Basic Information | |
---|---|
Family ID | F055075 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 139 |
Average Sequence Length | 48 residues |
Representative Sequence | MWKFVVVLLLTALAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG |
Number of Associated Samples | 119 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 84.89 % |
% of genes near scaffold ends (potentially truncated) | 28.06 % |
% of genes from short scaffolds (< 2000 bps) | 90.65 % |
Associated GOLD sequencing projects | 111 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.518 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.827 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.532 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.007 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF01218 | Coprogen_oxidas | 51.80 |
PF00313 | CSD | 13.67 |
PF07886 | BA14K | 2.16 |
PF00033 | Cytochrome_B | 0.72 |
PF00118 | Cpn60_TCP1 | 0.72 |
PF10399 | UCR_Fe-S_N | 0.72 |
PF13304 | AAA_21 | 0.72 |
PF00733 | Asn_synthase | 0.72 |
PF08206 | OB_RNB | 0.72 |
PF02668 | TauD | 0.72 |
PF01850 | PIN | 0.72 |
COG ID | Name | Functional Category | % Frequency in 139 Family Scaffolds |
---|---|---|---|
COG0408 | Coproporphyrinogen-III oxidase HemH, oxygen-dependent | Coenzyme transport and metabolism [H] | 51.80 |
COG0459 | Chaperonin GroEL (HSP60 family) | Posttranslational modification, protein turnover, chaperones [O] | 0.72 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.72 |
COG1158 | Transcription termination factor Rho | Transcription [K] | 0.72 |
COG1278 | Cold shock protein, CspA family | Transcription [K] | 0.72 |
COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 0.72 |
COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.72 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.52 % |
All Organisms | root | All Organisms | 47.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2228664022|INPgaii200_c1178443 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1096 | Open in IMG/M |
2228664022|INPgaii200_c1179465 | Not Available | 529 | Open in IMG/M |
3300000891|JGI10214J12806_10429642 | Not Available | 626 | Open in IMG/M |
3300001139|JGI10220J13317_11468850 | Not Available | 503 | Open in IMG/M |
3300004157|Ga0062590_101937972 | Not Available | 609 | Open in IMG/M |
3300004479|Ga0062595_100121367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1447 | Open in IMG/M |
3300004480|Ga0062592_102378118 | Not Available | 531 | Open in IMG/M |
3300005103|Ga0066813_1014336 | Not Available | 526 | Open in IMG/M |
3300005294|Ga0065705_10091004 | Not Available | 530 | Open in IMG/M |
3300005328|Ga0070676_10831178 | Not Available | 683 | Open in IMG/M |
3300005329|Ga0070683_100836375 | Not Available | 883 | Open in IMG/M |
3300005332|Ga0066388_101111997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1339 | Open in IMG/M |
3300005332|Ga0066388_103404394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 812 | Open in IMG/M |
3300005332|Ga0066388_103790227 | Not Available | 771 | Open in IMG/M |
3300005332|Ga0066388_105421972 | Not Available | 646 | Open in IMG/M |
3300005334|Ga0068869_100630981 | Not Available | 908 | Open in IMG/M |
3300005339|Ga0070660_100896069 | Not Available | 748 | Open in IMG/M |
3300005343|Ga0070687_100336952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 969 | Open in IMG/M |
3300005347|Ga0070668_102076173 | Not Available | 524 | Open in IMG/M |
3300005354|Ga0070675_101857603 | Not Available | 556 | Open in IMG/M |
3300005438|Ga0070701_11309636 | Not Available | 518 | Open in IMG/M |
3300005441|Ga0070700_101992638 | Not Available | 503 | Open in IMG/M |
3300005455|Ga0070663_101487662 | Not Available | 602 | Open in IMG/M |
3300005459|Ga0068867_100461253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1085 | Open in IMG/M |
3300005539|Ga0068853_100789562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 909 | Open in IMG/M |
3300005549|Ga0070704_100105101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2137 | Open in IMG/M |
3300005549|Ga0070704_100144892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1860 | Open in IMG/M |
3300005614|Ga0068856_100578935 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1144 | Open in IMG/M |
3300005713|Ga0066905_102042415 | Not Available | 532 | Open in IMG/M |
3300005718|Ga0068866_11110968 | Not Available | 567 | Open in IMG/M |
3300005719|Ga0068861_101243890 | Not Available | 722 | Open in IMG/M |
3300005764|Ga0066903_102312374 | Not Available | 1038 | Open in IMG/M |
3300005844|Ga0068862_102185145 | Not Available | 565 | Open in IMG/M |
3300006050|Ga0075028_100748171 | Not Available | 592 | Open in IMG/M |
3300006175|Ga0070712_100268748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1369 | Open in IMG/M |
3300006572|Ga0074051_10003887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1641 | Open in IMG/M |
3300006871|Ga0075434_100132233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2515 | Open in IMG/M |
3300006880|Ga0075429_101714098 | Not Available | 546 | Open in IMG/M |
3300009053|Ga0105095_10590652 | Not Available | 618 | Open in IMG/M |
3300009078|Ga0105106_11000222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium | 594 | Open in IMG/M |
3300009091|Ga0102851_12831062 | Not Available | 557 | Open in IMG/M |
3300009092|Ga0105250_10126422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
3300009094|Ga0111539_11464553 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300009100|Ga0075418_10986774 | Not Available | 911 | Open in IMG/M |
3300009147|Ga0114129_10064880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 5097 | Open in IMG/M |
3300009156|Ga0111538_11526350 | Not Available | 842 | Open in IMG/M |
3300009156|Ga0111538_11709186 | Not Available | 793 | Open in IMG/M |
3300009156|Ga0111538_12399832 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300009165|Ga0105102_10842480 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
3300009553|Ga0105249_11031519 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
3300009792|Ga0126374_11890289 | Not Available | 502 | Open in IMG/M |
3300010358|Ga0126370_10226506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1432 | Open in IMG/M |
3300010362|Ga0126377_11839279 | Not Available | 681 | Open in IMG/M |
3300010371|Ga0134125_12207073 | Not Available | 599 | Open in IMG/M |
3300010373|Ga0134128_10546878 | Not Available | 1290 | Open in IMG/M |
3300010375|Ga0105239_12350472 | Not Available | 621 | Open in IMG/M |
3300010375|Ga0105239_13086232 | Not Available | 543 | Open in IMG/M |
3300010397|Ga0134124_12709757 | Not Available | 539 | Open in IMG/M |
3300011119|Ga0105246_10186540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1602 | Open in IMG/M |
3300011119|Ga0105246_10698077 | Not Available | 889 | Open in IMG/M |
3300012507|Ga0157342_1036553 | Not Available | 641 | Open in IMG/M |
3300012891|Ga0157305_10010796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1456 | Open in IMG/M |
3300012913|Ga0157298_10206082 | Not Available | 635 | Open in IMG/M |
3300012951|Ga0164300_10067552 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1473 | Open in IMG/M |
3300012951|Ga0164300_10078113 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1396 | Open in IMG/M |
3300012951|Ga0164300_10575112 | Not Available | 660 | Open in IMG/M |
3300012955|Ga0164298_10000998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 8318 | Open in IMG/M |
3300012957|Ga0164303_10020778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2525 | Open in IMG/M |
3300012957|Ga0164303_11551627 | Not Available | 503 | Open in IMG/M |
3300012960|Ga0164301_10234335 | Not Available | 1194 | Open in IMG/M |
3300012964|Ga0153916_10377348 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1472 | Open in IMG/M |
3300012984|Ga0164309_11500414 | Not Available | 577 | Open in IMG/M |
3300012987|Ga0164307_10010599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 4457 | Open in IMG/M |
3300014255|Ga0075320_1132731 | Not Available | 515 | Open in IMG/M |
3300014302|Ga0075310_1048888 | Not Available | 821 | Open in IMG/M |
3300014319|Ga0075348_1126737 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 661 | Open in IMG/M |
3300014326|Ga0157380_13521680 | Not Available | 502 | Open in IMG/M |
3300014881|Ga0180094_1075686 | Not Available | 750 | Open in IMG/M |
3300015371|Ga0132258_11834876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1527 | Open in IMG/M |
3300015371|Ga0132258_13067670 | Not Available | 1156 | Open in IMG/M |
3300015374|Ga0132255_100834582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1375 | Open in IMG/M |
3300017965|Ga0190266_10040432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1567 | Open in IMG/M |
3300017966|Ga0187776_11096400 | Not Available | 591 | Open in IMG/M |
3300018027|Ga0184605_10454525 | Not Available | 564 | Open in IMG/M |
3300018028|Ga0184608_10139023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1040 | Open in IMG/M |
3300018076|Ga0184609_10096644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1322 | Open in IMG/M |
3300018076|Ga0184609_10248222 | Not Available | 832 | Open in IMG/M |
3300018081|Ga0184625_10144305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1243 | Open in IMG/M |
3300018469|Ga0190270_10096181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2252 | Open in IMG/M |
3300018469|Ga0190270_10975666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 872 | Open in IMG/M |
3300018469|Ga0190270_11146938 | Not Available | 813 | Open in IMG/M |
3300018481|Ga0190271_10493433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1335 | Open in IMG/M |
3300019356|Ga0173481_10332431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 719 | Open in IMG/M |
3300019361|Ga0173482_10489588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 594 | Open in IMG/M |
3300021078|Ga0210381_10190053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 713 | Open in IMG/M |
3300022694|Ga0222623_10050208 | Not Available | 1604 | Open in IMG/M |
3300025313|Ga0209431_11184166 | Not Available | 524 | Open in IMG/M |
3300025559|Ga0210087_1062060 | Not Available | 745 | Open in IMG/M |
3300025899|Ga0207642_10082934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1562 | Open in IMG/M |
3300025900|Ga0207710_10013081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 3495 | Open in IMG/M |
3300025907|Ga0207645_10271292 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1125 | Open in IMG/M |
3300025924|Ga0207694_10485193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1034 | Open in IMG/M |
3300025926|Ga0207659_11814454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 518 | Open in IMG/M |
3300025933|Ga0207706_10602716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 943 | Open in IMG/M |
3300025941|Ga0207711_12021595 | Not Available | 519 | Open in IMG/M |
3300025960|Ga0207651_10439077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1118 | Open in IMG/M |
3300026041|Ga0207639_11771477 | Not Available | 578 | Open in IMG/M |
3300026075|Ga0207708_10545656 | Not Available | 977 | Open in IMG/M |
3300026118|Ga0207675_100991155 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300027523|Ga0208890_1000462 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 3737 | Open in IMG/M |
3300027560|Ga0207981_1037752 | Not Available | 880 | Open in IMG/M |
3300027907|Ga0207428_10374538 | Not Available | 1045 | Open in IMG/M |
3300027909|Ga0209382_10271464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1920 | Open in IMG/M |
3300028592|Ga0247822_11979149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 500 | Open in IMG/M |
3300028597|Ga0247820_10410524 | Not Available | 908 | Open in IMG/M |
3300028608|Ga0247819_10130476 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300028608|Ga0247819_10741814 | Not Available | 603 | Open in IMG/M |
3300028802|Ga0307503_10004678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 3567 | Open in IMG/M |
3300028802|Ga0307503_10629625 | Not Available | 595 | Open in IMG/M |
3300028809|Ga0247824_10669472 | Not Available | 630 | Open in IMG/M |
3300028814|Ga0307302_10490254 | Not Available | 610 | Open in IMG/M |
3300030006|Ga0299907_11249558 | Not Available | 530 | Open in IMG/M |
3300031539|Ga0307380_10014197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Methyloceanibacter → Methyloceanibacter caenitepidi | 9799 | Open in IMG/M |
3300031565|Ga0307379_10329416 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300031566|Ga0307378_11242837 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300031847|Ga0310907_10239555 | Not Available | 887 | Open in IMG/M |
3300031854|Ga0310904_10151256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1348 | Open in IMG/M |
3300031858|Ga0310892_10198118 | Not Available | 1205 | Open in IMG/M |
3300031940|Ga0310901_10036667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1533 | Open in IMG/M |
3300031949|Ga0214473_10129523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2942 | Open in IMG/M |
3300031949|Ga0214473_10417083 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
3300031949|Ga0214473_10702177 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Suessiales → Symbiodiniaceae → Symbiodinium → Symbiodinium microadriaticum | 1103 | Open in IMG/M |
3300032012|Ga0310902_10322329 | Not Available | 959 | Open in IMG/M |
3300032261|Ga0306920_103300109 | Not Available | 602 | Open in IMG/M |
3300032516|Ga0315273_13142349 | Not Available | 513 | Open in IMG/M |
3300033416|Ga0316622_101864144 | Not Available | 700 | Open in IMG/M |
3300033433|Ga0326726_11439926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 671 | Open in IMG/M |
3300033550|Ga0247829_10879263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 746 | Open in IMG/M |
3300033551|Ga0247830_10047603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2793 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.63% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.19% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.32% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.32% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.60% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.16% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.16% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.16% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.16% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 2.16% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.16% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.16% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.16% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.44% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.44% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.72% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.72% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.72% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.72% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.72% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.72% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.72% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.72% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.72% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.72% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.72% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300014255 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleC_D2 | Environmental | Open in IMG/M |
3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
3300014319 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031566 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-1 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPgaii200_11784432 | 2228664022 | Soil | MWKFVFILLVTALAVLVAQLIADAPVIQTRVGALGEMQVTYAFAGIRG |
INPgaii200_11794652 | 2228664022 | Soil | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGIRG |
JGI10214J12806_104296421 | 3300000891 | Soil | MWKFVVVLLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG* |
JGI10220J13317_114688502 | 3300001139 | Soil | VVVLLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG* |
Ga0062590_1019379721 | 3300004157 | Soil | MWKFVVVLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG* |
Ga0062595_1001213672 | 3300004479 | Soil | MWKFVFILLVTALAVLVAQLIADAPVIQTRVGALGEMQVTYAFAGIRG* |
Ga0062592_1023781181 | 3300004480 | Soil | LLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG* |
Ga0066813_10143362 | 3300005103 | Soil | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAASQVQVTYAYAGVRG* |
Ga0065705_100910041 | 3300005294 | Switchgrass Rhizosphere | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTVYAYAGTRG* |
Ga0070676_108311781 | 3300005328 | Miscanthus Rhizosphere | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGV |
Ga0070683_1008363751 | 3300005329 | Corn Rhizosphere | MWKFVVVLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITY |
Ga0066388_1011119972 | 3300005332 | Tropical Forest Soil | MWKFVRVLLKTEIAILIAQLVADAPVIQTRVGTLYPVQITHAFAGVRG* |
Ga0066388_1034043942 | 3300005332 | Tropical Forest Soil | MWKFVFVLLVTALELLAAQLIADAPVIQTRVGALHTVQVTYAGVRG* |
Ga0066388_1037902272 | 3300005332 | Tropical Forest Soil | MWKFVFVLLVTALVLLVAQLIADAPVIQTRVGAASQVQVTYAYAGVRG* |
Ga0066388_1054219721 | 3300005332 | Tropical Forest Soil | MWKFVLVLLLTAIAILIAQLVADAPVIQTRVGTLYPVQITYAFAGVRG* |
Ga0068869_1006309812 | 3300005334 | Miscanthus Rhizosphere | MWKFVLVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG* |
Ga0070660_1008960692 | 3300005339 | Corn Rhizosphere | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVT |
Ga0070687_1003369523 | 3300005343 | Switchgrass Rhizosphere | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTY |
Ga0070668_1020761731 | 3300005347 | Switchgrass Rhizosphere | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAAMETQTAYAYAGIRG* |
Ga0070675_1018576031 | 3300005354 | Miscanthus Rhizosphere | SASEAVMWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGVRG* |
Ga0070701_113096361 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGVRG* |
Ga0070700_1019926381 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG* |
Ga0070663_1014876622 | 3300005455 | Corn Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG* |
Ga0068867_1004612532 | 3300005459 | Miscanthus Rhizosphere | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG* |
Ga0068853_1007895622 | 3300005539 | Corn Rhizosphere | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG* |
Ga0070704_1001051011 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGALGQVQVTYAYAGVRG* |
Ga0070704_1001448921 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | SEAVMWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG* |
Ga0068856_1005789352 | 3300005614 | Corn Rhizosphere | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGIRG* |
Ga0066905_1020424151 | 3300005713 | Tropical Forest Soil | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAASQVLVTYAYLGVRG* |
Ga0068866_111109682 | 3300005718 | Miscanthus Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAY |
Ga0068861_1012438901 | 3300005719 | Switchgrass Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGALHTVRVTYAYAGVRG* |
Ga0066903_1023123742 | 3300005764 | Tropical Forest Soil | MWKFVLLLLLTAIAILIAQLVADAPVIQTRVGTLHPVKITYAYAGVRG* |
Ga0068862_1021851452 | 3300005844 | Switchgrass Rhizosphere | AVMWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGIRG* |
Ga0075028_1007481711 | 3300006050 | Watersheds | MWKFVLVLLITATAILIAQLVADAPVIQAGVGAASQRQIQVTYAYGGVRG* |
Ga0070712_1002687482 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKFVLVLLITATAILIAQLVADAPVIQAGVGVASQRQIQVTYAYGGVRG* |
Ga0074051_100038874 | 3300006572 | Soil | MWKFVFVLLVTALALLAAQLIADAPVIQTRVGAAMETQIVYAYAGTRG* |
Ga0075434_1001322332 | 3300006871 | Populus Rhizosphere | MWKFVFTLLVTALAVLVAQLIADAPVIQTRVGALGEMQVTYAFAGIRG* |
Ga0075429_1017140982 | 3300006880 | Populus Rhizosphere | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAANAAQVIYAYAGIRG* |
Ga0105095_105906522 | 3300009053 | Freshwater Sediment | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAGGNVQTTYAYAGVRG* |
Ga0105106_110002222 | 3300009078 | Freshwater Sediment | MLKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAGGNVQTTYAYAGVRG* |
Ga0102851_128310622 | 3300009091 | Freshwater Wetlands | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGIRG* |
Ga0105250_101264223 | 3300009092 | Switchgrass Rhizosphere | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAANAAQVAYAYA |
Ga0111539_114645531 | 3300009094 | Populus Rhizosphere | MWKFVVVLLTAIDVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG* |
Ga0075418_109867741 | 3300009100 | Populus Rhizosphere | MLKYVVVLLLTAFAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG* |
Ga0114129_100648804 | 3300009147 | Populus Rhizosphere | MLKYVVVLLLTAFAILVAQLVSDAPVIQTRVGASAQMQTTYAYAGVRG* |
Ga0111538_115263501 | 3300009156 | Populus Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAMHTVQVTYAYAG* |
Ga0111538_117091862 | 3300009156 | Populus Rhizosphere | MWKLVFVLLLTAFAILVAQLVSDAPVIQTRVGASAQMQTTYAYAGVRG* |
Ga0111538_123998322 | 3300009156 | Populus Rhizosphere | SEAVMWKFVVVLLLTAFAILVAELVSDALVIQTRVGAANAAQVIYAYAGIRG* |
Ga0105102_108424801 | 3300009165 | Freshwater Sediment | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRIGAANAAQVMYAYAGIRG* |
Ga0105249_110315191 | 3300009553 | Switchgrass Rhizosphere | VMWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTVYAYAGIRG* |
Ga0126374_118902891 | 3300009792 | Tropical Forest Soil | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAASQEVTYAYAGVRG* |
Ga0126370_102265061 | 3300010358 | Tropical Forest Soil | MWKFVLVLLLTEITILIAQLVADAPVIQTRVGTLYPVQITHAFAGVRG* |
Ga0126377_118392792 | 3300010362 | Tropical Forest Soil | SEAAMWKFVRVLLKTEIAILIAQLVADAPVIQTRVGTLYPVQITYAFAGVRG* |
Ga0134125_122070731 | 3300010371 | Terrestrial Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGCGGKRKIP |
Ga0134128_105468782 | 3300010373 | Terrestrial Soil | AVMWKFVFVLLVTALTLLVAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG* |
Ga0105239_123504721 | 3300010375 | Corn Rhizosphere | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAANAAQVAYAYAGIRG* |
Ga0105239_130862322 | 3300010375 | Corn Rhizosphere | LVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG* |
Ga0134124_127097571 | 3300010397 | Terrestrial Soil | MWKFVLVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGIRG* |
Ga0105246_101865404 | 3300011119 | Miscanthus Rhizosphere | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAAMHMQTTYAYAGVRG* |
Ga0105246_106980771 | 3300011119 | Miscanthus Rhizosphere | MWKFVVVLLLTAFAILFAQLVSDAPVIQTRVGAANAAQVAYAYAGIRG* |
Ga0157342_10365532 | 3300012507 | Arabidopsis Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAMHTVQVTYAYAGVRG* |
Ga0157305_100107964 | 3300012891 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGASAQMQTTYAYAGVRG* |
Ga0157298_102060822 | 3300012913 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGCGGKRKIPHAEERP* |
Ga0164300_100675524 | 3300012951 | Soil | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGSRG* |
Ga0164300_100781131 | 3300012951 | Soil | MWKFVLVLLITATAILIAQLVADAPVIQAGVGAASQRQIQVTYAYAGVSG* |
Ga0164300_105751121 | 3300012951 | Soil | MWKFVLVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAYAGVRG* |
Ga0164298_100009988 | 3300012955 | Soil | MWKFVLVLFITAIAILIARLVADAPVIQTGVGAASQRQIQVTYAYAGVSG* |
Ga0164303_100207783 | 3300012957 | Soil | MWKFVLVLFITAIAILIARLVADAPVIQTGVGASSQRQIQVTYAYAGVSG* |
Ga0164303_115516271 | 3300012957 | Soil | MWKFVLVLLITAIAILIAQLVADVPVIQTRVGAASPMQMQVTYAYGDVRG* |
Ga0164301_102343352 | 3300012960 | Soil | MWKFVLVLLITATAILIAQLLADAPVIQAGVGAASQRQIQVTYAYGGVRG* |
Ga0153916_103773481 | 3300012964 | Freshwater Wetlands | MWKFVFVLLVTALALLVAQLIADAPVIQARVGALSQVQVTYAYAGIRG |
Ga0164309_115004141 | 3300012984 | Soil | MWKFVLVLLLTAIAILIAQLVADVPVIQTRVGAASPMQMQVTHAYGDVRG* |
Ga0164307_100105993 | 3300012987 | Soil | MWKFVLVLFITAIAILIAQLIADAPVIQTGVGAASQRQIQVTYAYAGVRG* |
Ga0075320_11327311 | 3300014255 | Natural And Restored Wetlands | MWKFVFVLLVTALALLAAQLIADAPVIQTRVGALHAVQVTYAYAGI |
Ga0075310_10488882 | 3300014302 | Natural And Restored Wetlands | MWKFVVVLLLTAFAVLVAQLVSDAPVIQTRVGAAAQMQTTYAYAGVRG* |
Ga0075348_11267372 | 3300014319 | Natural And Restored Wetlands | MLKFVLVLLLTAFAILVAQLVSDAPVIQTRVGAAAQMQTTYAYAGVRG* |
Ga0157380_135216802 | 3300014326 | Switchgrass Rhizosphere | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG* |
Ga0180094_10756862 | 3300014881 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAAKQMQTTYAYAGVRG* |
Ga0132258_118348761 | 3300015371 | Arabidopsis Rhizosphere | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAAMQMQTT |
Ga0132258_130676702 | 3300015371 | Arabidopsis Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAAMQMQTTYAYAGVRG* |
Ga0132255_1008345822 | 3300015374 | Arabidopsis Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGGRG* |
Ga0190266_100404321 | 3300017965 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAGGKMQTTYAYAGGRG |
Ga0187776_110964002 | 3300017966 | Tropical Peatland | MWKFVLLLLLTAIAILIAQLVADAPVIQTRVGTLYPVQITHAFAGVRG |
Ga0184605_104545251 | 3300018027 | Groundwater Sediment | MLKFVLVLLVTALAVLIAQLIADAPVIQTRVGAAGTVQVTYAYAGIRG |
Ga0184608_101390232 | 3300018028 | Groundwater Sediment | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAGTVQVTYAYAGIRG |
Ga0184609_100966443 | 3300018076 | Groundwater Sediment | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTVYAYAGTREGRS |
Ga0184609_102482221 | 3300018076 | Groundwater Sediment | PCPSEAVMLKFVLVLLVTALAVLIAQLIADAPVIQTRVGAAGTVQVT |
Ga0184625_101443052 | 3300018081 | Groundwater Sediment | MWKFVLVLLVTALAVLIAQLISDAPVIQTRVGAAGTVQVTYAYAGIRG |
Ga0190270_100961812 | 3300018469 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAAGKVQITYAYAGVRG |
Ga0190270_109756662 | 3300018469 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAANAAQVAYAYAGIRG |
Ga0190270_111469382 | 3300018469 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGASAQMQTTYAYAGVRG |
Ga0190271_104934333 | 3300018481 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAANAAQVIYAYAGI |
Ga0173481_103324312 | 3300019356 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGVRG |
Ga0173482_104895881 | 3300019361 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQPPTPMRGCGGKRKIPHAEERP |
Ga0210381_101900532 | 3300021078 | Groundwater Sediment | MWKFVLVLLVTALAVLIAQLIADAPVIQTRVGAAMEAQTAYA |
Ga0222623_100502082 | 3300022694 | Groundwater Sediment | MWKFVLVLLVTALAVLIAQLIADAPVIQTRVGAAGTVQVTYAYAGIRG |
Ga0209431_111841661 | 3300025313 | Soil | MWKFVVVLLLTALAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG |
Ga0210087_10620602 | 3300025559 | Natural And Restored Wetlands | MWKFVVVMLLTAFAILVAQLVSDAPVIQTRVGAAAQMQTTYAYAGVRG |
Ga0207642_100829343 | 3300025899 | Miscanthus Rhizosphere | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG |
Ga0207710_100130812 | 3300025900 | Switchgrass Rhizosphere | MWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG |
Ga0207645_102712923 | 3300025907 | Miscanthus Rhizosphere | MWKFVVVLLLTAIAVLVAQLVSDAPVIQTRVGAANNVQIT |
Ga0207694_104851933 | 3300025924 | Corn Rhizosphere | MWKFVLVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG |
Ga0207659_118144541 | 3300025926 | Miscanthus Rhizosphere | SSASEAVMWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAGVRG |
Ga0207706_106027162 | 3300025933 | Corn Rhizosphere | MWKFVVVLLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG |
Ga0207711_120215952 | 3300025941 | Switchgrass Rhizosphere | VMWKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGIRG |
Ga0207651_104390773 | 3300025960 | Switchgrass Rhizosphere | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAY |
Ga0207639_117714771 | 3300026041 | Corn Rhizosphere | WKFVLVLLVTALALLAAQLIADAPVIQTRVGAVSQVQVTYAYAGVRG |
Ga0207708_105456561 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG |
Ga0207675_1009911551 | 3300026118 | Switchgrass Rhizosphere | PRPCPSEAVMWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTVYAYAGIRG |
Ga0208890_10004626 | 3300027523 | Soil | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTAYAYAGIRG |
Ga0207981_10377522 | 3300027560 | Soil | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQIVYAYAGTRG |
Ga0207428_103745381 | 3300027907 | Populus Rhizosphere | LVTALAVLVAQLIADAPVIQTRVGALGEMQVTYAFAGIRG |
Ga0209382_102714642 | 3300027909 | Populus Rhizosphere | MLKYVVVLLLTAFAILVAQLVSDAPVIQTRVGASAQMQTTYAYAGVRG |
Ga0247822_119791491 | 3300028592 | Soil | SPSEAVMWKFVVVLLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG |
Ga0247820_104105241 | 3300028597 | Soil | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTVYAYAGTRG |
Ga0247819_101304763 | 3300028608 | Soil | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAAMETQTVYAYAGIRG |
Ga0247819_107418142 | 3300028608 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGATMQMQTTYAYAG |
Ga0307503_100046781 | 3300028802 | Soil | VVVLLLTAFAILVAQLVSDAPVIQTRVGAVGQMQMTYAYAGVRG |
Ga0307503_106296252 | 3300028802 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAVGQMQMTYAYAGVEG |
Ga0247824_106694721 | 3300028809 | Soil | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAVSQVQVTYASAGIRG |
Ga0307302_104902541 | 3300028814 | Soil | MWKFVLVLLVTALAVLIAQLIADAPVIQTRVGAVGQVQVTYAYAGIRG |
Ga0299907_112495582 | 3300030006 | Soil | MWKFVFVLLVTALAVLIAQLIADAPVIQTRVGAGGKMQTTYAYAGVRG |
Ga0307380_100141976 | 3300031539 | Soil | MWKFVLILLTTALAVLVAQLIADAPVIQTRVGVTIEAPALAYAGVRG |
Ga0307379_103294161 | 3300031565 | Soil | WKFVLILLTTALAVLVAQLIADAPVIQTRVGVTVETPVLAYAGVRG |
Ga0307378_112428371 | 3300031566 | Soil | MWKFVLILLTTALAVLVAQLIADAPVIQTRVGLTIEAPALAYAGVRG |
Ga0310907_102395552 | 3300031847 | Soil | PSEAVMWKFVVVLLLTAIAVLVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG |
Ga0310904_101512561 | 3300031854 | Soil | MWKFVVVLLLTAFAILAAQLVSDAPVIQTRVGAATQMQTTYAYA |
Ga0310892_101981181 | 3300031858 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGAATQMQTTYAYAGVRG |
Ga0310901_100366671 | 3300031940 | Soil | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAAMQMQTTYAY |
Ga0214473_101295234 | 3300031949 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAAMQMQTTYAYAGVRG |
Ga0214473_104170832 | 3300031949 | Soil | MWKFVVVLLLTAFAILVAQLVSDAPVIQTRVGAASQMQTAYAYAGVRG |
Ga0214473_107021771 | 3300031949 | Soil | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGAAMQMQTAYAYAGVRG |
Ga0310902_103223292 | 3300032012 | Soil | MWKFVVVLLLTAIAILVAQLVSDAPVIQTRVGAANNVQITYAYAGIRG |
Ga0306920_1033001091 | 3300032261 | Soil | MWKFVRVLLKTEIAILIAQLVADAPVIQTRVGTYPVQITHAFAGVRG |
Ga0315273_131423492 | 3300032516 | Sediment | MWKFVVMLLLTAFAILVAQLVSDAPVIQTRVGAAPQMQTTYAYAGVRG |
Ga0316622_1018641442 | 3300033416 | Soil | MWKFVFVLLVTALALLAAQLIADAPVIQTRVGAASQAQVTYAYAGIRG |
Ga0326726_114399262 | 3300033433 | Peat Soil | MWKFVFVLLVTALALLVAQLIADAPVIQTRVGAASQVQVTYAYAGVRG |
Ga0247829_108792632 | 3300033550 | Soil | MWKFVVLLLLTAFAMLVAQLVSDAPLIQTRVGAPSKVQPTYAYAGVRG |
Ga0247830_100476032 | 3300033551 | Soil | MWKFVVLLLLTAFAMLVAQLVSDAPVIQTRVGAPSKVQPTYAYAGVRG |
⦗Top⦘ |