NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F055550

Metagenome Family F055550

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F055550
Family Type Metagenome
Number of Sequences 138
Average Sequence Length 48 residues
Representative Sequence KQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Number of Associated Samples 112
Number of Associated Scaffolds 138

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.74 %
% of genes near scaffold ends (potentially truncated) 94.20 %
% of genes from short scaffolds (< 2000 bps) 81.16 %
Associated GOLD sequencing projects 105
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (76.812 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake
(15.942 % of family members)
Environment Ontology (ENVO) Unclassified
(60.145 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(60.145 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.77%    β-sheet: 0.00%    Coil/Unstructured: 66.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 138 Family Scaffolds
PF04860Phage_portal 55.80
PF01391Collagen 7.25
PF04586Peptidase_S78 2.90
PF01844HNH 1.45
PF13641Glyco_tranf_2_3 0.72
PF05135Phage_connect_1 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 138 Family Scaffolds
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 2.90


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.03 %
UnclassifiedrootN/A7.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002200|metazooDRAFT_1266460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage628Open in IMG/M
3300002306|B570J29618_1009971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage593Open in IMG/M
3300002408|B570J29032_109417889All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.749Open in IMG/M
3300002408|B570J29032_109780596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1299Open in IMG/M
3300002835|B570J40625_101616960All Organisms → cellular organisms → Bacteria → Proteobacteria529Open in IMG/M
3300003411|JGI25911J50253_10163022All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.633Open in IMG/M
3300003490|JGI25926J51410_1056856All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage667Open in IMG/M
3300004096|Ga0066177_10416625All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300004123|Ga0066181_10089433All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300004128|Ga0066180_10350215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.584Open in IMG/M
3300005525|Ga0068877_10207436All Organisms → cellular organisms → Bacteria1170Open in IMG/M
3300005527|Ga0068876_10013510All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5293Open in IMG/M
3300005527|Ga0068876_10084869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1897Open in IMG/M
3300005584|Ga0049082_10090816All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300005662|Ga0078894_10199239All Organisms → Viruses → Predicted Viral1812Open in IMG/M
3300005805|Ga0079957_1285994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.748Open in IMG/M
3300006802|Ga0070749_10507160All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage657Open in IMG/M
3300006805|Ga0075464_10803325All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.585Open in IMG/M
3300006863|Ga0075459_1024146All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1014Open in IMG/M
3300006863|Ga0075459_1054831All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes673Open in IMG/M
3300007363|Ga0075458_10124902All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.799Open in IMG/M
3300007363|Ga0075458_10265811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes521Open in IMG/M
3300007516|Ga0105050_10536181All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.688Open in IMG/M
3300007559|Ga0102828_1137838All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.608Open in IMG/M
3300007627|Ga0102869_1142244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.648Open in IMG/M
3300007642|Ga0102876_1158208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.605Open in IMG/M
3300008055|Ga0108970_11052060All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.831Open in IMG/M
3300008108|Ga0114341_10013249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage11027Open in IMG/M
3300008110|Ga0114343_1166604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.682Open in IMG/M
3300008111|Ga0114344_1007057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4770Open in IMG/M
3300008111|Ga0114344_1007917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5558Open in IMG/M
3300008116|Ga0114350_1098100All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.932Open in IMG/M
3300008262|Ga0114337_1010833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6159Open in IMG/M
3300008263|Ga0114349_1006036All Organisms → cellular organisms → Bacteria11569Open in IMG/M
3300008266|Ga0114363_1136770All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.830Open in IMG/M
3300008266|Ga0114363_1232197Not Available536Open in IMG/M
3300008450|Ga0114880_1041809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1985Open in IMG/M
3300009085|Ga0105103_10408350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.752Open in IMG/M
3300009152|Ga0114980_10031443All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3280Open in IMG/M
3300009152|Ga0114980_10473496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes715Open in IMG/M
3300009155|Ga0114968_10335923All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.837Open in IMG/M
3300009155|Ga0114968_10413483Not Available734Open in IMG/M
3300009158|Ga0114977_10099698All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1762Open in IMG/M
3300009163|Ga0114970_10222118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1103Open in IMG/M
3300009163|Ga0114970_10521099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.647Open in IMG/M
3300009164|Ga0114975_10106662All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1619Open in IMG/M
3300009169|Ga0105097_10197285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1108Open in IMG/M
3300009170|Ga0105096_10543637All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.607Open in IMG/M
3300009180|Ga0114979_10082259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1998Open in IMG/M
3300009184|Ga0114976_10188916All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1139Open in IMG/M
3300010160|Ga0114967_10558770Not Available553Open in IMG/M
3300010354|Ga0129333_10132490All Organisms → Viruses → Predicted Viral2292Open in IMG/M
3300010354|Ga0129333_10724651All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage853Open in IMG/M
3300010370|Ga0129336_10122480All Organisms → Viruses → Predicted Viral1515Open in IMG/M
3300010370|Ga0129336_10296552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.900Open in IMG/M
3300010370|Ga0129336_10627340All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage572Open in IMG/M
3300010885|Ga0133913_11560521All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1668Open in IMG/M
3300010885|Ga0133913_13565746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1012Open in IMG/M
3300013005|Ga0164292_11068136Not Available501Open in IMG/M
(restricted) 3300013126|Ga0172367_10032065All Organisms → cellular organisms → Bacteria4558Open in IMG/M
3300013372|Ga0177922_10247284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.689Open in IMG/M
3300013372|Ga0177922_11102007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.884Open in IMG/M
3300014050|Ga0119952_1130222Not Available557Open in IMG/M
3300017722|Ga0181347_1140372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.665Open in IMG/M
3300017723|Ga0181362_1124524All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.504Open in IMG/M
3300017774|Ga0181358_1256963All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.547Open in IMG/M
3300017778|Ga0181349_1068683All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1363Open in IMG/M
3300019784|Ga0181359_1060999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1444Open in IMG/M
3300019784|Ga0181359_1076509All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300020190|Ga0194118_10063935All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2361Open in IMG/M
3300020530|Ga0208235_1023381All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300020536|Ga0207939_1001798All Organisms → cellular organisms → Bacteria4923Open in IMG/M
3300020539|Ga0207941_1021501All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.948Open in IMG/M
3300020557|Ga0208231_1042193All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300020570|Ga0208465_1035461All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.639Open in IMG/M
3300021956|Ga0213922_1102470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.577Open in IMG/M
3300021962|Ga0222713_10037287All Organisms → cellular organisms → Bacteria3837Open in IMG/M
3300021963|Ga0222712_10549873All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.674Open in IMG/M
3300022407|Ga0181351_1206089All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.652Open in IMG/M
3300023174|Ga0214921_10085781All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2455Open in IMG/M
3300023179|Ga0214923_10197753All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1189Open in IMG/M
3300024262|Ga0210003_1110710All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1232Open in IMG/M
3300024346|Ga0244775_10466103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1034Open in IMG/M
3300024346|Ga0244775_11001263All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300025687|Ga0208019_1109192All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage836Open in IMG/M
3300025896|Ga0208916_10210031All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage843Open in IMG/M
3300025896|Ga0208916_10389956All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes608Open in IMG/M
3300027138|Ga0255064_1005955All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2293Open in IMG/M
3300027492|Ga0255093_1054773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300027631|Ga0208133_1105143All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300027644|Ga0209356_1086502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage927Open in IMG/M
3300027707|Ga0209443_1114981All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.1007Open in IMG/M
3300027733|Ga0209297_1092028All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1309Open in IMG/M
3300027734|Ga0209087_1012552All Organisms → cellular organisms → Bacteria4293Open in IMG/M
3300027736|Ga0209190_1189219All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300027744|Ga0209355_1046431All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2123Open in IMG/M
3300027756|Ga0209444_10105756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1142Open in IMG/M
3300027764|Ga0209134_10262039All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.591Open in IMG/M
3300027782|Ga0209500_10132875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1191Open in IMG/M
3300027785|Ga0209246_10272967All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300027797|Ga0209107_10533343All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.517Open in IMG/M
3300027899|Ga0209668_10559170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.762Open in IMG/M
3300027963|Ga0209400_1025216All Organisms → cellular organisms → Bacteria3396Open in IMG/M
3300027963|Ga0209400_1245841All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage712Open in IMG/M
3300027969|Ga0209191_1097660All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1257Open in IMG/M
3300027973|Ga0209298_10066999All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1628Open in IMG/M
3300027973|Ga0209298_10271248All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.670Open in IMG/M
3300028025|Ga0247723_1000358All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage31485Open in IMG/M
3300028025|Ga0247723_1008519All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4218Open in IMG/M
(restricted) 3300028569|Ga0247843_1156064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage929Open in IMG/M
3300031758|Ga0315907_10007594All Organisms → cellular organisms → Bacteria11282Open in IMG/M
3300031758|Ga0315907_10382429All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1138Open in IMG/M
3300031857|Ga0315909_10329907All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1125Open in IMG/M
3300031951|Ga0315904_10091869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3216Open in IMG/M
3300031951|Ga0315904_11018303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage655Open in IMG/M
3300031963|Ga0315901_10278936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1396Open in IMG/M
3300031963|Ga0315901_10729525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage729Open in IMG/M
3300032092|Ga0315905_10631652Not Available962Open in IMG/M
3300032093|Ga0315902_10508417All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1045Open in IMG/M
3300032116|Ga0315903_10408336All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1103Open in IMG/M
3300033981|Ga0334982_0190215All Organisms → Viruses → Predicted Viral1021Open in IMG/M
3300033996|Ga0334979_0165767All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1325Open in IMG/M
3300034012|Ga0334986_0016951All Organisms → cellular organisms → Bacteria5039Open in IMG/M
3300034019|Ga0334998_0385743All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage808Open in IMG/M
3300034020|Ga0335002_0324922All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage886Open in IMG/M
3300034061|Ga0334987_0170518All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1567Open in IMG/M
3300034061|Ga0334987_0631099Not Available627Open in IMG/M
3300034062|Ga0334995_0069297All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2784Open in IMG/M
3300034071|Ga0335028_0173499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1355Open in IMG/M
3300034101|Ga0335027_0652080All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.632Open in IMG/M
3300034106|Ga0335036_0438861All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.829Open in IMG/M
3300034106|Ga0335036_0750442Not Available571Open in IMG/M
3300034106|Ga0335036_0892114All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.505Open in IMG/M
3300034107|Ga0335037_0073025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1856Open in IMG/M
3300034112|Ga0335066_0595938All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp.572Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater15.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake15.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake15.94%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton7.25%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater7.25%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous6.52%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.62%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.62%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater2.90%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.17%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.17%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.17%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.17%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.45%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.45%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment1.45%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.72%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.72%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment0.72%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.72%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.72%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.72%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.72%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002200Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013EnvironmentalOpen in IMG/M
3300002306Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300003490Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300004096Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2)EnvironmentalOpen in IMG/M
3300004123Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2)EnvironmentalOpen in IMG/M
3300004128Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300007363Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNAEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007642Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3EnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008108Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008263Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTREnvironmentalOpen in IMG/M
3300008266Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009085Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009163Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaGEnvironmentalOpen in IMG/M
3300009164Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaGEnvironmentalOpen in IMG/M
3300009169Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009180Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaGEnvironmentalOpen in IMG/M
3300009184Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaGEnvironmentalOpen in IMG/M
3300010160Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014050Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007BEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020530Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020536Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020539Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020557Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021956Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MGEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023174Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025896Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027138Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300027492Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8dEnvironmentalOpen in IMG/M
3300027631Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027707Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes)EnvironmentalOpen in IMG/M
3300027733Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027734Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027756Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027782Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027797Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300027963Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027969Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300028025Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FCEnvironmentalOpen in IMG/M
3300028569 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8mEnvironmentalOpen in IMG/M
3300031758Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032093Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033996Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034071Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
metazooDRAFT_126646033300002200LakeRRKVDAAVAAIFGYDRATQPPPPKAPVAKFFSIQV*
B570J29618_100997133300002306FreshwaterANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPAPKEPVAKYFSIQV*
B570J29032_10941788933300002408FreshwaterRHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
B570J29032_10978059613300002408FreshwaterRLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV
B570J40625_10161696013300002835FreshwaterVTKQSSRGVMVSKSNSKRKIDAAVAAIFGYDRATAAPEPKAPVPKFFSLNL*
JGI25911J50253_1016302223300003411Freshwater LakeSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV*
JGI25926J51410_105685633300003490Freshwater LakeKASSKRKVDAAVASIFGYDRATQPAEPKKPVARFFSLEL*
Ga0066177_1041662513300004096Freshwater LakeISNCVTKQSSRGVMVAKASSKRKVDAAVASIFGYDRATQPAEPKKPVARFFSLEL*
Ga0066181_1008943343300004123Freshwater LakeAKASSRRKVDAAVASIFGYDRATQPPEPKEPVARYFSIQV*
Ga0066180_1035021523300004128Freshwater LakeKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0068877_1020743633300005525Freshwater LakeVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV*
Ga0068876_1001351013300005527Freshwater LakeANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAKPPPPVARYFSIQV*
Ga0068876_1008486913300005527Freshwater LakeANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0049082_1009081633300005584Freshwater LenticKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVVKYFSIQV*
Ga0078894_1019923913300005662Freshwater LakeDERLARHIANTVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI
Ga0079957_128599433300005805LakeVMVSKASSRRKIDAAVAAIFGYDRATAAPEPKPPVTRFFSIQA*
Ga0070749_1050716013300006802AqueousTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPTARIHFV*
Ga0075464_1080332513300006805AqueousKASSRRKVDAAVAAIFGYDRATQPPEPKAPVTRYFSVQV*
Ga0075459_102414613300006863AqueousVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI*
Ga0075459_105483133300006863AqueousVMVAKASARRKVDAAVAAIFGYDRATQPPPPKQPVARFFSIQV*
Ga0075458_1012490213300007363AqueousNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0075458_1026581133300007363AqueousKASARRKVDAAVAAIFGYDRATQPPPPKQPVARFFSIQV*
Ga0105050_1053618123300007516FreshwaterTSSRGTMVAKANNKRKIDSAVAAIFGYDRATQPAAPKKPIARFYSS*
Ga0102828_113783813300007559EstuarineSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL*
Ga0102869_114224433300007627EstuarineVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0102876_115820833300007642EstuarineGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARYFSIQV*
Ga0108970_1105206013300008055EstuaryITNCVTKQSSRGVRVAKASSKRKVDAAVAAIFGYDRATQPPEPKPPVARFFSVQL*
Ga0114341_1001324913300008108Freshwater, PlanktonNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0114343_116660433300008110Freshwater, PlanktonIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0114344_100705713300008111Freshwater, PlanktonKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0114344_100791713300008111Freshwater, PlanktonKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPPPVARYFSIQV*
Ga0114350_109810013300008116Freshwater, PlanktonVAKASSGRKVDAAVASIFGYDRATQPAEPTPPVARFFSIQV*
Ga0114841_111761613300008259Freshwater, PlanktonAKATNKRKIDAAVAAIFGYDRATAPKPKPVVPRIHFV*
Ga0114337_101083313300008262Freshwater, PlanktonCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0114349_100603633300008263Freshwater, PlanktonMNNCVTKQSSRGVMVSKSNSKRKIDAAVASIFGYDRATSAPEAKAPVPKFFSLNL*
Ga0114363_113677033300008266Freshwater, PlanktonHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTPRYFSIQV*
Ga0114363_123219713300008266Freshwater, PlanktonVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0114880_104180933300008450Freshwater LakeRHIANCVTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK
Ga0105103_1040835013300009085Freshwater SedimentVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV*
Ga0114980_1003144363300009152Freshwater LakeKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0114980_1047349633300009152Freshwater LakeVMVAKASSKRKVDAAVASIFGYDRATRPPEPKAPVTRFFSIDI*
Ga0114968_1033592333300009155Freshwater LakeMARHIANCVTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK*
Ga0114968_1041348333300009155Freshwater LakeSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0114977_1009969843300009158Freshwater LakeGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL*
Ga0114970_1022211813300009163Freshwater LakeNCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0114970_1052109913300009163Freshwater LakeNCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPITRYFSVQV*
Ga0114975_1010666213300009164Freshwater LakeSSKRKVDAAVAAIFGYDRATQPPELKPPVARFFSVQL*
Ga0105097_1019728513300009169Freshwater SedimentRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0105096_1054363733300009170Freshwater SedimentRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0114979_1008225943300009180Freshwater LakeARHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV*
Ga0114976_1018891633300009184Freshwater LakeRHVANCVTKQSSRGVMVAKASSKRKVDAAVASIFGYDRATRPPEPKAPVTRFFSIDI*
Ga0114967_1055877013300010160Freshwater LakeSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV*
Ga0129333_1013249013300010354Freshwater To Marine Saline GradientKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPTARIHFV*
Ga0129333_1072465133300010354Freshwater To Marine Saline GradientSARRKVDAAVAAIFGYDRATQPPPPKQPVAKFFSIQV*
Ga0129336_1012248033300010370Freshwater To Marine Saline GradientVTKQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPAPPKAPVPRFYSIRV*
Ga0129336_1029655243300010370Freshwater To Marine Saline GradientGDERLARHIANTVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI*
Ga0129336_1062734013300010370Freshwater To Marine Saline GradientTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV*
Ga0133913_1156052133300010885Freshwater LakeARHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLEPAKPVAKFFSIQV*
Ga0133913_1356574633300010885Freshwater LakeQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPPEPKPPVARFFSVQL*
Ga0164292_1106813613300013005FreshwaterNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV*
(restricted) Ga0172367_1003206553300013126FreshwaterVTKQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPQPPKPPVAQFFSIQV*
Ga0177922_1024728433300013372FreshwaterVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPPPVARFFSIQV*
Ga0177922_1110200743300013372FreshwaterASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV*
Ga0119952_113022213300014050FreshwaterKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFSIQV*
Ga0181347_114037213300017722Freshwater LakeRHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Ga0181362_112452413300017723Freshwater LakeVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPVVKYFSIQV
Ga0181358_125696313300017774Freshwater LakeSRRKVDAAVAAIFGYDRATQPPEPKAPITRYFSVQV
Ga0181349_106868313300017778Freshwater LakeERLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQ
Ga0169931_1061756833300017788FreshwaterHINNSVTKTSSRGIMIAKANNKRKIDGAVAAIFSFDRAMAPVPKKPTPRVHFI
Ga0181359_106099913300019784Freshwater LakeRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Ga0181359_107650913300019784Freshwater LakeGDERLARHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLTPPPPVARFFSIQV
Ga0194118_1006393543300020190Freshwater LakeARHISNCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPVTRYFSIQV
Ga0194119_1016530813300020220Freshwater LakeGNANLNQHINNSVTKTSSRGIMIAKANNKRKIDGAVAAIFSFDRAMAPVPKKPTPRVHFI
Ga0208235_102338133300020530FreshwaterGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV
Ga0207939_100179873300020536FreshwaterHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV
Ga0207941_102150133300020539FreshwaterSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Ga0208231_104219313300020557FreshwaterVMVAKASSRRKVDAAVASIFGYDRATQPPAPKEPVAKYFSIQV
Ga0208465_103546113300020570FreshwaterSKSNSKRKIDAAVAAIFGYDRATAAPEPKAPVPKFFSLNL
Ga0213922_110247013300021956FreshwaterVAKASSRRKVDAAVASIFGYDRATQPAEPLPPVAKFFSIQV
Ga0222713_1003728713300021962Estuarine WaterASSKRKVDAAVAAIFGYDRATQPIEKQPVTRYFSIQS
Ga0222712_1054987313300021963Estuarine WaterVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTKYFSIQV
Ga0181351_120608913300022407Freshwater LakeKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Ga0214921_1008578113300023174FreshwaterRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFSIQV
Ga0214923_1019775333300023179FreshwaterVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFSIQV
Ga0210003_111071013300024262Deep SubsurfaceVTKQSSRGVMVAKASARRKVDAAVASIFGYDRATQPPPPKAPVAKFFSIQV
Ga0244775_1046610333300024346EstuarineCVTKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV
Ga0244775_1100126313300024346EstuarineRGVMVAKASSRRKVDAAVASIFGYDRATQPPGPKEPVARYFSIQV
Ga0208019_110919233300025687AqueousDGNEGLARHVANCVTKQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPPPPKEPTARFFSIQV
Ga0208916_1021003113300025896AqueousVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK
Ga0208916_1038995613300025896AqueousQSSRGVMVAKASARRKVDAAVAAIFGYDRATQPPPPKQPVARFFSIQV
Ga0255064_100595543300027138FreshwaterIANCVTKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV
Ga0255093_105477323300027492FreshwaterVTKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV
Ga0208133_110514313300027631EstuarineKQSSRGSMVAKASAKRKVDAAVAAIFGYDRATQPPPPKAPIAKFFSIQV
Ga0209356_108650213300027644Freshwater LakeASSKRKVDAAVAAIFGYDRATQPPEPKPPVARFFSVQL
Ga0209443_111498133300027707Freshwater LakeKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209297_109202813300027733Freshwater LakeGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL
Ga0209087_101255283300027734Freshwater LakeRHISNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209190_118921913300027736Freshwater LakeVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL
Ga0209355_104643113300027744Freshwater LakeMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209444_1010575633300027756Freshwater LakeTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209134_1026203933300027764Freshwater LakeVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPATPPPPVARFFSIQV
Ga0209500_1013287533300027782Freshwater LakeTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209246_1027296713300027785Freshwater LakeVTKQPSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKEPVARYFSIQV
Ga0209107_1053334313300027797Freshwater And SedimentPRHISNCVTKQSSRGVMVAKASSRRKVDAAVAAIFGYDRATQPPEPKAPVVKYFSIQV
Ga0209668_1055917013300027899Freshwater Lake SedimentSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVAKFFSFQA
Ga0209400_102521663300027963Freshwater LakeVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209400_124584133300027963Freshwater LakeTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK
Ga0209191_109766033300027969Freshwater LakeTNCVTKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPPELKPPVARFFSVQL
Ga0209298_1006699913300027973Freshwater LakeMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV
Ga0209298_1027124813300027973Freshwater LakeANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLEPAKPVAKFFSIQV
Ga0247723_100035813300028025Deep Subsurface SedimentVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPLEPLPPVTRFFSIQV
Ga0247723_100851953300028025Deep Subsurface SedimentSKRKVDAAVAAIFGYDRATQPAEPKPPVARFFSVQL
(restricted) Ga0247843_115606413300028569FreshwaterKQSSRGVMVAKASSKRKVDAAVAAIFGYDRATQPPEPKSPVARFFSVQL
Ga0315907_10007594133300031758FreshwaterTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPQPKEPVARYFSIQV
Ga0315907_1038242933300031758FreshwaterARHVANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPPPVARFFSIQV
Ga0315909_1032990713300031857FreshwaterCVTKQSSRGLMVAKASARRKVDAAVAAIFGYDRATQPPPPKAPVAKFFSIQV
Ga0315904_1009186953300031951FreshwaterRGVMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Ga0315904_1101830333300031951FreshwaterGDERLARHIANTVTKTSSRGIMVAKATNKRKIDAAVAAIFGYDRATAPVPKPVVARFHSI
Ga0315901_1027893633300031963FreshwaterMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV
Ga0315901_1072952513300031963FreshwaterKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV
Ga0315905_1063165213300032092FreshwaterSRGLMVAKATNKRKIDAAVAAIFGYDRATAPKPKPVVPRIHFV
Ga0315902_1050841713300032093FreshwaterAKASSRRKVDAAVASIFGYDRATQPPQPKEPVARYFSIQV
Ga0315903_1040833633300032116FreshwaterMVAKASSRRKVDAAVASIFGYDRATQPAEPPAPVARFFSIQV
Ga0334982_0190215_892_10203300033981FreshwaterMVAKASSRRKVDAAVASIFGYDRATQPPAPKEPVAKYFSIQV
Ga0334979_0165767_1178_13243300033996FreshwaterQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTARYFSIQV
Ga0334986_0016951_4846_50133300034012FreshwaterMNNCVTKQSSRGVMVSKSNSKRKIDAAVASIFGYDRATSAPEAKAPVPKFFSLNL
Ga0334998_0385743_31_1593300034019FreshwaterMVSKSNSKRKIDAAVASIFGYDRATSAPEAKAPVPKFFSLNL
Ga0335002_0324922_2_1093300034020FreshwaterVDAAVAAIFGYDRATQPAEPKKPVARFFSLDLGAK
Ga0334987_0170518_3_1943300034061FreshwaterGDERLARHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTPRYFSIQV
Ga0334987_0631099_509_6253300034061FreshwaterASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV
Ga0334995_0069297_2594_27823300034062FreshwaterDERLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPLTRYFTIQV
Ga0335028_0173499_1211_13393300034071FreshwaterMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV
Ga0335027_0652080_3_1823300034101FreshwaterLARHITNCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV
Ga0335036_0438861_710_8293300034106FreshwaterKASSRRKVDAAVASIFGYDRATQPLEPLPPITRFFSIQV
Ga0335036_0750442_1_1233300034106FreshwaterAKASSRRKVDAAVASIFGYDRATQPPEPKAPVSKYFSIQV
Ga0335036_0892114_2_1213300034106FreshwaterVAKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI
Ga0335037_0073025_1686_18563300034107FreshwaterHIANCVTKQSSRGVMVAKASSRRKVDAAVASIFGYDRATQPAPPKPPTPRYFSIQV
Ga0335066_0595938_1_1143300034112FreshwaterKATNKRKIDAAVAAIFGYDRATAPKPPKQPVARFHSI


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.