NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F056534

Metagenome / Metatranscriptome Family F056534

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056534
Family Type Metagenome / Metatranscriptome
Number of Sequences 137
Average Sequence Length 49 residues
Representative Sequence MDNKNFLREINNDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE
Number of Associated Samples 101
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 35.04 %
% of genes near scaffold ends (potentially truncated) 35.04 %
% of genes from short scaffolds (< 2000 bps) 55.47 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (37.956 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(29.927 % of family members)
Environment Ontology (ENVO) Unclassified
(61.314 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.672 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 54.90%    β-sheet: 0.00%    Coil/Unstructured: 45.10%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF04965GPW_gp25 54.74
PF00856SET 10.22
PF14240YHYH 5.84
PF16075DUF4815 1.46
PF07068Gp23 0.73
PF04984Phage_sheath_1 0.73
PF13884Peptidase_S74 0.73
PF07880T4_gp9_10 0.73
PF11053DNA_Packaging 0.73
PF13469Sulfotransfer_3 0.73
PF00386C1q 0.73

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 137 Family Scaffolds
COG3497Phage tail sheath protein FIMobilome: prophages, transposons [X] 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.29 %
UnclassifiedrootN/A19.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10045213All Organisms → Viruses → Predicted Viral1960Open in IMG/M
3300000116|DelMOSpr2010_c10120989Not Available945Open in IMG/M
3300000116|DelMOSpr2010_c10178319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes699Open in IMG/M
3300000117|DelMOWin2010_c10000220All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae33997Open in IMG/M
3300001460|JGI24003J15210_10121523All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae711Open in IMG/M
3300001962|GOS2239_1004413Not Available1571Open in IMG/M
3300002176|JGI24820J26691_1007078All Organisms → Viruses → Predicted Viral3041Open in IMG/M
3300002488|JGI25128J35275_1019570All Organisms → Viruses → Predicted Viral1682Open in IMG/M
3300004448|Ga0065861_1101383All Organisms → Viruses → Predicted Viral1407Open in IMG/M
3300004457|Ga0066224_1027169All Organisms → Viruses2999Open in IMG/M
3300005074|Ga0070431_1034592All Organisms → Viruses → Predicted Viral2739Open in IMG/M
3300005074|Ga0070431_1240764All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon584Open in IMG/M
3300005074|Ga0070431_1250548Not Available564Open in IMG/M
3300005239|Ga0073579_1191274Not Available47392Open in IMG/M
3300005432|Ga0066845_10441769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes503Open in IMG/M
3300005523|Ga0066865_10003776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4481Open in IMG/M
3300006025|Ga0075474_10041421All Organisms → Viruses → Predicted Viral1582Open in IMG/M
3300006026|Ga0075478_10019678All Organisms → Viruses → Predicted Viral2279Open in IMG/M
3300006735|Ga0098038_1003816All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM26255Open in IMG/M
3300006735|Ga0098038_1010784All Organisms → Viruses → Predicted Viral3583Open in IMG/M
3300006735|Ga0098038_1025089All Organisms → Viruses → Predicted Viral2251Open in IMG/M
3300006735|Ga0098038_1031108All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1991Open in IMG/M
3300006735|Ga0098038_1067583All Organisms → Viruses → Predicted Viral1268Open in IMG/M
3300006735|Ga0098038_1125777Not Available868Open in IMG/M
3300006737|Ga0098037_1017278All Organisms → Viruses → Predicted Viral2716Open in IMG/M
3300006737|Ga0098037_1021031All Organisms → Viruses → Predicted Viral2438Open in IMG/M
3300006751|Ga0098040_1009977All Organisms → Viruses3297Open in IMG/M
3300006752|Ga0098048_1000528All Organisms → Viruses18083Open in IMG/M
3300006793|Ga0098055_1026006All Organisms → Viruses → Predicted Viral2454Open in IMG/M
3300006867|Ga0075476_10056763All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1570Open in IMG/M
3300006916|Ga0070750_10001820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae11905Open in IMG/M
3300006924|Ga0098051_1115493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes717Open in IMG/M
3300006928|Ga0098041_1061058All Organisms → Viruses → Predicted Viral1217Open in IMG/M
3300006990|Ga0098046_1027079All Organisms → Viruses → Predicted Viral1417Open in IMG/M
3300007344|Ga0070745_1104463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae1105Open in IMG/M
3300007538|Ga0099851_1022386All Organisms → Viruses → Predicted Viral2553Open in IMG/M
3300007539|Ga0099849_1001769All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM210119Open in IMG/M
3300007539|Ga0099849_1106776All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1112Open in IMG/M
3300007542|Ga0099846_1020939All Organisms → Viruses → Predicted Viral2542Open in IMG/M
3300007542|Ga0099846_1092830All Organisms → Viruses → Predicted Viral1116Open in IMG/M
3300007640|Ga0070751_1251877All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes670Open in IMG/M
3300007960|Ga0099850_1075392All Organisms → Viruses → Predicted Viral1411Open in IMG/M
3300009079|Ga0102814_10005434All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM28030Open in IMG/M
3300009149|Ga0114918_10113462All Organisms → Viruses1663Open in IMG/M
3300009149|Ga0114918_10396549Not Available753Open in IMG/M
3300009149|Ga0114918_10402025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes746Open in IMG/M
3300009423|Ga0115548_1027929All Organisms → Viruses → Predicted Viral2193Open in IMG/M
3300009433|Ga0115545_1001985All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM210181Open in IMG/M
3300009550|Ga0115013_10102683All Organisms → Viruses → Predicted Viral1629Open in IMG/M
3300009593|Ga0115011_10000499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae32075Open in IMG/M
3300009593|Ga0115011_10024760All Organisms → Viruses → Predicted Viral4014Open in IMG/M
3300009593|Ga0115011_10922081Not Available733Open in IMG/M
3300010149|Ga0098049_1151501Not Available717Open in IMG/M
3300010150|Ga0098056_1017685All Organisms → Viruses → Predicted Viral2555Open in IMG/M
3300010296|Ga0129348_1004813All Organisms → Viruses → Predicted Viral4945Open in IMG/M
3300010297|Ga0129345_1073529All Organisms → Viruses → Predicted Viral1285Open in IMG/M
3300010299|Ga0129342_1095037All Organisms → Viruses → Predicted Viral1122Open in IMG/M
3300010299|Ga0129342_1130118Not Available928Open in IMG/M
3300010299|Ga0129342_1151399All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes845Open in IMG/M
3300010300|Ga0129351_1198563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes779Open in IMG/M
3300010300|Ga0129351_1290587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes620Open in IMG/M
3300010368|Ga0129324_10087197All Organisms → Viruses → Predicted Viral1362Open in IMG/M
3300010389|Ga0136549_10000581All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM226587Open in IMG/M
3300010392|Ga0118731_107282287Not Available1243Open in IMG/M
3300012928|Ga0163110_11061317All Organisms → Viruses647Open in IMG/M
3300012954|Ga0163111_11742495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured phage MedDCM-OCT-S04-C93622Open in IMG/M
3300012954|Ga0163111_11783119Not Available615Open in IMG/M
3300012963|Ga0129340_1065678Not Available611Open in IMG/M
3300012967|Ga0129343_1008448Not Available1100Open in IMG/M
3300017708|Ga0181369_1093738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured phage MedDCM-OCT-S04-C93629Open in IMG/M
3300017713|Ga0181391_1017040All Organisms → Viruses → Predicted Viral1829Open in IMG/M
3300017719|Ga0181390_1003561All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM686183Open in IMG/M
3300017751|Ga0187219_1000944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6814176Open in IMG/M
3300017967|Ga0181590_10078504All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM682602Open in IMG/M
3300017967|Ga0181590_10239566All Organisms → Viruses → Predicted Viral1344Open in IMG/M
3300017967|Ga0181590_10319218All Organisms → Viruses → Predicted Viral1124Open in IMG/M
3300017967|Ga0181590_10788394Not Available633Open in IMG/M
3300018421|Ga0181592_10276432All Organisms → Viruses → Predicted Viral1223Open in IMG/M
3300018424|Ga0181591_10089195All Organisms → Viruses → Predicted Viral2538Open in IMG/M
3300019730|Ga0194001_1022757Not Available721Open in IMG/M
3300019750|Ga0194000_1003998Not Available1490Open in IMG/M
3300020258|Ga0211529_1000120All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6814020Open in IMG/M
3300020258|Ga0211529_1002845All Organisms → Viruses → Predicted Viral2864Open in IMG/M
3300020258|Ga0211529_1038990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae813Open in IMG/M
3300020264|Ga0211526_1000215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae11217Open in IMG/M
3300020267|Ga0211648_1022000All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300020278|Ga0211606_1000922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6813055Open in IMG/M
3300020365|Ga0211506_1163273Not Available626Open in IMG/M
3300020379|Ga0211652_10071571All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM681041Open in IMG/M
3300020388|Ga0211678_10162809Not Available951Open in IMG/M
3300020408|Ga0211651_10201755Not Available774Open in IMG/M
3300020417|Ga0211528_10328332All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured phage MedDCM-OCT-S04-C93570Open in IMG/M
3300020421|Ga0211653_10013134All Organisms → Viruses → Predicted Viral4012Open in IMG/M
3300020439|Ga0211558_10000072All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae50397Open in IMG/M
3300020463|Ga0211676_10004428All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6813247Open in IMG/M
3300021347|Ga0213862_10000177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales26692Open in IMG/M
3300021364|Ga0213859_10000020All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales67130Open in IMG/M
3300021364|Ga0213859_10121376All Organisms → Viruses → Predicted Viral1236Open in IMG/M
3300021368|Ga0213860_10000847All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae12359Open in IMG/M
3300021425|Ga0213866_10000024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae141061Open in IMG/M
3300021425|Ga0213866_10024904All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae3523Open in IMG/M
3300021957|Ga0222717_10029326All Organisms → Viruses → Predicted Viral3646Open in IMG/M
3300021958|Ga0222718_10001527All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae21936Open in IMG/M
3300021958|Ga0222718_10003127Not Available14347Open in IMG/M
3300021958|Ga0222718_10004669All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae11307Open in IMG/M
3300021959|Ga0222716_10507927Not Available676Open in IMG/M
(restricted) 3300023109|Ga0233432_10166203All Organisms → Viruses → Predicted Viral1138Open in IMG/M
(restricted) 3300023210|Ga0233412_10086003All Organisms → Viruses → Predicted Viral1310Open in IMG/M
(restricted) 3300024059|Ga0255040_10009935All Organisms → Viruses → Predicted Viral3122Open in IMG/M
(restricted) 3300024062|Ga0255039_10018004All Organisms → Viruses → Predicted Viral2489Open in IMG/M
3300024262|Ga0210003_1093373All Organisms → Viruses → Predicted Viral1385Open in IMG/M
3300024262|Ga0210003_1188131All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes855Open in IMG/M
3300025070|Ga0208667_1000004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae115880Open in IMG/M
3300025070|Ga0208667_1022716Not Available1199Open in IMG/M
3300025084|Ga0208298_1006371All Organisms → Viruses → Predicted Viral3215Open in IMG/M
3300025086|Ga0208157_1068362All Organisms → Viruses911Open in IMG/M
3300025086|Ga0208157_1125567Not Available591Open in IMG/M
3300025096|Ga0208011_1000253All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6822381Open in IMG/M
3300025120|Ga0209535_1141957Not Available774Open in IMG/M
3300025132|Ga0209232_1001517All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6812406Open in IMG/M
3300025151|Ga0209645_1013881All Organisms → Viruses → Predicted Viral3174Open in IMG/M
3300025577|Ga0209304_1026717All Organisms → Viruses → Predicted Viral1753Open in IMG/M
3300025647|Ga0208160_1125728Not Available643Open in IMG/M
3300025674|Ga0208162_1016642All Organisms → Viruses → Predicted Viral2926Open in IMG/M
3300025674|Ga0208162_1058806All Organisms → Viruses → Predicted Viral1258Open in IMG/M
3300027753|Ga0208305_10003281All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM687267Open in IMG/M
3300027774|Ga0209433_10009661All Organisms → Viruses → Predicted Viral3071Open in IMG/M
3300027859|Ga0209503_10234625Not Available886Open in IMG/M
(restricted) 3300027865|Ga0255052_10529749All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes578Open in IMG/M
3300027906|Ga0209404_10001004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6820401Open in IMG/M
3300027906|Ga0209404_10002206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Prochlorococcus phage P-TIM6812235Open in IMG/M
3300027906|Ga0209404_10529345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales782Open in IMG/M
3300029318|Ga0185543_1018872All Organisms → Viruses → Predicted Viral1631Open in IMG/M
3300031519|Ga0307488_10023637All Organisms → Viruses → Predicted Viral4935Open in IMG/M
3300031519|Ga0307488_10206035All Organisms → Viruses → Predicted Viral1328Open in IMG/M
3300031578|Ga0307376_10277214Not Available1125Open in IMG/M
3300031673|Ga0307377_10057279All Organisms → Viruses → Predicted Viral3278Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine29.93%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.41%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.95%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient5.84%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.38%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.38%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface3.65%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.65%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater3.65%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.92%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.19%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.19%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.19%
Marine Benthic Sponge Stylissa Massa AssociatedHost-Associated → Porifera → Unclassified → Unclassified → Unclassified → Marine Benthic Sponge Stylissa Massa Associated2.19%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.46%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.46%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.46%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.46%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.46%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.73%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.73%
Marine Methane Seep SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment0.73%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001962Marine microbial communities from Cocos Island, Costa Rica - GS023EnvironmentalOpen in IMG/M
3300002176Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50mEnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300005074Marine benthic sponge Stylissa massa associated microbial communities from Guam, USAHost-AssociatedOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005432Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV78EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006751Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006990Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaGEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009423Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300010389Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsfEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012967Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019730Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MGEnvironmentalOpen in IMG/M
3300019750Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States - FLT_6-7_MGEnvironmentalOpen in IMG/M
3300020258Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556061-ERR598949)EnvironmentalOpen in IMG/M
3300020264Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158)EnvironmentalOpen in IMG/M
3300020267Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108)EnvironmentalOpen in IMG/M
3300020278Marine microbial communities from Tara Oceans - TARA_B100000674 (ERX556076-ERR599151)EnvironmentalOpen in IMG/M
3300020365Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300020408Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118)EnvironmentalOpen in IMG/M
3300020417Marine microbial communities from Tara Oceans - TARA_B100000073 (ERX556034-ERR599082)EnvironmentalOpen in IMG/M
3300020421Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020463Marine microbial communities from Tara Oceans - TARA_B100001057 (ERX555988-ERR599050)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025096Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027774Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029318Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1004521313300000116MarineMDQNFLREINHDQKTPKNKKKVREDGFYEASEADYKDFWE
DelMOSpr2010_1012098933300000116MarineMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE*
DelMOSpr2010_1017831913300000116MarineMDKNFLREINHDQKTPKNKKKVREDGFYEASEADYKDFWENE
DelMOWin2010_10000220173300000117MarineMDQNFLREINHDQKTPKNKKKVREDGFYEASEADYKDFWENEDTKQTLID*
JGI24003J15210_1012152323300001460MarineMDQNFLREINNDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID*
GOS2239_100441333300001962MarineMDNKNFLREIANDQKTRKNRKKVREDGFYEASEADWKDFWENEDTSDMLTE*
JGI24820J26691_100707823300002176MarineMDNKNFLREINNDQKTPKNRKKVREDGFYEASEADWKDFWESEDTSEILTE*
JGI25128J35275_101957033300002488MarineMDNQNFLREIAHDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0065861_110138333300004448MarineMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDTKQTLID*
Ga0066224_102716923300004457MarineMDQNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDTKQTLID*
Ga0070431_103459213300005074Marine Benthic Sponge Stylissa Massa AssociatedMEDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKAEILTE*
Ga0070431_124076423300005074Marine Benthic Sponge Stylissa Massa AssociatedMKDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKAEILTE*
Ga0070431_125054823300005074Marine Benthic Sponge Stylissa Massa AssociatedMDKNFLREINNDQLTPKNKKKVREDGFYEASEVDYKDFWENEDKQPDLLTE*
Ga0073579_1191274333300005239MarineMDQNFLREINHDQKTPKNTKNVREDGFYEASEADYKDFWENEDTTDTSKH*
Ga0066845_1044176913300005432MarineREIANDQKTPKNQKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0066865_1000377633300005523MarineMDNQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0075474_1004142133300006025AqueousMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTTEILTE*
Ga0075478_1001967833300006026AqueousMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDNSQILTE*
Ga0098038_100381613300006735MarineKTPKNKKKVREDGFYEASEADYRDFWENEDTSEMLTE*
Ga0098038_101078413300006735MarineQKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLTE*
Ga0098038_102508913300006735MarineKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLTE*
Ga0098038_103110823300006735MarineMENQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0098038_106758313300006735MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYRDFWENEDTS
Ga0098038_112577713300006735MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLTE*
Ga0098037_101727833300006737MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYRDFWENEDTSEMLTE*
Ga0098037_102103113300006737MarineINNDQKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLTE*
Ga0098040_100997723300006751MarineMDNKNFLREITNDQKTPKNRKNVREDGFYEASEADYKDFWENEDVSEMLTE*
Ga0098048_100052883300006752MarineMDKNFLREINHDQQTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID*
Ga0098055_102600643300006793MarineMDKNFLREINNDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID*
Ga0075476_1005676333300006867AqueousKTYMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTTEILTE*
Ga0070750_1000182053300006916AqueousMDQNFLREFNHDQKTPKNKKKVREDGFYEASEADYKDFWENEDTQQTLID*
Ga0098051_111549323300006924MarineMDKNFLREINHDQQTPKNTKKVREDGFYEASEADWKDFWENDDNK
Ga0098041_106105833300006928MarineMDNQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDT
Ga0098046_102707943300006990MarineMDKNFLREINNDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQ
Ga0070745_110446313300007344AqueousTYMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTTEILTE*
Ga0099851_102238613300007538AqueousNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE*
Ga0099849_100176953300007539AqueousMDKNFLREINHDQKTPKNKKKVREDGFYEASEVDYKDFWENEDKSPDILTE*
Ga0099849_110677633300007539AqueousMDKNFLREINNDQRTPKNKKKVREDGFYEASEVDYKDFWENEDNQPDLLTE*
Ga0099846_102093943300007542AqueousMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEILTE*
Ga0099846_109283033300007542AqueousMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWE
Ga0070751_125187723300007640AqueousMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEML
Ga0099850_107539243300007960AqueousMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTREMMTE*
Ga0102814_1000543443300009079EstuarineMDKNFLREINNDQKTPKNTKRVREDGFYEASEVDWKDFWENETTDNKQTLID*
Ga0114918_1011346243300009149Deep SubsurfaceMDQNFLREINHDQKTPKNKKKVREDGFYEASEADYKDVWENEDNKQTLID*
Ga0114918_1039654913300009149Deep SubsurfaceMDKNFLREINHDQKTPKNTKNVREDGFYEASEVDYKDFWENEDTTDNKQTLID*
Ga0114918_1040202513300009149Deep SubsurfaceMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDNKQT
Ga0115548_102792933300009423Pelagic MarineMDKNFLREINHDQKTPKNTKKVREDGFYEASEVDYKDFWENEDTQQTLID*
Ga0115545_100198553300009433Pelagic MarineMDKNFLREINHDQKTPKNTKKVREDGFYEASETDYKDFWENEDTKQTLID*
Ga0115013_1010268333300009550MarineMDNQNFLREIANDQKTPKNKKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0115011_10000499143300009593MarineMIYKRKVVIMEQNFLREINNDQKTPKNKKKIREDGFYEASEADYKDFWENEDTKQTLID*
Ga0115011_1002476043300009593MarineMINQRSLIGTFFNGMIYKGKVVIMEQNFLREINNDQKTPKNRKKVREDGFYEASEVDYKDFWENEDTSEMLTE*
Ga0115011_1092208113300009593MarineMIYKGKVVIMDQNFLREINNDQKTPKNRKKVREDGFYEASEVDYKDFWENEDTSEMLTE*
Ga0098049_115150113300010149MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYRDFWENEDTTEMLTE*
Ga0098056_101768533300010150MarineMDKNFLREINHDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID*
Ga0129348_100481373300010296Freshwater To Marine Saline GradientMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSKILTE*
Ga0129345_107352943300010297Freshwater To Marine Saline GradientMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSE
Ga0129342_109503733300010299Freshwater To Marine Saline GradientNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE*
Ga0129342_113011833300010299Freshwater To Marine Saline GradientMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENED
Ga0129342_115139923300010299Freshwater To Marine Saline GradientMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENED
Ga0129351_119856333300010300Freshwater To Marine Saline GradientMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE*
Ga0129351_129058723300010300Freshwater To Marine Saline GradientMDKNFLREINNDQRTPKNKKKVKEDGFYEASEVDYKDFWENEDNQPDLLTE*
Ga0129324_1008719743300010368Freshwater To Marine Saline GradientMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEILTE*
Ga0136549_1000058123300010389Marine Methane Seep SedimentMDDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKTEILTE*
Ga0118731_10728228723300010392MarineMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDNKQTLID*
Ga0163110_1106131723300012928Surface SeawaterMENKNFLREIANDQKTPKNQKKVREDGFYEASEADYKDFWENEDTTEMLTE*
Ga0163111_1174249513300012954Surface SeawaterQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0163111_1178311923300012954Surface SeawaterMDNKNFLREINNDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE*
Ga0129340_106567813300012963AqueousDLSSMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE*
Ga0129343_100844833300012967AqueousDLSSMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEILTE*
Ga0181369_109373823300017708MarinePKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0181391_101704023300017713SeawaterMDQNFLREINHDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID
Ga0181390_100356143300017719SeawaterMDQNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDNKQTLID
Ga0187219_100094443300017751SeawaterMDKNFLREINHDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID
Ga0181590_1007850413300017967Salt MarshNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE
Ga0181590_1023956613300017967Salt MarshMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE
Ga0181590_1031921813300017967Salt MarshMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE
Ga0181590_1078839413300017967Salt MarshKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDNSQILTE
Ga0181592_1027643243300018421Salt MarshMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDT
Ga0181591_1008919513300018424Salt MarshMDNRNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEILTE
Ga0194001_102275723300019730SedimentMDQNFLREINHDQKTPKNKKKVREDGFYEASEADYKDFWENEDTKQTLID
Ga0194000_100399833300019750SedimentMDQNFLREINHDQKTPKNKKKVREDGFYEASEAEYKDFWENEDTKQTLID
Ga0211529_100012033300020258MarineMDNKNFLREIANDQKTPKNQKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0211529_100284563300020258MarineMDNQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTSE
Ga0211529_103899013300020258MarineKRVMEDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKAEILTE
Ga0211526_100021543300020264MarineMDNQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTSEMLTE
Ga0211648_102200023300020267MarineMDNQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0211606_100092243300020278MarineMDNKNFLREINNDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0211506_116327313300020365MarineSKRVMEDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKAEILTE
Ga0211652_1007157133300020379MarineREIANDQKTPKNKKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0211678_1016280923300020388MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLTE
Ga0211651_1020175523300020408MarineMDNQNFLREIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTT
Ga0211528_1032833213300020417MarineIANDQKTPKNRKKVREDGFYEASEADWKDFWENEDTSEMLTE
Ga0211653_1001313443300020421MarineMDNQNFLREIANDQKTPKNKKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0211558_10000072273300020439MarineMDKNFLREINNDQRTPKNKKKVREDGFYEASEVDYKDFWENEDNQPDLLTE
Ga0211676_1000442843300020463MarineMDNQNFLREITNDQKTPKNKKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0213862_1000017773300021347SeawaterMDKNFLREINHDQKTPKNKKKVREDGFYEASEVDYKDFWENEDTKQTLID
Ga0213859_10000020333300021364SeawaterMDKNFLREINHDQKTPKNKKKVREDGFYEASEVDYKDFWENEDNQPDLLTE
Ga0213859_1012137613300021364SeawaterMEDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKTEILTE
Ga0213860_1000084743300021368SeawaterMDKNFLREINHDQKTPKNKKKVREDGFYEASEVDYKDFWENEENQPDLLTE
Ga0213866_100000241023300021425SeawaterMDDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKTEILTE
Ga0213866_1002490433300021425SeawaterMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTTEILTE
Ga0222717_1002932643300021957Estuarine WaterMDKNFLREINNDQKTPKNTKKVREDGFYEASEVDWKDFWENETTDNKQTLID
Ga0222718_1000152773300021958Estuarine WaterMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDNSQILTE
Ga0222718_1000312743300021958Estuarine WaterMDNKNFLREINHDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTAEILTE
Ga0222718_1000466943300021958Estuarine WaterMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDTTDNKQTLID
Ga0222716_1050792713300021959Estuarine WaterKTFMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTSEMLTE
(restricted) Ga0233432_1016620333300023109SeawaterMDKNFLREINNDQKTPKNTKRVREDGFYEASEVDFKDFW
(restricted) Ga0233412_1008600323300023210SeawaterMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDNKQTLID
(restricted) Ga0255040_1000993543300024059SeawaterMDKNFLREINNDQKTPKNTKRVREDGFYEASEVDFKDFWENEDPTDDKQTLID
(restricted) Ga0255039_1001800433300024062SeawaterMDKNFLREINNDQKTPKNTKRVREDGFYEASEVDFKDFWENEDPIDDKQTLID
Ga0210003_109337343300024262Deep SubsurfaceMDQNFLREINHDQKTPKNKKKVREDGFYEASEADYKD
Ga0210003_118813113300024262Deep SubsurfaceMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDCWENEDNKQTLID
Ga0208667_1000004153300025070MarineMDKNFLREINHDQQTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID
Ga0208667_102271623300025070MarineMDKNFLREINNDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID
Ga0208298_100637113300025084MarineMDKNFLREINNDQKTPKNTKKVREDGFYEASEADWKD
Ga0208157_106836233300025086MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYRDFWENEDTSEMLTE
Ga0208157_112556713300025086MarineINNDQKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLTE
Ga0208011_100025373300025096MarineMDNKNFLREITNDQKTPKNRKNVREDGFYEASEADYKDFWENEDVSEMLTE
Ga0209535_114195723300025120MarineMDQNFLREINNDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQTLID
Ga0209232_100151733300025132MarineMDNQNFLREIAHDQKTPKNRKKVREDGFYEASEADWKDFWENEDTTEMLTE
Ga0209645_101388173300025151MarineMKDKNFLREINHDQKTPKNQKKVRQDGFYEASEADWKDFWENEDKAEILTE
Ga0209304_102671733300025577Pelagic MarineMDKNFLREINHDQKTPKNTKKVREDGFYEASEVDYKDFWENEDTQQTLID
Ga0208160_112572813300025647AqueousEINHDQKTPKNQKKVRQDGFYEASEVDWKDFWENEDTTEILTE
Ga0208162_101664243300025674AqueousMDKNFLREINHDQKTPKNKKKVREDGFYEASEVDYKDFWENEDKSPDILTE
Ga0208162_105880613300025674AqueousMDNKNFLREINNDQKTPKNQKKVRQDGFYEASEVDWK
Ga0208305_1000328143300027753EstuarineMDKNFLREINNDQKTPKNTKRVREDGFYEASEVDWKDFWENETTDNKQTLID
Ga0209433_1000966133300027774MarineMDNKNFLREINNDQKTPKNRKKVREDGFYEASEADWKDFWESEDTSEILTE
Ga0209503_1023462523300027859MarineMENQNFLREINNDQKTPKNKKKVREDGFYEASEADYKDFWENEDTSEMLT
(restricted) Ga0255052_1052974923300027865SeawaterMDKNFLREINNDQKTQKNTKRVREDGFYEASEVDFKDFWENEDPTDDKQTLID
Ga0209404_1000100453300027906MarineMEQNFLREINNDQKTPKNKKKIREDGFYEASEADYKDFWENEDTKQTLID
Ga0209404_1000220643300027906MarineMINQRSLIGTFFNGMIYKGKVVIMEQNFLREINNDQKTPKNRKKVREDGFYEASEVDYKDFWENEDTSEMLTE
Ga0209404_1052934523300027906MarineMIYKGKVVIMDQNFLREINNDQKTPKNRKKVREDGFYEASEVDYKDFWENEDTSEMLTE
Ga0185543_101887213300029318MarineQKTPKNRKKVREDGFYEASEADWKDFWENEDTSEMLTE
Ga0307488_1002363753300031519Sackhole BrineMDKNFLREINHDQKTPKNTKKVREDGFYEASEADYKDFWENEDPTDDKQTLID
Ga0307488_1020603513300031519Sackhole BrineMDKNFLREINNDQKTPKNTKKVREDGFYEASEADWKDFWENDDNKQT
Ga0307376_1027721433300031578SoilMDQNFLREINHDQKTPKNKKKVREDGFYEASEADYKDVWENEDNKQTLID
Ga0307377_1005727923300031673SoilMDKNFLREINNDQKTPKNTKKVREDGFYEASEADYKDVWENEDNKQTLID


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.