Basic Information | |
---|---|
Family ID | F057354 |
Family Type | Metagenome |
Number of Sequences | 136 |
Average Sequence Length | 43 residues |
Representative Sequence | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRDDIYQQPNPSY |
Number of Associated Samples | 100 |
Number of Associated Scaffolds | 136 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 88.97 % |
% of genes near scaffold ends (potentially truncated) | 99.26 % |
% of genes from short scaffolds (< 2000 bps) | 90.44 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (96.324 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (29.412 % of family members) |
Environment Ontology (ENVO) | Unclassified (69.853 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.088 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.29% β-sheet: 8.57% Coil/Unstructured: 87.14% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 136 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 1.47 |
PF03354 | TerL_ATPase | 0.74 |
COG ID | Name | Functional Category | % Frequency in 136 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.47 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 0.74 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.06 % |
Unclassified | root | N/A | 2.94 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002408|B570J29032_108950761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300002408|B570J29032_109805141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1396 | Open in IMG/M |
3300002408|B570J29032_109928569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2961 | Open in IMG/M |
3300003429|JGI25914J50564_10057945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1026 | Open in IMG/M |
3300005581|Ga0049081_10055420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1498 | Open in IMG/M |
3300005805|Ga0079957_1035722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3224 | Open in IMG/M |
3300006484|Ga0070744_10223438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300006803|Ga0075467_10632827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300006805|Ga0075464_10332154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300006805|Ga0075464_10666270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300006805|Ga0075464_10728968 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
3300006805|Ga0075464_10851895 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
3300006917|Ga0075472_10671241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300007670|Ga0102862_1055951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
3300007708|Ga0102859_1265354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300008450|Ga0114880_1242205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300009068|Ga0114973_10303235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 851 | Open in IMG/M |
3300009085|Ga0105103_10746343 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300009152|Ga0114980_10379623 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300009152|Ga0114980_10506892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
3300009159|Ga0114978_10403991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300009160|Ga0114981_10173960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
3300009161|Ga0114966_10079284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2247 | Open in IMG/M |
3300009169|Ga0105097_10848360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300009180|Ga0114979_10259700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1039 | Open in IMG/M |
3300009184|Ga0114976_10587380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300010885|Ga0133913_12030855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
3300011010|Ga0139557_1051088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 703 | Open in IMG/M |
3300012017|Ga0153801_1081481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300013004|Ga0164293_11004896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300013005|Ga0164292_10743155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1250824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300013372|Ga0177922_10494240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300014811|Ga0119960_1077010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300017701|Ga0181364_1055525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300017716|Ga0181350_1088267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
3300017716|Ga0181350_1137431 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300017722|Ga0181347_1112603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300017723|Ga0181362_1097034 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300017736|Ga0181365_1012846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2091 | Open in IMG/M |
3300017736|Ga0181365_1027873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1426 | Open in IMG/M |
3300017736|Ga0181365_1032182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1323 | Open in IMG/M |
3300017736|Ga0181365_1035512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1257 | Open in IMG/M |
3300017736|Ga0181365_1075510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
3300017754|Ga0181344_1076300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300017754|Ga0181344_1175099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
3300017761|Ga0181356_1056944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1336 | Open in IMG/M |
3300017761|Ga0181356_1234482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
3300017766|Ga0181343_1183185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300017766|Ga0181343_1214546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300017766|Ga0181343_1227885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300017774|Ga0181358_1118179 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
3300017777|Ga0181357_1100553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1096 | Open in IMG/M |
3300017777|Ga0181357_1143227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300017778|Ga0181349_1089332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1164 | Open in IMG/M |
3300017778|Ga0181349_1116217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300017780|Ga0181346_1121086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1002 | Open in IMG/M |
3300017780|Ga0181346_1127053 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300017780|Ga0181346_1300636 | Not Available | 544 | Open in IMG/M |
3300017784|Ga0181348_1170760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 799 | Open in IMG/M |
3300017784|Ga0181348_1305430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300017785|Ga0181355_1012553 | Not Available | 3722 | Open in IMG/M |
3300017785|Ga0181355_1263521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300017785|Ga0181355_1334815 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 560 | Open in IMG/M |
3300017785|Ga0181355_1394113 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300019784|Ga0181359_1058191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1483 | Open in IMG/M |
3300019784|Ga0181359_1204091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300019784|Ga0181359_1205823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 630 | Open in IMG/M |
3300020159|Ga0211734_11320708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 653 | Open in IMG/M |
3300020160|Ga0211733_10940162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300020161|Ga0211726_10867778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300020506|Ga0208091_1034272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300020536|Ga0207939_1003360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3220 | Open in IMG/M |
3300020541|Ga0208359_1021294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300020550|Ga0208600_1026445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300020553|Ga0208855_1037611 | Not Available | 657 | Open in IMG/M |
3300020565|Ga0208718_1013944 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1643 | Open in IMG/M |
3300021962|Ga0222713_10291265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
3300021962|Ga0222713_10390125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 860 | Open in IMG/M |
3300021963|Ga0222712_10112843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1882 | Open in IMG/M |
3300022179|Ga0181353_1102606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 702 | Open in IMG/M |
3300022179|Ga0181353_1112887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300023184|Ga0214919_10372825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300025896|Ga0208916_10139925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1037 | Open in IMG/M |
3300025896|Ga0208916_10171569 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 935 | Open in IMG/M |
3300025896|Ga0208916_10346250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300025896|Ga0208916_10428942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300027140|Ga0255080_1025439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
3300027142|Ga0255065_1025864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
3300027214|Ga0208306_1048587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 743 | Open in IMG/M |
3300027721|Ga0209492_1067566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1262 | Open in IMG/M |
3300027764|Ga0209134_10163279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300027782|Ga0209500_10117853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1290 | Open in IMG/M |
3300027798|Ga0209353_10027898 | All Organisms → Viruses → Predicted Viral | 2633 | Open in IMG/M |
3300027808|Ga0209354_10069434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1428 | Open in IMG/M |
3300027900|Ga0209253_10741627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300027973|Ga0209298_10129195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300027974|Ga0209299_1177313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 790 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1049267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2286 | Open in IMG/M |
3300028025|Ga0247723_1155282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
(restricted) 3300028581|Ga0247840_10022787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6240 | Open in IMG/M |
3300031758|Ga0315907_10053604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3539 | Open in IMG/M |
3300031784|Ga0315899_11046840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300031787|Ga0315900_10932611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300031857|Ga0315909_10481526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 863 | Open in IMG/M |
3300031951|Ga0315904_10584844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
3300031951|Ga0315904_10900228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
3300032050|Ga0315906_10194230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1917 | Open in IMG/M |
3300032050|Ga0315906_11027525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300032177|Ga0315276_10555996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1234 | Open in IMG/M |
3300033979|Ga0334978_0329459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300033995|Ga0335003_0390487 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300033996|Ga0334979_0235521 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300034012|Ga0334986_0512247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 587 | Open in IMG/M |
3300034061|Ga0334987_0784814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300034062|Ga0334995_0013082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7688 | Open in IMG/M |
3300034073|Ga0310130_0245847 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
3300034092|Ga0335010_0255302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1032 | Open in IMG/M |
3300034092|Ga0335010_0390127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300034095|Ga0335022_0083293 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2061 | Open in IMG/M |
3300034101|Ga0335027_0021903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5412 | Open in IMG/M |
3300034103|Ga0335030_0424212 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300034104|Ga0335031_0181218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1438 | Open in IMG/M |
3300034104|Ga0335031_0585967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
3300034105|Ga0335035_0527823 | Not Available | 640 | Open in IMG/M |
3300034106|Ga0335036_0255637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1184 | Open in IMG/M |
3300034112|Ga0335066_0403804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300034116|Ga0335068_0562564 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
3300034117|Ga0335033_0552535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
3300034118|Ga0335053_0288551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1036 | Open in IMG/M |
3300034118|Ga0335053_0607676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300034122|Ga0335060_0400610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300034122|Ga0335060_0688636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 505 | Open in IMG/M |
3300034166|Ga0335016_0557703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300034200|Ga0335065_0189003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1351 | Open in IMG/M |
3300034283|Ga0335007_0811996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 29.41% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.79% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.82% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 7.35% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 5.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.68% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.94% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.21% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.21% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.21% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.47% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.74% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.74% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.74% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.74% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.74% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.74% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.74% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.74% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.74% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.74% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020541 | Freshwater microbial communities from Lake Mendota, WI - 26AUG2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020565 | Freshwater microbial communities from Lake Mendota, WI - 29APR2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027140 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h | Environmental | Open in IMG/M |
3300027142 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h | Environmental | Open in IMG/M |
3300027214 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028581 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_17m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034095 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Feb2014D0-rr0091 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
B570J29032_1089507612 | 3300002408 | Freshwater | MSVWTPDWKLIVGGVDYTDIAISDIQHQAGRDDIYSQPN |
B570J29032_1098051412 | 3300002408 | Freshwater | MTVFTPDWKLTVGGVDYTDITISDVQHAAGRTDIYQQSL |
B570J29032_1099285695 | 3300002408 | Freshwater | MSQFTPDWKLTVGGVDYTDITISDVQHQAGRSDIYQQALPSYMQVTLVAL |
JGI25914J50564_100579451 | 3300003429 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSY |
Ga0049081_100554201 | 3300005581 | Freshwater Lentic | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQP |
Ga0079957_10357221 | 3300005805 | Lake | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRDDIYTQPNPSYL |
Ga0070744_102234382 | 3300006484 | Estuarine | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRSDIYQQPNPSYIQVSF |
Ga0075467_106328271 | 3300006803 | Aqueous | MTVWTPDWKLTVAGVDYTDLTISDIIHQAGRDDIYSHPSPSHLQCTIVA |
Ga0075464_103321542 | 3300006805 | Aqueous | MTVFTPQYKLTVNGVEYTNVAISDIAHQAGREDIYSQPNPS |
Ga0075464_106662701 | 3300006805 | Aqueous | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRDDIYTQPNPSYLQVQL |
Ga0075464_107289682 | 3300006805 | Aqueous | MTAWSPDWKLTVAGVDYTNIAISDIQHQAGRTDIYQQPN |
Ga0075464_108518951 | 3300006805 | Aqueous | MSVFTPDWKLTVAGVEYTDITISDITHEAGRDDIYEQPNPSYLQ |
Ga0075472_106712413 | 3300006917 | Aqueous | MTVWTPDWKLTVAGTEYTNLTISDITHQAGRDDIYTQPNPS |
Ga0102862_10559511 | 3300007670 | Estuarine | MSVFTPDWKLTVAGVEYTDITISDITHAAGRDDIYEQPNPSYLQ |
Ga0102859_12653542 | 3300007708 | Estuarine | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQPNPSYL |
Ga0114880_12422051 | 3300008450 | Freshwater Lake | MSAFTPDWKLTVGGVDYTDIAISDIQHEAGRTDIYQQPSPSYCSITL |
Ga0114973_103032352 | 3300009068 | Freshwater Lake | MTVFNPSWKLTVAGTDYTNIAISDIAHQAGRTDIYSQ |
Ga0105103_107463432 | 3300009085 | Freshwater Sediment | MSVWTPDWKLTVGGVDYTDIAISDVQHQSGRDDIYSQP |
Ga0114980_103796232 | 3300009152 | Freshwater Lake | MTAWSPEWKLTVAGTNYTNIAISDITHQAGRTDIYTQPSPSYMQVTL |
Ga0114980_105068922 | 3300009152 | Freshwater Lake | MTAWSPEWKLTVAGTNYTNIAISDVQHQAGRTDIYSQPSPSYMQITL |
Ga0114978_104039911 | 3300009159 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIELVA |
Ga0114981_101739601 | 3300009160 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIELVALNNFLL* |
Ga0114966_100792844 | 3300009161 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIAHQAGRSDIYQQPNPSYIQINF |
Ga0105097_108483601 | 3300009169 | Freshwater Sediment | MTAFTPDWKLTVGGVDYTDITISDVQHAAGRTDIYQQPLPSYIQIT |
Ga0114979_102597002 | 3300009180 | Freshwater Lake | MTAFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIELVA |
Ga0114976_105873802 | 3300009184 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIY |
Ga0133913_120308551 | 3300010885 | Freshwater Lake | MTVFTPEWKLTVAGTDYTNIAISDVQHQAGRTDIY |
Ga0139557_10510882 | 3300011010 | Freshwater | MTFWSPDWKLTVAGVDYTDIAISDIQHQAGRSDIYQQPNPSYIQ |
Ga0153801_10814812 | 3300012017 | Freshwater | MTVFTPEWKLTVAGTDYTNIAISDVQHQAGRTDIYSQPS |
Ga0164293_110048961 | 3300013004 | Freshwater | MSAFTPDWKLTVGGVDYTDIAISDVQHQSGRTDIYQQALPSYMQISFV |
Ga0164292_107431551 | 3300013005 | Freshwater | MTVWTPEWKLTVAGTEYTNLTISDIIHQSGRDDIYTQPNPSYL |
(restricted) Ga0172374_12508241 | 3300013122 | Freshwater | MTVFTPDWKLTVGGVDYTDITISDVQHQAGRSDIYQQPL |
Ga0177922_104942401 | 3300013372 | Freshwater | MTVFTPDWKLTVGGVDYTDITIADVQHQAGRTDIYQQPLPSYCQVTF |
Ga0119960_10770102 | 3300014811 | Aquatic | MTVWTPDWKLTVAGTEYTNLTISDITHQAGRDDIYTQPDRDWE |
Ga0181364_10555252 | 3300017701 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHEAGRTDIYQQ |
Ga0181350_10882671 | 3300017716 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQ |
Ga0181350_11374312 | 3300017716 | Freshwater Lake | MTAWSPDWKLTVAGVEYTDIAISDIAHQAGRSDIYQQPNPSYLQV |
Ga0181347_11126032 | 3300017722 | Freshwater Lake | MSAWSPDWKLTVAGVDYTDIAISDVQHQAGRDDIYQQPN |
Ga0181362_10970341 | 3300017723 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQPNPS |
Ga0181365_10128461 | 3300017736 | Freshwater Lake | MTVWTPDWKLTVAGVDYTDIAISDITHESGRDDIYTQPNPSY |
Ga0181365_10278733 | 3300017736 | Freshwater Lake | MTVWTPDWQLSVAGVDYTDIAISNITHQSGRDDIYTQA |
Ga0181365_10321822 | 3300017736 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIELVAL |
Ga0181365_10355121 | 3300017736 | Freshwater Lake | MTVWTPDWKLTVAGVDYTDIAISDITHESGRDDIYTQPNPSYLQI |
Ga0181365_10755102 | 3300017736 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIDLF |
Ga0181344_10763002 | 3300017754 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQPNPSYLQITFVALSN |
Ga0181344_11750992 | 3300017754 | Freshwater Lake | MTVWTPDWKLTVEGVDYTDIAIADIAHQAGRTDIYSQ |
Ga0181356_10569442 | 3300017761 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHEAGRTDIYQQPN |
Ga0181356_12344821 | 3300017761 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRSDIYQQPNPSYIQVSFV |
Ga0181343_11831852 | 3300017766 | Freshwater Lake | MTVFTPEWKLTVAGTDYTNIAISDIQHQAGRTDIY |
Ga0181343_12145461 | 3300017766 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIAHQAGRSDIYQQPNPSYIQV |
Ga0181343_12278851 | 3300017766 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHEAGRTDIYQ |
Ga0181358_11181791 | 3300017774 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIAHQAGRSDIYQQPSPSYIQVIP |
Ga0181357_11005532 | 3300017777 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYIQIELVAL |
Ga0181357_11432271 | 3300017777 | Freshwater Lake | MTVWTPDWKLTVAGVDYTDLTISDIIHQAGRDDIYTQPNPSYL |
Ga0181349_10893321 | 3300017778 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPN |
Ga0181349_11162172 | 3300017778 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIAHQAGRSDIYQQPNPSYIQISFVALSGQ |
Ga0181346_11210862 | 3300017780 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQSGRTDIYQQPN |
Ga0181346_11270531 | 3300017780 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIAHQAGRSDIYQQ |
Ga0181346_13006362 | 3300017780 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISVIQHQAGRTDIYQQ |
Ga0181348_11707602 | 3300017784 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDISHQAGRSDIYQQPNPSYIQ |
Ga0181348_13054302 | 3300017784 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRSDIYQQPNPSYIQVSFLALSGQ |
Ga0181355_10125537 | 3300017785 | Freshwater Lake | MSDFTPDWKLTVGGVDYTNIAISDVQHQAGRSDIYQQPLP |
Ga0181355_12635211 | 3300017785 | Freshwater Lake | MTAWLPDWKLTVAGVDYTDIAISDIAHQAGRSDIYQQPNPSYIQVNFVA |
Ga0181355_13348151 | 3300017785 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQSGRTDIYQQPNPSYLQITFVAPYF |
Ga0181355_13941132 | 3300017785 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDVQHQAGRDDIYQQPN |
Ga0181359_10581911 | 3300019784 | Freshwater Lake | MTVWTPDWKLTVAGTDYTDIAIADITHQSGRSDIYSQPNPSY |
Ga0181359_12040911 | 3300019784 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHEAGRTDIYQQPNPSY |
Ga0181359_12058232 | 3300019784 | Freshwater Lake | MTVWSPDWKLTVAGVDYTDIAISDIQHQSGRTDIYQQP |
Ga0211734_113207081 | 3300020159 | Freshwater | MTVFTPEWKLTVAGTEYTDIAISDVQHQAGRTDIYTQPSPSYMQ |
Ga0211733_109401621 | 3300020160 | Freshwater | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQPNPSYLQITFV |
Ga0211726_108677782 | 3300020161 | Freshwater | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRTDIYQQPNPSYMQINFVAL |
Ga0208091_10342721 | 3300020506 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRTDIYTQA |
Ga0207939_10033601 | 3300020536 | Freshwater | MTVFTPDWKLTVGGVDYTDITISDVQHAAGRTDIYQQSLPSYM |
Ga0208359_10212941 | 3300020541 | Freshwater | MSAFTPDWKLTVGGVDYTNIAISDVQHQSGRTDIYEQALPSYCSIT |
Ga0208600_10264451 | 3300020550 | Freshwater | MTAWSPDWKLTVAGVDYTDIAISDIQHEAGRTDIYQQPNPSYVQIT |
Ga0208855_10376112 | 3300020553 | Freshwater | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQP |
Ga0208718_10139443 | 3300020565 | Freshwater | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRDDIYQQPNPSY |
Ga0222713_102912651 | 3300021962 | Estuarine Water | MTVFTPDWKLTVGGVDYTDIAISDIQHQAGRTDIYQ |
Ga0222713_103901251 | 3300021962 | Estuarine Water | LTVWTPDWKLTVGGVDYTDVAISDIQHQAGRDNIYIQPNPSYVQI |
Ga0222712_101128431 | 3300021963 | Estuarine Water | MTVFTPDWKLTVGGVDYTDITISDVQHQAGRTDIYSQPLPSYIQLTLLALN |
Ga0181353_11026061 | 3300022179 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRSDIYQQPNP |
Ga0181353_11128871 | 3300022179 | Freshwater Lake | MTVFTPEYQLTVNGVEYTNVAISDIAHQAGREDIYSQPNPSYLQ |
Ga0214919_103728252 | 3300023184 | Freshwater | MTVFNPEWKLTVAGTEYTSIAISDIRHKSGRDDIYTQPAPSYLQIS |
Ga0208916_101399251 | 3300025896 | Aqueous | MTVFTPDWKLTINAVEYTNVAISDIAHQAGRQDIYSQPN |
Ga0208916_101715692 | 3300025896 | Aqueous | MTVWTPDWKLTVAGVDYTDLTISDIIHQAGRDDIYSQPSPS |
Ga0208916_103462502 | 3300025896 | Aqueous | MTVWTPDWKLTVAGVDYTDLTISDIIHQAGRDDIYSQPNPSYLQCTIVA |
Ga0208916_104289421 | 3300025896 | Aqueous | MTVFNPSWKLTVAGTDYTNIAISDISHQAGRTDIYS |
Ga0255080_10254392 | 3300027140 | Freshwater | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIE |
Ga0255065_10258641 | 3300027142 | Freshwater | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMQIELVALNN |
Ga0208306_10485871 | 3300027214 | Estuarine | MSVFTPDWKLTVAGVEYTDITISDITHAAGRDDIY |
Ga0209492_10675662 | 3300027721 | Freshwater Sediment | MTVFTPDWKLTVGGVDYTDIAISDIQHQAGRDDIYSQPNPSYIQITLVALNN |
Ga0209134_101632792 | 3300027764 | Freshwater Lake | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRDDIYQQPNP |
Ga0209500_101178531 | 3300027782 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYM |
Ga0209353_100278986 | 3300027798 | Freshwater Lake | MTVWTPDWKLTVAGVDYTDIAISDITHESGRDDIYTQPNPSYLQ |
Ga0209354_100694342 | 3300027808 | Freshwater Lake | MTAWTPDWKLTVAGVDYTDLTISDIIHQAGRDDIYSQPNP |
Ga0209253_107416272 | 3300027900 | Freshwater Lake Sediment | MTVFTPEWKLTVAGTDYTNIAISDIQHQAGRDDLYTQPSP |
Ga0209298_101291951 | 3300027973 | Freshwater Lake | MTVWTPDWKLTVAGVDYTDLTISDIIHQAGRNDIYSQPNPSYLQCTIVAL |
Ga0209299_11773131 | 3300027974 | Freshwater Lake | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYIQ |
(restricted) Ga0247834_10492671 | 3300027977 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDITHESGRDDIYTQPNPSYLQIS |
Ga0247723_11552822 | 3300028025 | Deep Subsurface Sediment | MTVWTPDWKLTVAGVDYENITIADIAHQAGRDDIY |
(restricted) Ga0247840_100227879 | 3300028581 | Freshwater | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRDDIYQQPNPSYLQ |
Ga0315907_100536041 | 3300031758 | Freshwater | MTVFTPDWKLTVGGIDYTDITISDVQHQAGRSDIYQQP |
Ga0315899_110468402 | 3300031784 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRDDIYTQPNPSYLQVEVV |
Ga0315900_109326112 | 3300031787 | Freshwater | MSAFTPDWKLTVGGVDYTDITISDVQHQAGRSDIYQQPLP |
Ga0315909_104815261 | 3300031857 | Freshwater | LTAWAPDWKLTVGGVDYTDIAISDIQHQAGRDNIYIQPNPSYVQI |
Ga0315904_105848442 | 3300031951 | Freshwater | MTVFTPDWKLTVGGVDYTDITISDVQHTAGRSDIYQQPLPSYMQVTL |
Ga0315904_109002282 | 3300031951 | Freshwater | MTVFTPDWKLTVGGVDYTDIAISDIQHQAGRTDIYQQP |
Ga0315906_101942301 | 3300032050 | Freshwater | MTVFTPDWKLIVGGVDYTDIAISDVQHQSGRTDIYQQALPSYM |
Ga0315906_110275251 | 3300032050 | Freshwater | MTVWTPDWKLSVAGVDYENITIADIAHQAGRDDIYTQPNP |
Ga0315276_105559962 | 3300032177 | Sediment | MSVFTPDWKLTVAGVEYTDITISDITHEAGRDDIYEQPNPSYLQVEL |
Ga0334978_0329459_594_728 | 3300033979 | Freshwater | MSAFTPDWKLTVGGVDYTDIAISDIQHEAGRTDIYQQPSPSYCSI |
Ga0335003_0390487_486_599 | 3300033995 | Freshwater | MTVWSPDWKLTVAGVDYTDIAIADIAHQAGRDDIYSQP |
Ga0334979_0235521_911_1063 | 3300033996 | Freshwater | MSDFTPDWKLTVGGVDYTNIAISDVQHQAGRSDIYQQSLPSYIQVTLVALN |
Ga0334986_0512247_420_587 | 3300034012 | Freshwater | MSDFTPDWKLTVSGVDYTDITISDVQHQAGRSDIYQQSLPSYIQVTLVALNGQTLP |
Ga0334987_0784814_382_531 | 3300034061 | Freshwater | MSDFTPDWKLTVGGVDYTNIAISDVQHQAGRSDIYQQPLPSYCQITLVAL |
Ga0334995_0013082_3_116 | 3300034062 | Freshwater | MTVWTPDWKLIVDGVDYEDITVSDIAHQAGRDDIYTQP |
Ga0310130_0245847_442_561 | 3300034073 | Fracking Water | MSDFTPDWKLTVGGVDYTDIAIADVQHQAGRTDIYQQPLP |
Ga0335010_0255302_884_1030 | 3300034092 | Freshwater | MSDFTPDWKLTVGGVDYTNIAISDVQHQAGRSDIYQQSLPSYIQVTLVA |
Ga0335010_0390127_2_163 | 3300034092 | Freshwater | MPAFTPDWKLTVGGVDYTNITISDVQHQAGRSDIYQQPLPSYMQITLVALNNQT |
Ga0335022_0083293_2_136 | 3300034095 | Freshwater | MTAWSPDWKLTVAGVDYTDIAISDIQHQAGRSDIYQQPNPSYIQV |
Ga0335027_0021903_2_145 | 3300034101 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRDDIYTQPNPSYLQVALV |
Ga0335030_0424212_742_855 | 3300034103 | Freshwater | MSAFTPDWKLTVGGVDYTDIAISDIQHEAGRTDIYQQP |
Ga0335031_0181218_1290_1436 | 3300034104 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRDDIYTQPNPSYLQVALVA |
Ga0335031_0585967_3_113 | 3300034104 | Freshwater | MSQFTPDWKLTVGGVDYTDITISDVQHQAGRSDIYQQ |
Ga0335035_0527823_520_639 | 3300034105 | Freshwater | MTVFTPEYQLTVNGVEYTNVAISDIAHQAGREDIYSQPNP |
Ga0335036_0255637_1045_1182 | 3300034106 | Freshwater | MTVFTPDWKLTINAVEYTNVAISDIAHQAGREDIYSQPNPSYMRIE |
Ga0335066_0403804_622_744 | 3300034112 | Freshwater | MSAWTPDWKLTVGGVDYTDIAISDIQHEAGRTDIYLQPNPS |
Ga0335068_0562564_376_519 | 3300034116 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQSGRDDIYTQPNPSYLQVQLV |
Ga0335033_0552535_398_541 | 3300034117 | Freshwater | MTAWSPDWKLTVAGVDYTDIVISDIQHQAGRTDIYQQPNPSYLQITFV |
Ga0335053_0288551_903_1034 | 3300034118 | Freshwater | MTVWNPDWKLTVSGVDYTDIAISDIQHQAGRDDIYSQPNPSYVQ |
Ga0335053_0607676_2_115 | 3300034118 | Freshwater | MTVFTPEYQLTVNGVEYTNVAISDIAHQAGREDIYSQP |
Ga0335060_0400610_557_724 | 3300034122 | Freshwater | MTVFTPDWKLTVGGVDYTDIAISDVQHQSGRTDIYQQALPSYIQISLVALNNQTLP |
Ga0335060_0688636_1_150 | 3300034122 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRTDIYTQPNPSYLQVQVVAL |
Ga0335016_0557703_3_143 | 3300034166 | Freshwater | MTVFTPDWKLTVGGVDYTDIAISDVQHQSGRTDIYQQALPSYMQISL |
Ga0335065_0189003_1237_1350 | 3300034200 | Freshwater | MTVWTPDWKLTVAGVDYTDIAISDIAHQAGRDDIYTQP |
Ga0335007_0811996_3_125 | 3300034283 | Freshwater | MTVFTPDWKLTVGGVDYTDITISDVQHAAGRTDIYQQSLPS |
⦗Top⦘ |