTIGTTQLLRARNSSFRFDRPKNTIPINPHNMLIGLGLLTISFSFVIS
Ga0256411_111065443300028134SeawaterMKLKLIVIFLISFVTINSQSMLSYEMGLPEIELNIPKPQNKFVARKQANNRALVFIAGTTLTTIGTVQMIRTKNSHFRFDRPKGAVPINPHNMLIGLGLFTISFSFVIS
Ga0257110_119934323300028197MarineMKLSNKVKEEIRDLVFIMAIVLLFLLCFSVVSGQDVASYDIKLPRVELNLDKPQNKFVAKKQINEKAIVFITGAALTTLSTVQMIRAKNSHFRFDNPKGAIPIGPHSMLLGVGLLTMSISFVF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.