NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F056307

Metatranscriptome Family F056307

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F056307
Family Type Metatranscriptome
Number of Sequences 137
Average Sequence Length 108 residues
Representative Sequence MARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGKHNREQEKADKHHLFEIEAYGKYDYHHNVYKPGVNRDRKFWEPEKIKDYVGRM
Number of Associated Samples 103
Number of Associated Scaffolds 137

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.11 %
% of genes near scaffold ends (potentially truncated) 45.26 %
% of genes from short scaffolds (< 2000 bps) 95.62 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (94.161 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(91.971 % of family members)
Environment Ontology (ENVO) Unclassified
(99.270 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(94.891 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.89%    β-sheet: 10.19%    Coil/Unstructured: 75.93%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 137 Family Scaffolds
PF04832SOUL 0.73


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.16 %
UnclassifiedrootN/A5.84 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10006554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus2470Open in IMG/M
3300008832|Ga0103951_10051240All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1497Open in IMG/M
3300008832|Ga0103951_10053205All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1482Open in IMG/M
3300008834|Ga0103882_10016672All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus858Open in IMG/M
3300008998|Ga0103502_10033694All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1650Open in IMG/M
3300008998|Ga0103502_10131106All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus902Open in IMG/M
3300009028|Ga0103708_100004111All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1994Open in IMG/M
3300009028|Ga0103708_100082917All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus772Open in IMG/M
3300009028|Ga0103708_100191629All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus588Open in IMG/M
3300018589|Ga0193320_1011903All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus725Open in IMG/M
3300018608|Ga0193415_1000871All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus2000Open in IMG/M
3300018608|Ga0193415_1000876All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1993Open in IMG/M
3300018608|Ga0193415_1005381All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1051Open in IMG/M
3300018643|Ga0193431_1024433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus639Open in IMG/M
3300018648|Ga0193445_1001422All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus2036Open in IMG/M
3300018651|Ga0192937_1029713All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus642Open in IMG/M
3300018653|Ga0193504_1034124All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus548Open in IMG/M
3300018656|Ga0193269_1015990All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1188Open in IMG/M
3300018659|Ga0193067_1004716All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1547Open in IMG/M
3300018660|Ga0193130_1027136All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus739Open in IMG/M
3300018663|Ga0192999_1038401All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus571Open in IMG/M
3300018663|Ga0192999_1040744All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus555Open in IMG/M
3300018664|Ga0193401_1018808All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus906Open in IMG/M
3300018673|Ga0193229_1041699Not Available555Open in IMG/M
3300018677|Ga0193404_1004886All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1623Open in IMG/M
3300018686|Ga0192840_1037683All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus601Open in IMG/M
3300018693|Ga0193264_1052272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus603Open in IMG/M
3300018694|Ga0192853_1009006All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1539Open in IMG/M
3300018720|Ga0192866_1015423All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1257Open in IMG/M
3300018731|Ga0193529_1003427All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus2093Open in IMG/M
3300018731|Ga0193529_1011478All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1468Open in IMG/M
3300018733|Ga0193036_1019856All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus863Open in IMG/M
3300018747|Ga0193147_1001596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus2346Open in IMG/M
3300018750|Ga0193097_1014037All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1846Open in IMG/M
3300018752|Ga0192902_1075391All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus601Open in IMG/M
3300018756|Ga0192931_1012428All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1790Open in IMG/M
3300018756|Ga0192931_1012666All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1776Open in IMG/M
3300018763|Ga0192827_1063426All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus643Open in IMG/M
3300018767|Ga0193212_1029280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus802Open in IMG/M
3300018770|Ga0193530_1043698Not Available882Open in IMG/M
3300018783|Ga0193197_1068121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus527Open in IMG/M
3300018784|Ga0193298_1009905All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1801Open in IMG/M
3300018784|Ga0193298_1095888All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus523Open in IMG/M
3300018812|Ga0192829_1087524All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus576Open in IMG/M
3300018819|Ga0193497_1025507All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1081Open in IMG/M
3300018819|Ga0193497_1030551All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus995Open in IMG/M
3300018820|Ga0193172_1034314All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus857Open in IMG/M
3300018833|Ga0193526_1023235All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1404Open in IMG/M
3300018844|Ga0193312_1008272All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1071Open in IMG/M
3300018854|Ga0193214_1062077All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus709Open in IMG/M
3300018857|Ga0193363_1092730All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus613Open in IMG/M
3300018865|Ga0193359_1008280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1712Open in IMG/M
3300018865|Ga0193359_1035939All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus947Open in IMG/M
3300018865|Ga0193359_1036498All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus940Open in IMG/M
3300018865|Ga0193359_1046837All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus832Open in IMG/M
3300018867|Ga0192859_1058188All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus634Open in IMG/M
3300018872|Ga0193162_1039061All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus926Open in IMG/M
3300018872|Ga0193162_1090281All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus586Open in IMG/M
3300018872|Ga0193162_1098121All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus556Open in IMG/M
3300018880|Ga0193337_1009804All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus922Open in IMG/M
3300018883|Ga0193276_1105698All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus571Open in IMG/M
3300018887|Ga0193360_1124620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus572Open in IMG/M
3300018898|Ga0193268_1048430All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1339Open in IMG/M
3300018901|Ga0193203_10032903All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1444Open in IMG/M
3300018908|Ga0193279_1105081All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis578Open in IMG/M
3300018924|Ga0193096_10034198All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1912Open in IMG/M
3300018925|Ga0193318_10141350All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus686Open in IMG/M
3300018925|Ga0193318_10186352All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus562Open in IMG/M
3300018929|Ga0192921_10133759All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus795Open in IMG/M
3300018940|Ga0192818_10208874Not Available553Open in IMG/M
3300018941|Ga0193265_10055370All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1354Open in IMG/M
3300018947|Ga0193066_10140711All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus704Open in IMG/M
3300018948|Ga0192985_1116632Not Available969Open in IMG/M
3300018950|Ga0192892_10127024All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus904Open in IMG/M
3300018952|Ga0192852_10024734All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1809Open in IMG/M
3300018953|Ga0193567_10149045All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus759Open in IMG/M
3300018953|Ga0193567_10233944All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus550Open in IMG/M
3300018953|Ga0193567_10257044All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus511Open in IMG/M
3300018956|Ga0192919_1046576All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1379Open in IMG/M
3300018956|Ga0192919_1060936All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1214Open in IMG/M
3300018957|Ga0193528_10039854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1607Open in IMG/M
3300018958|Ga0193560_10058555All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1207Open in IMG/M
3300018963|Ga0193332_10189627All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus657Open in IMG/M
3300018963|Ga0193332_10224041All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus585Open in IMG/M
3300018965|Ga0193562_10093036All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus858Open in IMG/M
3300018965|Ga0193562_10141919All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus688Open in IMG/M
3300018966|Ga0193293_10014194All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1016Open in IMG/M
3300018968|Ga0192894_10102790All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus870Open in IMG/M
3300018973|Ga0193330_10143265All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus748Open in IMG/M
3300018973|Ga0193330_10233094All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus513Open in IMG/M
3300018985|Ga0193136_10101685All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus828Open in IMG/M
3300018987|Ga0193188_10041672All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus766Open in IMG/M
3300018988|Ga0193275_10171010All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus669Open in IMG/M
3300018993|Ga0193563_10280352All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus502Open in IMG/M
3300018994|Ga0193280_10027347All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1913Open in IMG/M
3300018994|Ga0193280_10058298All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1483Open in IMG/M
3300018994|Ga0193280_10270312All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus639Open in IMG/M
3300018995|Ga0193430_10050679All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus927Open in IMG/M
3300018995|Ga0193430_10149515All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus568Open in IMG/M
3300018998|Ga0193444_10092133All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus795Open in IMG/M
3300018999|Ga0193514_10189189All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus744Open in IMG/M
3300019001|Ga0193034_10138136All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus585Open in IMG/M
3300019006|Ga0193154_10065322All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1259Open in IMG/M
3300019007|Ga0193196_10307433All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus680Open in IMG/M
3300019008|Ga0193361_10162362All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus847Open in IMG/M
3300019008|Ga0193361_10250510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus632Open in IMG/M
3300019011|Ga0192926_10113181All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1087Open in IMG/M
3300019011|Ga0192926_10290720All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus700Open in IMG/M
3300019011|Ga0192926_10355493All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus624Open in IMG/M
3300019014|Ga0193299_10043854All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1751Open in IMG/M
3300019014|Ga0193299_10076154All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1389Open in IMG/M
3300019016|Ga0193094_10134487All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus903Open in IMG/M
3300019017|Ga0193569_10062060All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1605Open in IMG/M
3300019017|Ga0193569_10242132All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus777Open in IMG/M
3300019018|Ga0192860_10317762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus557Open in IMG/M
3300019020|Ga0193538_10047234All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1556Open in IMG/M
3300019026|Ga0193565_10259465All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus594Open in IMG/M
3300019028|Ga0193449_10274601All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus714Open in IMG/M
3300019037|Ga0192886_10270939All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus559Open in IMG/M
3300019040|Ga0192857_10073312All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus884Open in IMG/M
3300019041|Ga0193556_10094239All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus953Open in IMG/M
3300019044|Ga0193189_10081057All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus777Open in IMG/M
3300019044|Ga0193189_10106953All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus671Open in IMG/M
3300019051|Ga0192826_10031282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1604Open in IMG/M
3300019052|Ga0193455_10071646All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1462Open in IMG/M
3300019053|Ga0193356_10046504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1288Open in IMG/M
3300019055|Ga0193208_10041217All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1755Open in IMG/M
3300019091|Ga0192935_1000596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus2112Open in IMG/M
3300019143|Ga0192856_1002318All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus1390Open in IMG/M
3300019143|Ga0192856_1016419All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus873Open in IMG/M
3300030699|Ga0307398_10190302All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1082Open in IMG/M
3300030702|Ga0307399_10265957Not Available809Open in IMG/M
3300031559|Ga0308135_1101067Not Available518Open in IMG/M
3300031717|Ga0307396_10564813All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus547Open in IMG/M
3300031729|Ga0307391_10334117Not Available830Open in IMG/M
3300031734|Ga0307397_10060155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Gymnoplea → Calanoida → Temoridae → Eurytemora → Eurytemora affinis1445Open in IMG/M
3300033572|Ga0307390_10398079Not Available840Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine91.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine5.11%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water2.19%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.73%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300018589Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001664 (ERX1782130-ERR1711875)EnvironmentalOpen in IMG/M
3300018608Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002024 (ERX1782181-ERR1712102)EnvironmentalOpen in IMG/M
3300018643Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782462-ERR1712152)EnvironmentalOpen in IMG/M
3300018648Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782304-ERR1712027)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018653Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003013 (ERX1789553-ERR1719190)EnvironmentalOpen in IMG/M
3300018656Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789469-ERR1719513)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018663Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001784 (ERX1782465-ERR1712058)EnvironmentalOpen in IMG/M
3300018664Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789700-ERR1719381)EnvironmentalOpen in IMG/M
3300018673Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_048 - TARA_N000000115 (ERX1782433-ERR1712189)EnvironmentalOpen in IMG/M
3300018677Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002043 (ERX1789362-ERR1719365)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018693Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789601-ERR1719212)EnvironmentalOpen in IMG/M
3300018694Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782273-ERR1712042)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018750Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789696-ERR1719423)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018756Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000879 (ERX1789481-ERR1719268)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018767Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000075 (ERX1782420-ERR1711944)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018783Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782442-ERR1712209)EnvironmentalOpen in IMG/M
3300018784Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789528-ERR1719403)EnvironmentalOpen in IMG/M
3300018812Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000065 (ERX1789716-ERR1719392)EnvironmentalOpen in IMG/M
3300018819Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002940 (ERX1789719-ERR1719288)EnvironmentalOpen in IMG/M
3300018820Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000312 (ERX1789518-ERR1719511)EnvironmentalOpen in IMG/M
3300018833Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_148 - TARA_N000002119 (ERX1789510-ERR1719289)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018857Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001828 (ERX1789640-ERR1719290)EnvironmentalOpen in IMG/M
3300018865Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001824 (ERX1789688-ERR1719211)EnvironmentalOpen in IMG/M
3300018867Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000968 (ERX1789681-ERR1719251)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018883Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001582 (ERX1789446-ERR1719492)EnvironmentalOpen in IMG/M
3300018887Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789534-ERR1719462)EnvironmentalOpen in IMG/M
3300018898Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789568-ERR1719317)EnvironmentalOpen in IMG/M
3300018901Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000014 (ERX1782459-ERR1712126)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018924Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000046 (ERX1789468-ERR1719259)EnvironmentalOpen in IMG/M
3300018925Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001662 (ERX1789484-ERR1719312)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018940Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000536 (ERX1782257-ERR1712105)EnvironmentalOpen in IMG/M
3300018941Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001288 (ERX1789482-ERR1719320)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018950Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000711 (ERX1789413-ERR1719427)EnvironmentalOpen in IMG/M
3300018952Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782281-ERR1712142)EnvironmentalOpen in IMG/M
3300018953Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002753EnvironmentalOpen in IMG/M
3300018956Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000841 (ERX1782332-ERR1711962)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018958Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_144 - TARA_N000003191EnvironmentalOpen in IMG/M
3300018963Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001796 (ERX1789664-ERR1719481)EnvironmentalOpen in IMG/M
3300018965Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_149 - TARA_N000002141EnvironmentalOpen in IMG/M
3300018966Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001614 (ERX1809469-ERR1739845)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018973Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_109 - TARA_N000001742 (ERX1789408-ERR1719300)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018987Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018993Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002703EnvironmentalOpen in IMG/M
3300018994Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001586 (ERX1789578-ERR1719368)EnvironmentalOpen in IMG/M
3300018995Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002299 (ERX1782426-ERR1711902)EnvironmentalOpen in IMG/M
3300018998Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002360 (ERX1782428-ERR1712117)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019006Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000394 (ERX1782339-ERR1711936)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019008Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001826 (ERX1789684-ERR1719447)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019014Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001620 (ERX1789400-ERR1719204)EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019018Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000981 (ERX1789537-ERR1719348)EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019026Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002719EnvironmentalOpen in IMG/M
3300019028Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789432-ERR1719419)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019041Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003007EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019052Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002402 (ERX1789503-ERR1719228)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019055Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)EnvironmentalOpen in IMG/M
3300019091Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001510 (ERX1782237-ERR1711876)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031559Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_937_33.10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1000655423300008832MarineMIKAACSHRTSAHSPLENVTTPYNPIRLLKGAPPGQERVNYYASELNIIGKHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM*
Ga0103951_1005124023300008832MarineMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKGAIRKM*
Ga0103951_1005320523300008832MarineMVVLIRLSLKNSAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQNKANAHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM*
Ga0103882_1001667213300008834Surface Ocean WaterSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM*
Ga0103502_1003369433300008998MarineMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQNKANAHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM*
Ga0103502_1013110613300008998MarineFLVDAYAKQIKELNSSTAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRQQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM*
Ga0103708_10000411133300009028Ocean WaterMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM*
Ga0103708_10008291713300009028Ocean WaterNFLVDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM*
Ga0103708_10019162913300009028Ocean WaterELNSSTAMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKDAIKKM*
Ga0193320_101190313300018589MarineMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193415_100087123300018608MarineMARINMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKI
Ga0193415_100087623300018608MarineMARINMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193415_100538123300018608MarineMARINMIKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193431_102443323300018643MarineMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193445_100142223300018648MarineMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKI
Ga0192937_102971313300018651MarineFLVDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193504_103412413300018653MarineLDLENFLVDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193269_101599013300018656MarineMMKAATSRRTSAHSPIDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDVDAFEKFDYHHNIYEPGVDRDKKFWEPEKIKDYVGRM
Ga0193067_100471613300018659MarineMARINMIRAATSHRTSAHSPLENVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKRLDDHHLFEIEAYNKFDYHHNIYEPNVDRNKTFWEPEKIKDFVKKM
Ga0193130_102713613300018660MarineELNSSTAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANQHHLFEIDAYGKYDYHHNVYRPGVNRDRKFWEPEKIKDYVGRM
Ga0192999_103840123300018663MarineHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKDAIKKM
Ga0192999_104074413300018663MarineMARINMIKAATSHKTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193401_101880823300018664MarineMARINMIKAATSHKTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193229_104169913300018673MarineATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193404_100488613300018677MarineMARINMIKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYQPNVDRNKTFWEPEKIKDYVKKI
Ga0192840_103768313300018686MarineMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193264_105227223300018693MarineMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNFYCSELNILGKHSRKQKAKDDHHLFEVEAYGKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0192853_100900623300018694MarineMIKAATSRRTSAHSPVDNVTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFAKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0192866_101542323300018720MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRAQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0193529_100342713300018731MarineMARINMIKAACSHRTSAHSPLENVTTPYNPIRLLKGAPPGQERVNYYASELNIIGKHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193529_101147813300018731MarineMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKGAIRKM
Ga0193036_101985613300018733MarineRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANKHHLFEIEAYGKYDYHHNIYKPGVNRDRKFWEPEKIKDYVGCM
Ga0193147_100159623300018747MarineMIKAACSQRTSAHSPLDNVTTPYNPVRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193097_101403713300018750MarineMIKAATSRRTSAHSPIDNMTTPYNPIRLLKGAPPGQERVNHYASELNILGKHTRKQDRKDRKHLFDIDAFNKFDYHHNIYEPGVNRDKKFWEPEKIKDYVGRM
Ga0192902_107539123300018752MarineMIKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYQPNVDRNKTFWEP
Ga0192931_101242823300018756MarineMIKAATSRRTSAHSPVDNVSTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQNRKDQKHLFEIDAFDKYDYHHNVYEAGVDRNQKFYEPEKIADYVGRM
Ga0192931_101266623300018756MarineMARINMIKAATSRRTSAHSPVDNVSTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQNRKDQKHLFEIDAFDKYDYHHNVYEAGVDRNQKFYEPEKIADYVGRM
Ga0192827_106342613300018763MarineMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193212_102928013300018767MarineRINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193530_104369813300018770MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHGRSQEKANKHHLFEIDAYGKYDYHHNVYKPGVDRDRKFWEPEKIKAYVGAM
Ga0193197_106812113300018783MarineARINMIKAATSHKTSTHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193298_100990513300018784MarineMARINMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGKHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193298_109588813300018784MarineNDKSSTSLDLENFLVDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0192829_108752413300018812MarineIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193497_102550713300018819MarineKELNSSTAMARINMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGKHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193497_103055123300018819MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANQHHLFEIDAYGKYDYHHNVYRPGVNRDRKFWEPEKIKDYVGRM
Ga0193172_103431423300018820MarineFLVDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193526_102323513300018833MarineMIKAATSRRTSAHSPLDNCTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFNKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0193312_100827223300018844MarineMIKAATSHKTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193214_106207713300018854MarineAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193363_109273013300018857MarineMARIKMIKAATQRRTSAHSPQDNVTTSYNPIRLLKGAPPGQERVNHYASELNILGKYGRKQDRKDRKHLFEIDAFDQYDYHHNIYEPGVNRDKKFWEPEKIKDYVGRM
Ga0193359_100828013300018865MarineMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRAQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0193359_103593923300018865MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGKHNREQEKADKHHLFEIEAYGKYDYHHNVYKPGVNRDRKFWEPEKIKDYVGRM
Ga0193359_103649823300018865MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANKHHLFEIEAYGKYDYHHNIYKPGVNRDRKFWEPEKIKDYVGCM
Ga0193359_104683713300018865MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANQHHLFEIDAYGKYDYHHNVYKPGVNRDRKFWEPEKIRDYVGAM
Ga0192859_105818813300018867MarineKELNSSTAMARINMIKAATSHKTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193162_103906113300018872MarineFLVDAYAKQIKELNSSTAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRQQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0193162_109028113300018872MarineMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANQHHLFEIDAYGKYDYHHNVYKPGVNRDRKFWEPEKIRDYVGAM
Ga0193162_109812113300018872MarineMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANQHHLFEIDAYGKYDYHHNVYRPGVNRDRKFWEPEKIKDYVGRM
Ga0193337_100980413300018880MarineMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193276_110569813300018883MarineLNSSTAMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFGVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193360_112462013300018887MarineMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFAVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193268_104843013300018898MarineMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNFYCSELNILGKHSRKQKAKDDHHLFEVEAYGKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193203_1003290323300018901MarineMARINMIKAATSHKTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYQPNVDRNKTFWEPEKIKDYVKKI
Ga0193279_110508113300018908MarineSDKYTNMRYNDKTSTSLDLDRFLVDAYSKQIKELNSSTAMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFGVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193096_1003419813300018924MarineMIRAATSRRTSAHSPIDNMTTPYNPIRLLKGAPPGQERVNHYASELNILGKHTRKQDRKDRKHLFDIDAFNKFDYHHNIYEPGVNRDKKFWEPEKIKDYVGRM
Ga0193318_1014135013300018925MarineSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193318_1018635213300018925MarineMARINMIKSATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHSRKQKARDAHHLFEIEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKI
Ga0192921_1013375913300018929MarineQCKIAKYSSAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANQHHLFEIDAYGKYDYHHNVYKPGVNRDRKFWEPEKIRDYVGAM
Ga0192818_1020887413300018940MarineHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKGAIRKM
Ga0193265_1005537023300018941MarineMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNFYCSELNILGKHSRKQKAKDDHHLFEIEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193066_1014071113300018947MarineTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0192985_111663213300018948MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRQQQKADAHHLFEIEAYGKFDYHHNIYKPGVDRNKKFWEPEKIKDYVGRM
Ga0192892_1012702413300018950MarineMARISMIKAATSRRTAAHSPLDNVTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFEIDAFSKYDYHHNVYEAGVDRNQKFWEPEKISDYVGRM
Ga0192852_1002473413300018952MarineMARINMIKAATSRRTSAHSPVDNVTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFAKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0193567_1014904523300018953MarineMARINMIKAATSRRTSAHSPKDNVSTLYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFAVEAYDEYDYHHNVYEPGVNREQKFWEPEKIKDYVGRM
Ga0193567_1023394413300018953MarineAMARINMIKAATSRRTSAHSPLDNCTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFNKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0193567_1025704413300018953MarineTAMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHARKQKARDDHHLFEVEAYDKYDYHHNVFSPNVDRDMKFWEPEKIKGAIRKM
Ga0192919_104657613300018956MarineMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0192919_106093623300018956MarineMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQVRKDQLHLFAVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193528_1003985433300018957MarineRFLVESYSKQIKELNSSTAMARINMIKAACSHRTSAHSPLENVTTPYNPIRLLKGAPPGQERVNYYASELNIIGKHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193560_1005855523300018958MarineMARINMIKAATSRRTSAHSPIDNVSTPYNPIRLLKGGPPGQERVNHYASELNILGKQGRKQDRKDQKHLFDIEAFNKYDYHHNVYEPGVNRDKKFWEPEKISDFVGLM
Ga0193332_1018962713300018963MarineMARINMIKAATSRRTSAHSPIDNVSTPYNPIRLLKGGPPGQERVNHYASELNILGKQGRKQDRKDRKHLFDIEAFSKYDYHHNVYEPGVDRDKKFWEPEKISDFVGRM
Ga0193332_1022404113300018963MarineDRFLVDSYSKQIKELNSSTAMARINMIKSATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNYYCSELNILGKHSRKQKARDAHHLFEIEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKI
Ga0193562_1009303623300018965MarineMMRAATSRRTSAHSPIDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDVDAFEKFDYHHNIYEPGVDRDKKFWEPEKIKDYVGRM
Ga0193562_1014191913300018965MarineAHSPVDNVSTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQNRKDQKHLFEIDAFDKYDYHHNVYEAGVDRNQKFYEPEKIADYVGRM
Ga0193293_1001419413300018966MarineDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPLDNVTTPYNPMRLLKGAPPGQERVSYYATELNIMGKHGREQKKIDDHHLYEIEAYGKYDYHHNVYKPGVDRNKKFWEPEKIKDYVGRM
Ga0192894_1010279013300018968MarineMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHSREQEKIDKHHLFEIESYGKYDYHHNVYRPGVKRDMKFWEPEKIKDYVGRM
Ga0193330_1014326513300018973MarineMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFGVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193330_1023309413300018973MarineINMIKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYQPNVDRNKTFWEPEKIKDYVKKI
Ga0193136_1010168513300018985MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRAQEKANAHHLFEVESQGKYDYHHNIYKPGVDRN
Ga0193188_1004167213300018987MarineRIQAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHNREQEKANKHHLFEIEAYGKYDYHHNIYKPGVNRDRKFWEPEKIKDYVGCM
Ga0193275_1017101013300018988MarineIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHHREQEKLDKHHLFEIESYGKYDYHHNVYKPGVKRDMKFWEPEKIKDYVGRM
Ga0193563_1028035223300018993MarineMARINMIKAATSRRTSAHSPKDNVSTLYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFAVEAYDEYDYHHNVYEPGVNREQKFWEPEKIK
Ga0193280_1002734733300018994MarineMARINMIKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKKLDDHHLFEIEAYGKFDYHHNIYQPNVDRNKTFWEPEKIKDYVKKI
Ga0193280_1005829813300018994MarineMARINMIRAATSHRTSAHSPLENVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKRLDDHHLFEIEAYNKYDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0193280_1027031213300018994MarineVDAYSKQIKELNSSTAMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFGVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193430_1005067913300018995MarineMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKD
Ga0193430_1014951513300018995MarineTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRQQKAKDAHHLFEVEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193444_1009213313300018998MarinePYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193514_1018918913300018999MarineMARINMIKAAVSRRTSAHAPLDNVTTPYNPMRLLKGAPPGQERVSYYATELNIMGKHGREQKKIDDHHLYEIEAYGKYDYHHNVYKPGVDRNKKFWEPEKIKDYVGRM
Ga0193034_1013813613300019001MarineKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193154_1006532213300019006MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRQQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGPHVTSILTCFVFVILIHLIRFALTEL
Ga0193196_1030743313300019007MarineAMARINMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193361_1016236213300019008MarineMARINMIKAATSRRTSAHSPVDNVTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFNKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0193361_1025051013300019008MarineMARINMIKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYEPNVDRNKTFWEPEKIKDYVKKM
Ga0192926_1011318113300019011MarineMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKAKDAHHLFEVEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0192926_1029072013300019011MarineNLDLENFLVDAYAKQIKELNSSTAMARINMIKAAVSRRTSAHAPLDNVTTPYNPMRLLKGAPPGQERVSYYATELNIMGKHGREQKKIDDHHLYEIEAYGKYDYHHNVYKPGVDRNKKFWEPEKIKDYVGRM
Ga0192926_1035549323300019011MarineFRHHQIMEKSKLESQNFFKASAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRAQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0193299_1004385413300019014MarineMIKAATSRRTSAHSPVDNVTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFNKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0193299_1007615413300019014MarineAMARINMIKAATSRRTSAHSPVDNVTTPYNPIRLLKGGPPGQERVNHYASELNILGKHGRKQDRKDRKHLFDIDAFNKYDYHHNVYEPGVDRDKKFWEPEKISDYVGRM
Ga0193094_1013448713300019016MarineKQIKELNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQEKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0193569_1006206023300019017MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRQQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0193569_1024213213300019017MarineAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRAQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0192860_1031776213300019018MarineRAMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFGVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193538_1004723423300019020MarineMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHGRSQEKANKHHLFEIDAYGKYDYHHNVYKPGVDRDRKFWEPEKIKAYVGAM
Ga0193565_1025946513300019026MarineMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQNNREQDKANRHHLFEIEAYGKYDYHHNVYKPGVNRDTICLKLKRMENMTIITM
Ga0193449_1027460123300019028MarineMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQVRKDQLHLFAVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0192886_1027093913300019037MarineQAMARINMIRAATSHRTSAHSPLENVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKRLDDHHLFEIEAYNKFDYHHNIYEPNVDRNKTFWEPEKIKDFVKKM
Ga0192857_1007331213300019040MarineDAYAKQIKELNSSTAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHHRAQEKANAHHLFEVESQGKYDYHHNIYKPGVDRNRKFWEPEKIKDYVGRM
Ga0193556_1009423923300019041MarineMARINMIKAATSRRTSAHSPKDNVSTPYNPIRLLKGAPPGQERVNHYASELNILGKQNRKQARKDQLHLFGVEAYDEYDYHHNVYEPGVNRDQKFWEPEKIADYVGRM
Ga0193189_1008105713300019044MarineLDRFLVESYSKQIKELNSSTAMARINMIKAACSHRTSAHSPLDNVTTPYNPIRLLKGAPPGQERVNYYASELNIIGQHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0193189_1010695313300019044MarineAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0192826_1003128233300019051MarineMARINMMKAATSHKTSAHAPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKKLDDHHLFEIEAYGKFDYHHNIYQPNVDRNKTFWEPEKIKDYVKKI
Ga0193455_1007164623300019052MarineMARINMIRAATSHRTSAHSPLENVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHGRKQKRLDDHHLFEIEAYNKYDYHHNIYQPNVDRNKTFWEPEKIKDYVKKM
Ga0193356_1004650423300019053MarineMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRQQKAKDAHHLFEVEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0193208_1004121723300019055MarineMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0192935_100059623300019091MarineMIKAACSHRTSAHSPLENVTTPYNPIRLLKGAPPGQERVNYYASELNIIGKHNRKQKRKDDLHLFGIEAYDKYDYHHNVYEPNVDREKKFWEPEKIKDYVKKM
Ga0192856_100231823300019143MarineMARINMIKAATSHRTSAHSPLDNVSTPYNPIRLLKGAPPGQERVNHYCSELNILGKHSRKQKAKDAHHLFEVEAYDKYDYHHNIFSPNVDRDMKFWEPEKIKDAIKKM
Ga0192856_101641913300019143MarineNSSTAMARINMIKAAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNYYASELNIMGQHNREQDKANKHHLFEIESYGKYDYHHNVYKPGVDRNRKFWEPEKIADYVGRM
Ga0307398_1019030223300030699MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHARAQEKANQHHLFEIEAYGKYDYHHNVYKPGVNRDKKFWEPEKIKAM
Ga0307399_1026595713300030702MarineAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHARAQEKANQHHLFEIEAYGKYDYHHNVYKPGVNRDKKFWEPEKIKAMSFKK
Ga0308135_110106723300031559MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGKHSRAQEKANAHHLFEIEAYGKYDYHHNVYKPGVNRERKFWEPEKIKEYVGR
Ga0307396_1056481313300031717MarineTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHARAQEKANQHHLFEIEAYGKYDYHHNVYKPGVNRDKKFWEPEKIKAMSFKK
Ga0307391_1033411723300031729MarineMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHARAQEKANQHHLFEIEAYGKYDYHHNVYKPGVNRDKKFWEPEKIKAMSFKKX
Ga0307397_1006015513300031734MarineMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHARAQEKANQHHLFEIEAYGKYDYHHNVYKPGVNRDKKFWEPEKIKAMSFKK
Ga0307390_1039807913300033572MarineAMARINMIKSAVSRRTSAHAPMDNVTTPYNPIRLLKGAPPGQERVNFYASELNIMGQHARAQEKANQHHLFEIEAYGKYDYHHNVYKPGVNRDKKFWEPEKIKAMSFKKX

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.