Metagenome / Metatranscriptome Family F056017

Overview

Basic Information

• Family ID: F056017
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 138
• Average Sequence Length: 37 residues
• Representative Sequence: MSAAGPPQGANCAPAFGGSAAAELANEAASVGVHQ
• Number of Associated Samples: 83
• Number of Associated Scaffolds: 138

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 57.89 %
• % of genes near scaffold ends (potentially truncated): 44.93 %
• % of genes from short scaffolds (< 2000 bps): 56.52 %
• Associated GOLD sequencing projects: 80
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (78.261 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (33.333 % of family members)
• Environment Ontology (ENVO): Unclassified (47.101 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (50.725 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Fibrous
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 33.33%
  β-sheet: 0.00%
  Coil/Unstructured: 66.67%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 138 Family Scaffolds
PF00005	ABC_tran	8.70
PF00528	BPD_transp_1	7.25
PF02653	BPD_transp_2	4.35
PF00873	ACR_tran	2.90
PF00361	Proton_antipo_M	2.17
PF08402	TOBE_2	1.45
PF00797	Acetyltransf_2	1.45
PF00248	Aldo_ket_red	1.45
PF00346	Complex1_49kDa	1.45
PF00483	NTP_transferase	1.45
PF02777	Sod_Fe_C	1.45
PF02737	3HCDH_N	1.45
PF06267	DUF1028	1.45
PF04055	Radical_SAM	1.45
PF08281	Sigma70_r4_2	1.45
PF00171	Aldedh	1.45
PF02321	OEP	1.45
PF13458	Peripla_BP_6	1.45
PF01494	FAD_binding_3	1.45
PF03401	TctC	1.45
PF12911	OppC_N	0.72
PF02934	GatB_N	0.72
PF03447	NAD_binding_3	0.72
PF13401	AAA_22	0.72
PF13466	STAS_2	0.72
PF07992	Pyr_redox_2	0.72
PF00486	Trans_reg_C	0.72
PF11743	DUF3301	0.72
PF02613	Nitrate_red_del	0.72
PF01127	Sdh_cyt	0.72
PF13432	TPR_16	0.72
PF08501	Shikimate_dh_N	0.72
PF12697	Abhydrolase_6	0.72
PF01032	FecCD	0.72
PF03840	SecG	0.72
PF01257	2Fe-2S_thioredx	0.72
PF07793	DUF1631	0.72
PF07690	MFS_1	0.72
PF13442	Cytochrome_CBB3	0.72
PF00326	Peptidase_S9	0.72
PF00106	adh_short	0.72
PF00294	PfkB	0.72
PF00795	CN_hydrolase	0.72
PF01975	SurE	0.72
PF00892	EamA	0.72
PF02104	SURF1	0.72
PF01966	HD	0.72
PF07978	NIPSNAP	0.72
PF01435	Peptidase_M48	0.72
PF02826	2-Hacid_dh_C	0.72
PF00202	Aminotran_3	0.72
PF09828	Chrome_Resist	0.72
PF01047	MarR	0.72
PF01717	Meth_synt_2	0.72
PF04321	RmlD_sub_bind	0.72
PF08241	Methyltransf_11	0.72
PF03972	MmgE_PrpD	0.72
PF11306	DUF3108	0.72
PF03934	T2SSK	0.72
PF01970	TctA	0.72
PF03477	ATP-cone	0.72
PF02668	TauD	0.72
PF01266	DAO	0.72
PF02233	PNTB	0.72
PF04995	CcmD	0.72
PF13298	LigD_N	0.72
PF02775	TPP_enzyme_C	0.72
PF00682	HMGL-like	0.72
PF13561	adh_short_C2	0.72
PF08811	DUF1800	0.72
PF01926	MMR_HSR1	0.72
PF09948	DUF2182	0.72
PF03450	CO_deh_flav_C	0.72
PF00056	Ldh_1_N	0.72
PF06857	ACP	0.72
PF00327	Ribosomal_L30	0.72
PF12769	PNTB_4TM	0.72
PF00472	RF-1	0.72
PF08445	FR47	0.72
PF05035	DGOK	0.72
PF16490	Oxidoreduct_C	0.72
PF00378	ECH_1	0.72
PF02142	MGS	0.72
PF05834	Lycopene_cycl	0.72
PF09837	DUF2064	0.72
PF00288	GHMP_kinases_N	0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 138 Family Scaffolds
COG1538	Outer membrane protein TolC	Cell wall/membrane/envelope biogenesis [M]	2.90
COG0654	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases	Energy production and conversion [C]	2.90
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	1.45
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	1.45
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	1.45
COG2162	Arylamine N-acetyltransferase	Secondary metabolites biosynthesis, transport and catabolism [Q]	1.45
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	1.45
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	1.45
COG3261	Ni,Fe-hydrogenase III large subunit	Energy production and conversion [C]	1.45
COG1086	NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsC	Cell wall/membrane/envelope biogenesis [M]	1.45
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	1.45
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	1.45
COG0702	Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domains	General function prediction only [R]	1.45
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	1.45
COG0665	Glycine/D-amino acid oxidase (deaminating)	Amino acid transport and metabolism [E]	1.45
COG0644	Dehydrogenase (flavoprotein)	Energy production and conversion [C]	1.45
COG0649	NADH:ubiquinone oxidoreductase 49 kD subunit (chain D)	Energy production and conversion [C]	1.45
COG0605	Superoxide dismutase	Inorganic ion transport and metabolism [P]	1.45
COG0578	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.45
COG3342	Uncharacterized conserved protein, Ntn-hydrolase superfamily	General function prediction only [R]	1.45
COG0451	Nucleoside-diphosphate-sugar epimerase	Cell wall/membrane/envelope biogenesis [M]	1.45
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	1.45
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	1.45
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	1.45
COG2009	Succinate dehydrogenase/fumarate reductase, cytochrome b subunit	Energy production and conversion [C]	0.72
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.72
COG5267	Uncharacterized conserved protein, DUF1800 family	Function unknown [S]	0.72
COG3734	2-keto-3-deoxy-galactonokinase	Carbohydrate transport and metabolism [G]	0.72
COG2142	Succinate dehydrogenase, hydrophobic anchor subunit	Energy production and conversion [C]	0.72
COG3346	Cytochrome oxidase assembly protein ShyY1	Posttranslational modification, protein turnover, chaperones [O]	0.72
COG2175	Taurine dioxygenase, alpha-ketoglutarate-dependent	Secondary metabolites biosynthesis, transport and catabolism [Q]	0.72
COG2180	Nitrate reductase assembly protein NarJ, required for insertion of molybdenum cofactor	Posttranslational modification, protein turnover, chaperones [O]	0.72
COG2511	Archaeal Glu-tRNAGln amidotransferase subunit E, contains GAD domain	Translation, ribosomal structure and biogenesis [J]	0.72
COG3114	Heme exporter protein D	Intracellular trafficking, secretion, and vesicular transport [U]	0.72
COG3156	Type II secretory pathway, component PulK	Intracellular trafficking, secretion, and vesicular transport [U]	0.72
COG3333	TctA family transporter	General function prediction only [R]	0.72
COG1089	GDP-D-mannose dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.72
COG0039	Malate/lactate dehydrogenase	Energy production and conversion [C]	0.72
COG0064	Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit	Translation, ribosomal structure and biogenesis [J]	0.72
COG0169	Shikimate 5-dehydrogenase	Amino acid transport and metabolism [E]	0.72
COG0216	Protein chain release factor RF1	Translation, ribosomal structure and biogenesis [J]	0.72
COG0496	Broad specificity polyphosphatase and 5'/3'-nucleotidase SurE	Replication, recombination and repair [L]	0.72
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.72
COG1087	UDP-glucose 4-epimerase	Cell wall/membrane/envelope biogenesis [M]	0.72
COG1088	dTDP-D-glucose 4,6-dehydratase	Cell wall/membrane/envelope biogenesis [M]	0.72
COG1905	NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)	Energy production and conversion [C]	0.72
COG1090	NAD dependent epimerase/dehydratase family enzyme	General function prediction only [R]	0.72
COG1091	dTDP-4-dehydrorhamnose reductase	Cell wall/membrane/envelope biogenesis [M]	0.72
COG1186	Protein chain release factor PrfB	Translation, ribosomal structure and biogenesis [J]	0.72
COG1282	NAD/NADP transhydrogenase beta subunit	Energy production and conversion [C]	0.72
COG1314	Protein translocase subunit SecG	Intracellular trafficking, secretion, and vesicular transport [U]	0.72
COG1486	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase	Carbohydrate transport and metabolism [G]	0.72
COG1784	TctA family transporter	General function prediction only [R]	0.72
COG1841	Ribosomal protein L30/L7E	Translation, ribosomal structure and biogenesis [J]	0.72

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	80.43 %
Unclassified	root	N/A	19.57 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	80.43 %
Unclassified	root	N/A	19.57 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	78.26 %
Unclassified	root	N/A	19.57 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.17 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	69.57 %
Unclassified	root	N/A	19.57 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	1.45 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	1.45 %
Sar	clade	All Organisms → cellular organisms → Eukaryota → Sar	0.72 %
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	0.72 %

Level 5

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	44.93 %
Unclassified	root	N/A	19.57 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8.70 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	1.45 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.72 %
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	0.72 %
Alveolata	clade	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata	0.72 %
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	0.72 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	11.59 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	7.97 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4.35 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1.45 %
Rhodocyclales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales	1.45 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	1.45 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.72 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	0.72 %
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	0.72 %
Dinophyceae	class	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae	0.72 %
Betaproteobacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis	0.72 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	3.62 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	1.45 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Candidatus Accumulibacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter	0.72 %
Cytophagia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia	0.72 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Zoogloeaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Suessiales	order	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %
Hyphomicrobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae	0.72 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	1.45 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	1.45 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Symbiodiniaceae	family	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae	0.72 %
Cytophagales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales	0.72 %
unclassified Candidatus Accumulibacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Azoarcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus	0.72 %
Prosthecomicrobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium	0.72 %
Ralstonia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	1.45 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
unclassified Azoarcus	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus	0.72 %
Flammeovirgaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Symbiodinium	genus	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium	0.72 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.72 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.72 %
Panarthropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda	0.72 %
Flexithrix	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Arthropoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Mandibulata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata	0.72 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Pancrustacea	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea	0.72 %
Tylenchina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Panagrolaimomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha	0.72 %
Hexapoda	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Strongyloidoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea	0.72 %
Insecta	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Strongyloididae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae	0.72 %
Dicondylia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Pterygota	subclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota	0.72 %
Parastrongyloides	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Palaeoptera	infraclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Ephemeroptera	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera	0.72 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Furcatergalia	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia	0.72 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Scapphodonta	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta	0.72 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Ephemeridae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae	0.72 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Ephemera	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera	0.72 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	19.57 %
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	7.97 %
Nitrosomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	1.45 %
Ephemera danica	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	0.72 %
Parastrongyloides trichosuri	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	0.72 %
Burkholderia pseudomallei 1710b	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	0.72 %
Flexithrix dorotheae	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	0.72 %
Symbiodinium necroappetens	species	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	0.72 %
Azoarcus sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	0.72 %
Ralstonia solanacearum	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	0.72 %
Prosthecomicrobium hirschii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	0.72 %
Candidatus Accumulibacter sp. SK-11	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	0.72 %
Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	0.72 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.72 %
Rhodospirillaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	0.72 %
Rhodocyclaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	0.72 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005543|Ga0070672_100022076	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4667
3300005543|Ga0070672_100045565	All Organisms → cellular organisms → Bacteria → Proteobacteria	3393
3300005560|Ga0066670_10019407	All Organisms → cellular organisms → Bacteria → Proteobacteria	3129
3300005561|Ga0066699_10034286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2978
3300005561|Ga0066699_10772724	All Organisms → cellular organisms → Bacteria	679
3300005576|Ga0066708_10096187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1752
3300005587|Ga0066654_10869211	Not Available	516
3300005598|Ga0066706_10564308	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium 13_1_20CM_4_70_13	904
3300005617|Ga0068859_100027879	Not Available	5663
3300005617|Ga0068859_100043962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4489
3300005618|Ga0068864_100334687	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1425
3300005840|Ga0068870_10011872	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4054
3300005841|Ga0068863_100100485	All Organisms → cellular organisms → Bacteria → Proteobacteria	2749
3300005843|Ga0068860_100043996	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4257
3300006032|Ga0066696_10651870	Not Available	680
3300006046|Ga0066652_101793457	Not Available	555
3300006057|Ga0075026_100880214	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	549
3300006172|Ga0075018_10654129	All Organisms → cellular organisms → Bacteria	564
3300006173|Ga0070716_101349982	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum	578
3300006175|Ga0070712_100457393	All Organisms → cellular organisms → Bacteria → Proteobacteria	1064
3300006797|Ga0066659_10784040	All Organisms → cellular organisms → Bacteria → Proteobacteria	787
3300009012|Ga0066710_100043824	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	5438
3300009012|Ga0066710_100106312	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3774
3300009038|Ga0099829_10994462	Not Available	696
3300009075|Ga0105090_10019243	All Organisms → cellular organisms → Bacteria → Proteobacteria	4185
3300009090|Ga0099827_10262514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1454
3300009090|Ga0099827_11179282	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	666
3300009090|Ga0099827_11790575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	535
3300009137|Ga0066709_100001202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	16536
3300009137|Ga0066709_100007401	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	9484
3300009137|Ga0066709_100176531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Azoarcus → unclassified Azoarcus → Azoarcus sp.	2774
3300009137|Ga0066709_100181974	All Organisms → cellular organisms → Bacteria	2737
3300009137|Ga0066709_100215046	All Organisms → cellular organisms → Bacteria → Proteobacteria	2539
3300009137|Ga0066709_100388733	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1931
3300009553|Ga0105249_10046572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3947
3300010880|Ga0126350_10898414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1061
3300011432|Ga0137428_1147002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	691
3300011444|Ga0137463_1096867	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1110
3300011445|Ga0137427_10479310	Not Available	511
3300012198|Ga0137364_10112917	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1928
3300012201|Ga0137365_10067323	All Organisms → cellular organisms → Bacteria → Proteobacteria	2701
3300012201|Ga0137365_10069774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2651
3300012201|Ga0137365_10775957	Not Available	700
3300012202|Ga0137363_10608840	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	922
3300012206|Ga0137380_10370709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae	1275
3300012206|Ga0137380_10450465	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1138
3300012206|Ga0137380_10675233	All Organisms → cellular organisms → Bacteria → Proteobacteria	898
3300012207|Ga0137381_10171220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1875
3300012207|Ga0137381_10256988	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → Flexithrix → Flexithrix dorotheae	1519
3300012207|Ga0137381_10433602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1147
3300012207|Ga0137381_10577946	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	979
3300012207|Ga0137381_10621766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	941
3300012208|Ga0137376_11414579	All Organisms → cellular organisms → Bacteria	586
3300012209|Ga0137379_10029661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5265
3300012209|Ga0137379_10137767	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2344
3300012209|Ga0137379_11068035	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	713
3300012210|Ga0137378_10023752	All Organisms → cellular organisms → Bacteria → Proteobacteria	5398
3300012210|Ga0137378_10024431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	5327
3300012210|Ga0137378_10047673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3848
3300012210|Ga0137378_10287903	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1528
3300012210|Ga0137378_10703567	All Organisms → cellular organisms → Bacteria → Proteobacteria	921
3300012349|Ga0137387_10065801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2457
3300012349|Ga0137387_10096588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2053
3300012350|Ga0137372_10022024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5947
3300012350|Ga0137372_10302244	Not Available	1240
3300012351|Ga0137386_10367162	Not Available	1036
3300012351|Ga0137386_10369952	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Palaeoptera → Ephemeroptera → Furcatergalia → Scapphodonta → Ephemeridae → Ephemera → Ephemera danica	1032
3300012354|Ga0137366_10506924	All Organisms → cellular organisms → Bacteria	871
3300012354|Ga0137366_10562053	All Organisms → cellular organisms → Bacteria → Proteobacteria	820
3300012356|Ga0137371_10142492	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1878
3300012356|Ga0137371_10873022	All Organisms → cellular organisms → Bacteria → Proteobacteria	684
3300012357|Ga0137384_10187119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	1733
3300012357|Ga0137384_10314894	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1300
3300012357|Ga0137384_11383271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	552
3300012358|Ga0137368_10089468	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2425
3300012359|Ga0137385_10060396	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae	3378
3300012359|Ga0137385_10716802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	835
3300012359|Ga0137385_11401698	All Organisms → cellular organisms → Bacteria	562
3300012361|Ga0137360_10943261	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	744
3300012684|Ga0136614_10090220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2324
3300012917|Ga0137395_10060739	All Organisms → cellular organisms → Bacteria → Proteobacteria	2410
3300012929|Ga0137404_10763896	Not Available	877
3300012971|Ga0126369_10104428	All Organisms → cellular organisms → Bacteria → Proteobacteria	2573
3300012977|Ga0134087_10744632	Not Available	524
3300014326|Ga0157380_13059667	All Organisms → cellular organisms → Bacteria → Proteobacteria	533
3300015371|Ga0132258_10013021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	17584
3300015371|Ga0132258_10080482	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	7595
3300015371|Ga0132258_10172966	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	5209
3300015371|Ga0132258_10180610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Prosthecomicrobium → Prosthecomicrobium hirschii	5099
3300015371|Ga0132258_10184341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5049
3300015371|Ga0132258_10467607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3147
3300017930|Ga0187825_10012642	All Organisms → cellular organisms → Bacteria → Proteobacteria	2827
3300018071|Ga0184618_10020680	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2152
3300018071|Ga0184618_10056015	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1447
3300018083|Ga0184628_10040638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	2335
3300018431|Ga0066655_10562986	Not Available	763
3300018431|Ga0066655_10920320	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Strongyloididae → Parastrongyloides → Parastrongyloides trichosuri	599
3300018431|Ga0066655_10927560	Not Available	597
3300018431|Ga0066655_11329152	All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium necroappetens	517
3300018482|Ga0066669_10031646	All Organisms → cellular organisms → Bacteria → Proteobacteria	3132
3300018482|Ga0066669_10126332	All Organisms → cellular organisms → Bacteria	1833
3300020004|Ga0193755_1171442	All Organisms → cellular organisms → Bacteria → Proteobacteria	643
3300020006|Ga0193735_1010038	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	2982
3300021478|Ga0210402_10017129	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales	6214
3300021478|Ga0210402_11106762	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	719
3300022756|Ga0222622_11253142	Not Available	546
3300025910|Ga0207684_10009323	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	8673
3300025922|Ga0207646_10127808	All Organisms → cellular organisms → Bacteria	2286
3300025922|Ga0207646_10311629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1422
3300025922|Ga0207646_10507326	Not Available	1086
3300026088|Ga0207641_12269512	All Organisms → cellular organisms → Bacteria → Proteobacteria	542
3300026089|Ga0207648_10013019	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	7760
3300026320|Ga0209131_1016274	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	4534
3300026320|Ga0209131_1348998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	550
3300026326|Ga0209801_1144775	Not Available	1005
3300026334|Ga0209377_1175934	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	759
3300026523|Ga0209808_1181199	Not Available	746
3300026523|Ga0209808_1322876	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	500
3300026550|Ga0209474_10046618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	3125
3300027775|Ga0209177_10284595	Not Available	624
3300030339|Ga0311360_10482861	Not Available	994
3300031521|Ga0311364_10638406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. SK-11	1073
3300031996|Ga0308176_12153869	Not Available	595
3300032397|Ga0315287_10119602	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3015
3300032397|Ga0315287_12480269	Not Available	557
3300033433|Ga0326726_10003389	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	14627
3300033433|Ga0326726_10011616	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	7763
3300033433|Ga0326726_10016808	All Organisms → cellular organisms → Bacteria	6367
3300033433|Ga0326726_10080788	All Organisms → cellular organisms → Bacteria → Proteobacteria	2881
3300034090|Ga0326723_0166920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	970
3300034090|Ga0326723_0349050	Not Available	668
3300034115|Ga0364945_0270502	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b	526
3300034150|Ga0364933_098769	All Organisms → cellular organisms → Bacteria → Proteobacteria	738

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	86.96%
Host-Associated	Host-Associated	13.04%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	74.64%
Plants	Host-Associated → Plants	13.04%
Aquatic	Environmental → Aquatic	12.32%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	67.39%
Rhizoplane	Host-Associated → Plants → Rhizoplane	10.14%
Sediment	Environmental → Aquatic → Sediment	7.25%
Peat	Environmental → Terrestrial → Peat	5.80%
Freshwater	Environmental → Aquatic → Freshwater	5.07%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.90%
Floodplain	Environmental → Terrestrial → Floodplain	1.45%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	63.04%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.25%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	5.80%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	5.80%
Loam	Environmental → Terrestrial → Soil → Loam	4.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	4.35%
Lake	Environmental → Aquatic → Freshwater → Lake	2.17%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	1.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.45%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.45%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.72%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.72%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.72%
Ice	Environmental → Aquatic → Freshwater → Ice	0.72%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	37.68%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	22.46%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.25%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	5.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	5.80%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	4.35%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.17%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.45%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	1.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.45%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.45%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.72%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.72%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	0.72%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	0.72%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.72%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	0.72%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	33.33%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	11.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	10.87%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.35%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	4.35%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.35%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.35%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.90%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.17%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	2.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.17%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.45%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.45%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	1.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.45%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.45%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.72%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.72%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	0.72%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	0.72%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.72%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.72%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.72%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	0.72%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	0.72%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.72%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.72%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental
3300005587	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103	Environmental
3300005598	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155	Environmental
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006057	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012	Environmental
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006797	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009075	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental
3300011398	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2	Environmental
3300011432	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2	Environmental
3300011444	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2	Environmental
3300011445	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2	Environmental
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012201	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012206	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012209	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012350	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG	Environmental
3300012351	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG	Environmental
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental
3300012358	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG	Environmental
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012684	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300019882	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2	Environmental
3300020004	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2	Environmental
3300020006	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2	Environmental
3300021478	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M	Environmental
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental
3300026326	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)	Environmental
3300026334	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)	Environmental
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental
3300026547	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)	Environmental
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental
3300027902	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)	Environmental
3300030339	III_Bog_N1 coassembly	Environmental
3300031521	III_Fen_E2 coassembly	Environmental
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032397	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0	Environmental
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental
3300034115	Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17	Environmental
3300034150	Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070672_1000220764	3300005543	Miscanthus Rhizosphere	MSAAGPSQGAKGAPSGGSAAAELTNETASVGVVR*
Ga0070672_1000455652	3300005543	Miscanthus Rhizosphere	MTMSAAGPSQGANCAPFGGSAAAELANEAASVGVQ*
Ga0066670_100194072	3300005560	Soil	MSDMSAAGPSQGAHCSPSGGSAAAELINEAASVGVV*
Ga0066699_100342864	3300005561	Soil	MSAAGPSQGANSSPSGGSAAAEWVNEAASVGAHI*
Ga0066699_107727242	3300005561	Soil	MSAAGPPQGANCSPAFGGSAAAELVNEAASVGVHK*
Ga0066708_100961872	3300005576	Soil	RDAGGKRMSAAEPYHYAGAPAFGGSAAAELATQLANEAASVGVVP*
Ga0066654_108692111	3300005587	Soil	MSAAGPPQGANFAPTGGSAAAEFANEAASVGVHICAAG
Ga0066706_105643082	3300005598	Soil	MSAAGPPQGANCAPAFGGSAAAEWVNEAASVGAHP
Ga0068859_1000278792	3300005617	Switchgrass Rhizosphere	MSAAGPLQGAHGSPSGGSDAAEWANEAASVGALK*
Ga0068859_1000439621	3300005617	Switchgrass Rhizosphere	QMSAAGPPQGANSAPSGGSAAAELDNEAASVEAHR*
Ga0068864_1003346872	3300005618	Switchgrass Rhizosphere	MSAMSAAGPPQGANCSPSGGSEAAELDNAAASVGVQ*
Ga0068870_100118723	3300005840	Miscanthus Rhizosphere	MSAAGPSQGANSSPSGGSVAAEFVYEAASVGALQ*
Ga0068863_1001004852	3300005841	Switchgrass Rhizosphere	MSAAGPSQGANSSPSGGSVAAEFVYAAASAGALQ*
Ga0068860_1000439965	3300005843	Switchgrass Rhizosphere	MSAAGPPQGANSAPSGGSAAAELDNEAASVEAHR*
Ga0066696_106518702	3300006032	Soil	MSAAGPPQGANCAPAFGGSAAAELANELANEAASVGVHQ*
Ga0066652_1017934572	3300006046	Soil	MSAAEPFHGAGAPSFGGSAAVDLANELANEAASVGVHS
Ga0075026_1008802142	3300006057	Watersheds	MSTTLSAIMSAAGPPEGANRSPSGGSAAAEWVNEAAGVGAVI*
Ga0075018_106541291	3300006172	Watersheds	ASKDTGGIRVMSADGPPQGANCSAPGGSAAAEWANEAASVGAHQ*
Ga0070716_1013499821	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	HMSAAGPPQGANSAPTEGSAAAALANPAASVGGP*
Ga0070712_1004573931	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MSGAGPSQAASCAPNGGSAAAERANEAASVGVLK*
Ga0066659_107840401	3300006797	Soil	GRLRDAEVEFMSAAGPPQGANCSPAFGGSAAAELANEAASVGVQ*
Ga0066710_1000438242	3300009012	Grasslands Soil	MSAAGPPQSANCAPAFGGSAAAEWVNEAASVGVVA
Ga0066710_1001063123	3300009012	Grasslands Soil	MSAAGPPQGANCSPAFGGSAAAEWVNEAASVGVLT
Ga0099829_109944622	3300009038	Vadose Zone Soil	MSAAEPFHGAGAPSGGSAAVELANELAHEAASVGVLP*
Ga0105090_100192434	3300009075	Freshwater Sediment	MSAAGPSQGANRAPSGGSAAAEWVNEAASVGAHQ*
Ga0099827_102625142	3300009090	Vadose Zone Soil	MSAAEPYHCAGAPALGGSAAAELANELANEAASVGAQQ*
Ga0099827_111792821	3300009090	Vadose Zone Soil	MAMSAAEPYHCAGAPAFGGSAAGELVNEAASVGVLQ*
Ga0099827_117905752	3300009090	Vadose Zone Soil	MSAAEPFHGAGAPVFRGSAAAEFVNEAASVGVHP*
Ga0066709_10000120213	3300009137	Grasslands Soil	MSDAGPPQGANCAPAFGGSAAAEFANEAASVGAQ*
Ga0066709_1000074019	3300009137	Grasslands Soil	MSAAGPPQGANFAPTGGSAAAEFANEAASLGVQS*
Ga0066709_1001765312	3300009137	Grasslands Soil	MSAAEPYHCAGAPAFGGSAAAELANEAASVGVLP*
Ga0066709_1001819744	3300009137	Grasslands Soil	MSAAEPFHGAGTPAFGGSAAAELINEAASVGAHQ*
Ga0066709_1002150464	3300009137	Grasslands Soil	MSAAGPPQGANCSPALGGSAAAELANELSNEAASVGAHQ*
Ga0066709_1003887332	3300009137	Grasslands Soil	MSAAEPFHGAGAPSFGGSAAVDLANELANEAASVGVHS*
Ga0105249_100465724	3300009553	Switchgrass Rhizosphere	MSAAGPSQGANSSPSGGSVAAEFVYAAASAGALR*
Ga0126350_108984141	3300010880	Boreal Forest Soil	MSAAGPPQGANCAPAFGGSAAAELANEAASVGVQS
Ga0137348_10768392	3300011398	Soil	MSAAGPSQGANCSPAGGSEAASAASVGGTYRAAGPS
Ga0137428_11470022	3300011432	Soil	MSAAGPPQGANCAPPGGSAAASLANEAASVGAHQIGIG
Ga0137463_10968672	3300011444	Soil	MSTAGLPQGANCSPSGGSAAAELAAELATELANKAASVGAQ*
Ga0137427_104793101	3300011445	Soil	MDIAMSAAGPSQGANYSPSGGSAAAELANEAATVG
Ga0137364_101129171	3300012198	Vadose Zone Soil	MSAAGPSQGANYSPPGGSAAATAASVGVYLDPPALGFGTL
Ga0137365_100673236	3300012201	Vadose Zone Soil	MSAAEPSHGAGAPAFEGSAAAELANEAASVGVHQ*
Ga0137365_100697745	3300012201	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAAELANEAASVGVNDSD*
Ga0137365_107759572	3300012201	Vadose Zone Soil	GMSAAGPPQGANCAPAFGGSAAAELAKEAASVRVHMSVGARA*
Ga0137363_106088401	3300012202	Vadose Zone Soil	MSAAEPFHGVGAPAFGGGAAAELATQLANEAASVGVVP*
Ga0137380_103707092	3300012206	Vadose Zone Soil	MSAAEPFHGAGAPALAGSAAAELVNEAASVGVHL*
Ga0137380_104504652	3300012206	Vadose Zone Soil	MSAAERPHGAGAPYRGSAAAELVNELAKEAASVGVQQ*
Ga0137380_106752332	3300012206	Vadose Zone Soil	MARSSLMSATEPFHGAGAPAFGGSAAAELANEAASVGV
Ga0137381_101712202	3300012207	Vadose Zone Soil	MSAAEPFHGADAPAFGASAAAELATQLATQLANEAASVGVVP*
Ga0137381_102569882	3300012207	Vadose Zone Soil	VLGDPPTVMSAAGPPQGANGAPAFGGSAAAELSNEAASVGVQ*
Ga0137381_104336022	3300012207	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAAELVNEAANVGVHQ*
Ga0137381_105779463	3300012207	Vadose Zone Soil	MSAPGPPQGVNCAPAFGGSAAAEFNEAASGGGYFHER
Ga0137381_106217661	3300012207	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAPQLANELANEAASVRVVP*
Ga0137376_114145791	3300012208	Vadose Zone Soil	MSAAGPSQGANYSPFGGRGQSVAAELANEAASVGVR*
Ga0137379_100296615	3300012209	Vadose Zone Soil	MSATEPFHGAGAPAFGGSAAAELANEAASVGVLP*
Ga0137379_101377672	3300012209	Vadose Zone Soil	MSAAEPLHGAGTPAFGGSAAAELDNEAASVGVHQ*
Ga0137379_110680352	3300012209	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAAQLANELANEAASVGVH
Ga0137378_100237522	3300012210	Vadose Zone Soil	MSAADPFYGAGTPAFGGSAAAELTTQLTNEAASVGVLQ*
Ga0137378_100244313	3300012210	Vadose Zone Soil	MSAAESLHGAGTPAFGGSAAAELANELATEAASVGGHQ*
Ga0137378_100476732	3300012210	Vadose Zone Soil	MSAAGPPQGANCAPAFGGSAAAELANEAASVGVHQ*
Ga0137378_102879031	3300012210	Vadose Zone Soil	MSGNMSAAGLSQGANCAPAFGGSAAAELVNEAASVGVHQ*
Ga0137378_107035672	3300012210	Vadose Zone Soil	VEAEADMNTAGPPQGVNCAPAFGGSAAAELANELANEAASVGVLP*
Ga0137387_100658014	3300012349	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAAELVSEAASVGALQ*
Ga0137387_100965882	3300012349	Vadose Zone Soil	MSAAEPFHGAGAPAVGGSATAELSTQLANEAASVGVVP*
Ga0137372_100220247	3300012350	Vadose Zone Soil	MSAAEPSRGAGAPAFGGSAAAQLANELANEAASVGVH*
Ga0137372_103022441	3300012350	Vadose Zone Soil	MSAAGPPQGANCTPFGGSAAAELANEAASVGEHICAA
Ga0137386_103671623	3300012351	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAAELVSEAASVGVHQ*
Ga0137386_103699521	3300012351	Vadose Zone Soil	MSAAGPPQGANCAPLGGSAAAEVANELANEAASVG
Ga0137366_105069242	3300012354	Vadose Zone Soil	MSAAEPFHGAGAPAFGGSAAAELANEAASVGVNDRD*
Ga0137366_105620532	3300012354	Vadose Zone Soil	MARSNLMSATEPPQGANCAPAFGGSAAAELANEAASVGV
Ga0137371_101424922	3300012356	Vadose Zone Soil	MSAAERFHGAGAPAFGGSAAAELSNEAASVGVVA*
Ga0137371_108730221	3300012356	Vadose Zone Soil	MSAAEPPQGANCAPAFGGSAAAELANEAASVGVHICAA
Ga0137384_101871193	3300012357	Vadose Zone Soil	MSAAGPPQGANGAPAFGGSAAAEFANEAASVGVHP
Ga0137384_103148943	3300012357	Vadose Zone Soil	MSATERFHGAGAPAFGGSAAAELANEATSVGVLP*
Ga0137384_113832712	3300012357	Vadose Zone Soil	RAAGPPQGASCAPSGGSAAAKLANEWVNEAASVGVHH*
Ga0137368_100894683	3300012358	Vadose Zone Soil	MSAAGPPQGANCAPSGGSAEAELANKASVGVHQDALL
Ga0137385_100603962	3300012359	Vadose Zone Soil	MSAAERFHGAGAPAFGGSAAAELSNEAASVGVVP*
Ga0137385_107168021	3300012359	Vadose Zone Soil	IHENFFLFVEAEADMNAAGPPQGVNCAPAFGGSAAAEFNEAASVGVLP*
Ga0137385_114016981	3300012359	Vadose Zone Soil	YIRRIMSAAGPPQGANCAPAFGGSVAAEWVNEAASVGVV*
Ga0137360_109432612	3300012361	Vadose Zone Soil	MSAAEPFHGAGARAFGGSTAAELVNEAASVGVLT*
Ga0136614_100902203	3300012684	Polar Desert Sand	MSDAEPSQGANYSHSGGSAAAAELANEAASVGGP*
Ga0137395_100607394	3300012917	Vadose Zone Soil	MSAAEPYDGAGAPAFGGSAAAELTNEAASVGGLP*
Ga0137404_107638961	3300012929	Vadose Zone Soil	MSAGGPPQGANCAPFGGSAAAELANEAASVGVHHRAEEI
Ga0126369_101044284	3300012971	Tropical Forest Soil	MSAAGPSQGANCAPAFGGSAAAELINEAASVGVL*
Ga0134087_107446322	3300012977	Grasslands Soil	MSAAGPPQGANCSPALGGSAAAELANELSNEAASVG
Ga0157380_130596672	3300014326	Switchgrass Rhizosphere	VMSAAGPSQGANCSPSGGSAAAELANEAASVGAVQ*
Ga0132258_100130211	3300015371	Arabidopsis Rhizosphere	MSAAGPSQGANWSPSGGSEAAELDNEAASVGVHP*
Ga0132258_100804824	3300015371	Arabidopsis Rhizosphere	MSAAWPSQGANCFPLGGSAAAELANEAASVGAHR*
Ga0132258_101729664	3300015371	Arabidopsis Rhizosphere	MSGEGPRRGANYAPFGGSAAAELANEAASVGVDP*
Ga0132258_101806103	3300015371	Arabidopsis Rhizosphere	MSAAGPSQGANCSPSGGSAAAELANEAASVGAVK*
Ga0132258_101843412	3300015371	Arabidopsis Rhizosphere	MSAAGPSQGANYAPSGGSAAAELINEAASVGVQL*
Ga0132258_104676073	3300015371	Arabidopsis Rhizosphere	MSAAGPSQGANSAPSGGSAAAEFDNEAASVGANR*
Ga0187825_100126421	3300017930	Freshwater Sediment	MSAAGPPQGAHCAPAFGGSVAAELADEAASVGVLE
Ga0184618_100206806	3300018071	Groundwater Sediment	KNMRTSMNTMSAAGPSQGANCSPYGGSEAAKAASVGGPK
Ga0184618_100560154	3300018071	Groundwater Sediment	MSAAGPSQGANSTPSGGSAAAELTNEAASVGTHQSA
Ga0184628_100406382	3300018083	Groundwater Sediment	MGVMSAAGPSQGENCPHSGSSAAAELDNEAAGMGVV
Ga0066655_105629862	3300018431	Grasslands Soil	AGMSAAGPPQGANGAHAVGGSAAAELINEAASVGVV
Ga0066655_109203202	3300018431	Grasslands Soil	MSAAGPPRGANWSPDFGGSAAAELANEAASVRVHE
Ga0066655_109275602	3300018431	Grasslands Soil	MSAAGPSQGANCAPAFGGSAAAELTNEAGSVGVLP
Ga0066655_113291521	3300018431	Grasslands Soil	MRLSAAGPSQGARAPSGGSAAAELATELANEAASV
Ga0066669_100316462	3300018482	Grasslands Soil	MSADGPSRGANCVPSGGSEAAELVNEAASVGAVHHARMQP
Ga0066669_101263323	3300018482	Grasslands Soil	MTAMSAAGPPQGANCSPAFEGSAAAEWVNEAASVGVV
Ga0193713_11938192	3300019882	Soil	MSTAGPPQGANSAPFGGSAAASAASVGVVNRTAGPPQAAGLRA
Ga0193755_11714421	3300020004	Soil	MVSAAGPPQGANNSPSGRSAAAELDNEAASVGVPSE
Ga0193735_10100384	3300020006	Soil	MSAAGPSQGVNYSPFGGRGQSVAAELANEAASVGDQP
Ga0210402_100171292	3300021478	Soil	MSAAGPPQGANRSPAFGGSAAAQLATEWANEAASVGAQQ
Ga0210402_111067622	3300021478	Soil	MSAAGPPQGANCAPAFGGSAAAELANELANEAASVGAHQ
Ga0222622_112531421	3300022756	Groundwater Sediment	MSAAGPPQGANSSPSGGSAAASAASVGAHFRVEDRHFED
Ga0207684_100093239	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MSMSAAEPSHGVGAPPFGGSAEAELANEAASVGVHQ
Ga0207646_101278082	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MSAAGPPQGANCALAFGGSAAAELVNEAASVGVHI
Ga0207646_103116292	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	MSAAEPFHGAGAPAFGGSAAAELANELANEAASVGVQ
Ga0207646_105073261	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	RKAAGMSMSAAEPSHGVGAPAFGGSAEAELANEAASVGVHQ
Ga0207641_122695122	3300026088	Switchgrass Rhizosphere	MSGAGPPQAANGAPSGGSAAAPAASVGAVPVPLLEVSG
Ga0207648_100130193	3300026089	Miscanthus Rhizosphere	MTMSAAGPSQGANCAPFGGSAAAELANEAASVGVQ
Ga0209131_10162744	3300026320	Grasslands Soil	MSAAGPSQGANYAPAFGGSAAAELTNEAASMGVHQ
Ga0209131_13489981	3300026320	Grasslands Soil	LHAMSAAEPFHGAGAPSGGSAAPELVNETASVGVL
Ga0209801_11447751	3300026326	Soil	GELMSAAEPYHCAGAPAFGGSAAAQLANELANEAASVEVLP
Ga0209377_11759341	3300026334	Soil	VEAEAHMNAAGPPHGVNCAPAFGGSAAAEFNEAASVGVLP
Ga0209808_11811991	3300026523	Soil	YGMSAAGPPQGANCSPAFGGSAAAELANELANEAASVGVHQ
Ga0209808_13228762	3300026523	Soil	GGKRMSAAEPYHCAGAPAFGGSAAAELATQLANEAASVGVVP
Ga0209156_101098391	3300026547	Soil	MSAAGPPQGANSAPAFGGSAAAEWVNEAASVGVHICAAGPPQG
Ga0209474_100466181	3300026550	Soil	MSGAGPSQAANCAPAFGGSAAAELSTQLANEAASVGAHQ
Ga0209177_102845952	3300027775	Agricultural Soil	DMRAAGPPQGAHGAPAGGSAAAELANEAASVGALS
Ga0209048_1000232817	3300027902	Freshwater Lake Sediment	MNAAEPSQGAHRAPSGGSAAASFSLAASVGVQLSAAE
Ga0311360_104828612	3300030339	Bog	MSDVNMSAAGLSQGANRAPSGGSAAAKAASVGVQL
Ga0311364_106384061	3300031521	Fen	MSAAGPSQGANSSPSGGSAAAKLCLGASVGAHHLLHILH
Ga0308176_121538691	3300031996	Soil	GPMSDAGPSQAANCAPSGGSEAAESANEAASVGVR
Ga0315287_101196024	3300032397	Sediment	MSAAGPSQGANGAPPGGSAAAELANEAASVGAHQRA
Ga0315287_116058621	3300032397	Sediment	MSAAGPPQGANGAPTGGKTAAPAASVGAVRSAPVLQ
Ga0315287_124802692	3300032397	Sediment	MTGPVSAAGPSQGANYAPSGGSAAAKAASVGAHISEP
Ga0326726_1000338911	3300033433	Peat Soil	MSAAEPFHGAGAPDSGGSAAAQFAKLVANEAASVGVQ
Ga0326726_100116161	3300033433	Peat Soil	MSAAEPFHGAGAPSGGSAAAELANELANEAASVGVL
Ga0326726_100168082	3300033433	Peat Soil	MSAAEPLQGAGAPAFGGSAAAQLANELATQLANEAASVGVVP
Ga0326726_100807884	3300033433	Peat Soil	MSAAEPYHCAGAPAFGGSAAAELANELAKEAASVGVHP
Ga0326723_0166920_862_969	3300034090	Peat Soil	AVSAAGSPQGANRAPSGGSAAAELANEAASVGVHQ
Ga0326723_0349050_561_668	3300034090	Peat Soil	MSAAEPYHCAGAPAFGGSAAAELANELANEAASVGV
Ga0364945_0270502_1_108	3300034115	Sediment	MTTPKFRAAGPPQGANSAPSGGSAAAESTNEAASVG
Ga0364933_098769_1_108	3300034150	Sediment	MSNTIRAAGPPQGANCAPSGGSAAARAASVGVVTPS