Basic Information | |
---|---|
Family ID | F054662 |
Family Type | Metagenome |
Number of Sequences | 139 |
Average Sequence Length | 44 residues |
Representative Sequence | LKIDMKEQRREMRLRFTSNTQNGNYFMGRVVLSVETGDVRGTGNP |
Number of Associated Samples | 102 |
Number of Associated Scaffolds | 139 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.56 % |
% of genes from short scaffolds (< 2000 bps) | 86.33 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.21 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (94.964 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater (38.849 % of family members) |
Environment Ontology (ENVO) | Unclassified (84.173 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (79.137 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 16.44% Coil/Unstructured: 83.56% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.21 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 139 Family Scaffolds |
---|---|---|
PF02801 | Ketoacyl-synt_C | 1.44 |
PF13946 | DUF4214 | 1.44 |
PF00109 | ketoacyl-synt | 0.72 |
PF01832 | Glucosaminidase | 0.72 |
PF00583 | Acetyltransf_1 | 0.72 |
PF01464 | SLT | 0.72 |
PF11397 | GlcNAc | 0.72 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 100.00 % |
Unclassified | root | N/A | 0.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309002|MiccSOB_contig04068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300000439|TBL_comb48_EPIDRAFT_1022853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2829 | Open in IMG/M |
3300001847|RCM41_1080717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1240 | Open in IMG/M |
3300002307|JGI24890J29729_1040255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300002933|G310J44882_10132752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300003375|JGI26470J50227_1071585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300003806|Ga0007864_1002824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
3300003813|Ga0007879_1006873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1438 | Open in IMG/M |
3300003813|Ga0007879_1009400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
3300003820|Ga0007863_1010767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300004095|Ga0007829_10070350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 688 | Open in IMG/M |
3300004481|Ga0069718_10102962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 896 | Open in IMG/M |
3300004481|Ga0069718_13471140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
3300004684|Ga0065168_1001043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4662 | Open in IMG/M |
3300004684|Ga0065168_1008228 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
3300004692|Ga0065171_1002700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2823 | Open in IMG/M |
3300004694|Ga0065170_1004406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1933 | Open in IMG/M |
3300004694|Ga0065170_1019168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300004770|Ga0007804_1074079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300004770|Ga0007804_1083953 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
3300004806|Ga0007854_10038210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2458 | Open in IMG/M |
3300004807|Ga0007809_10006152 | All Organisms → Viruses → Predicted Viral | 4555 | Open in IMG/M |
3300004807|Ga0007809_10056929 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1259 | Open in IMG/M |
3300004807|Ga0007809_10112553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 821 | Open in IMG/M |
3300005583|Ga0049085_10268905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300005662|Ga0078894_11152664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300006072|Ga0007881_1014784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2265 | Open in IMG/M |
3300006072|Ga0007881_1087520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300006100|Ga0007806_1001894 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6237 | Open in IMG/M |
3300006101|Ga0007810_1074533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300006104|Ga0007882_10161204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 785 | Open in IMG/M |
3300006105|Ga0007819_1003311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4696 | Open in IMG/M |
3300006107|Ga0007836_1029736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
3300006109|Ga0007870_1042146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
3300006110|Ga0007871_1036274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 944 | Open in IMG/M |
3300006110|Ga0007871_1068549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 667 | Open in IMG/M |
3300006110|Ga0007871_1082420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300006113|Ga0007858_1060571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300006113|Ga0007858_1090239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
3300006114|Ga0007815_1002049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5807 | Open in IMG/M |
3300006118|Ga0007859_1028282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1209 | Open in IMG/M |
3300006119|Ga0007866_1034798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300006121|Ga0007824_1012535 | All Organisms → Viruses → Predicted Viral | 1774 | Open in IMG/M |
3300006124|Ga0007873_1048449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300006124|Ga0007873_1086114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300006128|Ga0007828_1009551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2069 | Open in IMG/M |
3300006128|Ga0007828_1133648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300006805|Ga0075464_11073449 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300009068|Ga0114973_10349781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 780 | Open in IMG/M |
3300009151|Ga0114962_10010126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6991 | Open in IMG/M |
3300009151|Ga0114962_10274259 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 952 | Open in IMG/M |
3300009151|Ga0114962_10517950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300009151|Ga0114962_10585776 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
3300009154|Ga0114963_10304339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 887 | Open in IMG/M |
3300009154|Ga0114963_10508664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300009154|Ga0114963_10619545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300009160|Ga0114981_10186032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1141 | Open in IMG/M |
3300009164|Ga0114975_10349913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
3300009184|Ga0114976_10383274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
3300009184|Ga0114976_10512426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
3300009502|Ga0114951_10245706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300010157|Ga0114964_10163367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300010157|Ga0114964_10178844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
3300010158|Ga0114960_10077167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1898 | Open in IMG/M |
3300010885|Ga0133913_10033176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13868 | Open in IMG/M |
3300010885|Ga0133913_10622960 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2831 | Open in IMG/M |
3300010885|Ga0133913_11187015 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1958 | Open in IMG/M |
3300010885|Ga0133913_11256301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1895 | Open in IMG/M |
3300013093|Ga0164296_1060001 | All Organisms → Viruses → Predicted Viral | 1761 | Open in IMG/M |
3300013093|Ga0164296_1282925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
3300013094|Ga0164297_10210291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300014811|Ga0119960_1028355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300017723|Ga0181362_1074108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
3300017754|Ga0181344_1004378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4822 | Open in IMG/M |
3300017754|Ga0181344_1005159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4400 | Open in IMG/M |
3300017754|Ga0181344_1131718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300017754|Ga0181344_1192130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300017766|Ga0181343_1185156 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300019783|Ga0181361_121088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300020158|Ga0194038_1102830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300020172|Ga0211729_10958557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
3300020695|Ga0214190_1014821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
3300021124|Ga0214199_1008985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1219 | Open in IMG/M |
3300021125|Ga0214211_1003046 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1974 | Open in IMG/M |
3300021139|Ga0214166_1033428 | All Organisms → Viruses → Predicted Viral | 1200 | Open in IMG/M |
3300022063|Ga0212029_1072909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300022407|Ga0181351_1136565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300022602|Ga0248169_113761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5740 | Open in IMG/M |
3300022748|Ga0228702_1048891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1150 | Open in IMG/M |
3300025338|Ga0208501_108762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300025339|Ga0208502_1012470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300025365|Ga0208621_1010945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1044 | Open in IMG/M |
3300025372|Ga0207957_1031915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300025382|Ga0208256_1020010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1004 | Open in IMG/M |
3300025383|Ga0208250_1037168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300025390|Ga0208743_1038932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 672 | Open in IMG/M |
3300025392|Ga0208380_1024103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 985 | Open in IMG/M |
3300025411|Ga0208865_1004231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3225 | Open in IMG/M |
3300025420|Ga0208111_1037229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
3300025423|Ga0208746_1034787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 842 | Open in IMG/M |
3300025470|Ga0208389_1022221 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1385 | Open in IMG/M |
3300025598|Ga0208379_1048661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1107 | Open in IMG/M |
3300025598|Ga0208379_1077177 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 822 | Open in IMG/M |
3300025777|Ga0208110_1027183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300025778|Ga0208388_1004934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2492 | Open in IMG/M |
3300027627|Ga0208942_1135915 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300027659|Ga0208975_1049120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1300 | Open in IMG/M |
3300027741|Ga0209085_1002432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10627 | Open in IMG/M |
3300027749|Ga0209084_1097790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
3300027749|Ga0209084_1164296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
3300027777|Ga0209829_10091850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1489 | Open in IMG/M |
3300027777|Ga0209829_10359444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300027785|Ga0209246_10146271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 929 | Open in IMG/M |
3300027896|Ga0209777_10319140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1194 | Open in IMG/M |
3300027896|Ga0209777_11026963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027896|Ga0209777_11121089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
3300027917|Ga0209536_101608536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300027973|Ga0209298_10293716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300028025|Ga0247723_1060573 | All Organisms → Viruses → Predicted Viral | 1048 | Open in IMG/M |
3300028392|Ga0304729_1246251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300031726|Ga0302321_101025779 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 940 | Open in IMG/M |
3300031759|Ga0316219_1175103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 781 | Open in IMG/M |
3300031884|Ga0316220_1142439 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300031952|Ga0315294_10741897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 855 | Open in IMG/M |
3300032560|Ga0316223_1125835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300032560|Ga0316223_1180006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300032561|Ga0316222_1051396 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1872 | Open in IMG/M |
3300032562|Ga0316226_1077028 | All Organisms → Viruses → Predicted Viral | 1626 | Open in IMG/M |
3300032562|Ga0316226_1328103 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300032605|Ga0316232_1231187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 725 | Open in IMG/M |
3300032605|Ga0316232_1273820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
3300032665|Ga0316221_1055527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1579 | Open in IMG/M |
3300032665|Ga0316221_1136981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300032668|Ga0316230_1079962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
3300032668|Ga0316230_1121846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
3300032675|Ga0316225_1175477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
3300032676|Ga0316229_1093741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1296 | Open in IMG/M |
3300032722|Ga0316231_1329144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300033995|Ga0335003_0234420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 38.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 18.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 12.23% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 3.60% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.60% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.16% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.16% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.44% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.44% |
Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Lentic | 0.72% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.72% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.72% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.72% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.72% |
Concrete Drainage Pipe Biofilm | Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.72% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.72% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.72% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309002 | Concrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assembly | Environmental | Open in IMG/M |
3300000439 | Trout Bog Lake June 7 2007 Epilimnion (Trout Bog Lake Combined Assembly 48 Epilimnion Samples, Aug 2012 Assem) | Environmental | Open in IMG/M |
3300001847 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a | Environmental | Open in IMG/M |
3300002307 | Lentic bog actinobacteria communities from Grosse Fuchskuhle, Germany - Sample acI-C2 co-culture F-D7 | Environmental | Open in IMG/M |
3300002933 | Combined Assembly of freshwater hypolimnion microbial communities from Trout Bog Lake, Wisconsin, USA | Environmental | Open in IMG/M |
3300003375 | Freshwater actinobacteria microbial communities from Trout Bog Lake, Wisconsin, USA - enrichment TB-E6 | Environmental | Open in IMG/M |
3300003806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH16Oct07 | Environmental | Open in IMG/M |
3300003813 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 | Environmental | Open in IMG/M |
3300003820 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH10Sep07 | Environmental | Open in IMG/M |
3300004095 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE03Jun09 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004684 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (version 2) | Environmental | Open in IMG/M |
3300004692 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (version 2) | Environmental | Open in IMG/M |
3300004694 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE17Sep08 (version 2) | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300004806 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08 | Environmental | Open in IMG/M |
3300004807 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006100 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 | Environmental | Open in IMG/M |
3300006101 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE15Jun09 | Environmental | Open in IMG/M |
3300006104 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09.1 | Environmental | Open in IMG/M |
3300006105 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE07Jul09 | Environmental | Open in IMG/M |
3300006107 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Oct07 | Environmental | Open in IMG/M |
3300006109 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 | Environmental | Open in IMG/M |
3300006110 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Jun09 | Environmental | Open in IMG/M |
3300006113 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 | Environmental | Open in IMG/M |
3300006114 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 | Environmental | Open in IMG/M |
3300006118 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jul07 | Environmental | Open in IMG/M |
3300006119 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 | Environmental | Open in IMG/M |
3300006121 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE05Oct08 | Environmental | Open in IMG/M |
3300006124 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 | Environmental | Open in IMG/M |
3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009502 | Freshwater microbial communities from Finland to study Microbial Dark Matter (Phase II) - AM7a DNA metaG | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300013093 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES057 metaG | Environmental | Open in IMG/M |
3300013094 | Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES058 metaG | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300020158 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L227-6m | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020695 | Freshwater microbial communities from Trout Bog Lake, WI - 15JUL2008 epilimnion | Environmental | Open in IMG/M |
3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
3300021125 | Freshwater microbial communities from Trout Bog Lake, WI - 11AUG2009 epilimnion | Environmental | Open in IMG/M |
3300021139 | Freshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022602 | Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300025338 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE09Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025339 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300025365 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH26May08 (SPAdes) | Environmental | Open in IMG/M |
3300025372 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025382 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025383 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE18Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025390 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH04Jul08 (SPAdes) | Environmental | Open in IMG/M |
3300025392 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Jun07 (SPAdes) | Environmental | Open in IMG/M |
3300025411 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025420 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH08Aug08 (SPAdes) | Environmental | Open in IMG/M |
3300025423 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH15Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025470 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300025598 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE02Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025777 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH13Jun08 (SPAdes) | Environmental | Open in IMG/M |
3300025778 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH18Jul07 (SPAdes) | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027777 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_140205_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031759 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003P | Environmental | Open in IMG/M |
3300031884 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18005 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300032560 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18009 | Environmental | Open in IMG/M |
3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
3300032562 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18017 | Environmental | Open in IMG/M |
3300032605 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025_13 | Environmental | Open in IMG/M |
3300032665 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18007 | Environmental | Open in IMG/M |
3300032668 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18025 | Environmental | Open in IMG/M |
3300032675 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18015 | Environmental | Open in IMG/M |
3300032676 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18023 | Environmental | Open in IMG/M |
3300032722 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18027 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
MiccSOB_01092890 | 2070309002 | Concrete Drainage Pipe Biofilm | KVNMREQRRELRLRFDSNAQGGDYYMGRILLTLNVGDVRSTGNP |
TBL_comb48_EPIDRAFT_10228537 | 3300000439 | Freshwater | PDTLKIDMREQRREMRLRFTSNTEGGNYQLGNVLLSADIGDERSTGNP* |
RCM41_10807171 | 3300001847 | Marine Plankton | SPYSFTPSTLKIDMKEQRREMRLRFSSNVQNGDYFMGRVVLSVETGDVRGTGNP* |
JGI24890J29729_10402551 | 3300002307 | Lentic | KEQRREMRLKFISNERGGDYFMGRVILNVEAGDIRGTGNP* |
G310J44882_101327521 | 3300002933 | Freshwater | PDTLKIDMREQRRELRLKFISNTVNGNYQLGNVLVSADIGDERGTGNP* |
JGI26470J50227_10715853 | 3300003375 | Freshwater | MREQRREMRLRFTSNTFNGTYECGSNILSADIGDVRSTGNP* |
Ga0007864_10028241 | 3300003806 | Freshwater | PTTLKIDMKEQRRELRLRFTSNTQNGNYFLGRTLLSLDTGDIRGSGNP* |
Ga0007879_10068731 | 3300003813 | Freshwater | TLKIDMKEQRREMRLKFESNTQNGNYFMGRVVLNVESGDVRGTGNP* |
Ga0007879_10094004 | 3300003813 | Freshwater | EQRREMRLHFESNTFGGNYELGKVLLSVTTGDSRSTGNP* |
Ga0007863_10107671 | 3300003820 | Freshwater | EQRREMRLRFGSNVTGGNYFMGKVLLSLDTGDSRSTGNP* |
Ga0007829_100703502 | 3300004095 | Freshwater | EQRREMRLRFESNTFNGDYQVGKIILSIETGDVRGTGNP* |
Ga0069718_101029623 | 3300004481 | Sediment | YYFDNTTLKIDLREQRREMRLKFESNEVNGNYECGLNLLSADIGDSRGTGNP* |
Ga0069718_134711401 | 3300004481 | Sediment | TLKIDLREQRREMRLRFESNVVNGNYECGLNLLSADVGDVRSVGNP* |
Ga0065168_10010436 | 3300004684 | Freshwater | MREQRREMRIRFESNTYGGNYQMGKVLLSCEIGDERSTGNP* |
Ga0065168_10082281 | 3300004684 | Freshwater | KIDMREQRREMRLRFTSNTEGGNYQLGNVLLSADIGDERSTGNP* |
Ga0065171_10027001 | 3300004692 | Freshwater | KIDLKEQRREMRLRFSSNVVNGDYFMGRIVLNIETGDVRGTGNP* |
Ga0065170_10044063 | 3300004694 | Freshwater | MKEQRREMRLHFESNTYGGNYQMGKVLISFTVGDVRGTGNP* |
Ga0065170_10191683 | 3300004694 | Freshwater | LKEQRREMRLRFSSNVVNGDYFMGRIVLNIETGDVRGTGNP* |
Ga0007804_10740793 | 3300004770 | Freshwater | TTLKIDMREQRREMRLRFESNVVNGNYECGLNLLSADVGDMRSTGNP* |
Ga0007804_10839531 | 3300004770 | Freshwater | PYLFDESTLKIDMKEQRREMRLKFESNTQNGNYFMGRVVLDVESGDVRGTGNP* |
Ga0007854_100382104 | 3300004806 | Freshwater | SSPYTFDPTTLKIDMKEQRREMRLRFTSNTQNGNYFMGRVVLSVETGDVRGTGNP* |
Ga0007809_100061521 | 3300004807 | Freshwater | KEQRREMRLRIGSNTFGGDYQLGNCIMSVDMGDERGTGSP* |
Ga0007809_100569293 | 3300004807 | Freshwater | TLKIDMREQRREMRLRFESNTYGGTYQMGKNLLSITTGDVRGTGNP* |
Ga0007809_101125532 | 3300004807 | Freshwater | EQRREMRLRFESNTFNGNYQMGKIILSVDTGDVRGTGSP* |
Ga0049085_102689051 | 3300005583 | Freshwater Lentic | TTLKIDLREQRREMRLRFGSNVVNGNYETGLILLSAEGGDERSTGNP* |
Ga0078894_111526643 | 3300005662 | Freshwater Lake | ELRLKFESNTFNGDYFMGRILLSADMGDERSTGNP* |
Ga0007881_10147841 | 3300006072 | Freshwater | YNFDPTTLKVDMREQRREMRLRFTSNTTGGNYFMGKVLLSLDVGDSRSTGNP* |
Ga0007881_10875201 | 3300006072 | Freshwater | NPYLFDESTLKIDMKEQRREMRLKFESNTQNGNYFMGRVVLNVESGDVRGTGNP* |
Ga0007806_10018946 | 3300006100 | Freshwater | KIDMKEQRREMRLHFESNTYGGNYQMGKVLISFTVGDVRGTGNP* |
Ga0007810_10745331 | 3300006101 | Freshwater | KEQRREMRLRFTSNVQNGNYFMGRVVLSIEAGDLRGTGNP* |
Ga0007882_101612041 | 3300006104 | Freshwater | DMKEQRREMRLKFESNTQNGNYFMGRVVLNVESGDVRGTGNP* |
Ga0007819_10033111 | 3300006105 | Freshwater | FREMRMRFESNTYGGNYQMGNVLVHGEAGDVRSTGNPN* |
Ga0007836_10297364 | 3300006107 | Freshwater | DMREQRREMRLRFTSNTEGGNYQLGNVLLSADIGDERSTGNP* |
Ga0007870_10421464 | 3300006109 | Freshwater | MRMRFESNTYGGNYQMGNVLVHGEAGDVRSTGNPN* |
Ga0007871_10362744 | 3300006110 | Freshwater | YLFDESTLKIDMKEQRREMRLKFESNTQNGNYFMGRVVLNVESGDVRGTGNP* |
Ga0007871_10685493 | 3300006110 | Freshwater | TLKIDMKEQRREMRIRFSSNTQNGTYFMGRVVLSVEAGDVRGTGNP* |
Ga0007871_10824202 | 3300006110 | Freshwater | FDESTLKIDMKEQRREMRLKFESNTQNGNYFMGRVVLDVESGDVRGTGNP* |
Ga0007858_10605713 | 3300006113 | Freshwater | REMRLRFESNTFNGDYEMGNILLSADMGDERSTGNP* |
Ga0007858_10902391 | 3300006113 | Freshwater | MRLRIGSNTFGGDYQLGNCIMSVDMGDERGTGSP* |
Ga0007815_10020496 | 3300006114 | Freshwater | QRREMRLRITSNDFGGDYQLGNCLLSVDMGDERSTGSP* |
Ga0007859_10282824 | 3300006118 | Freshwater | LQRREMRLKLISNVAGGNYQMGNCLVSVDIGDERGTGNP* |
Ga0007866_10347984 | 3300006119 | Freshwater | QRRELRLKFISNTVNGNYQLGNVLVSADIGDERGTGNP* |
Ga0007824_10125351 | 3300006121 | Freshwater | REQRREMRLKFESNVTGGNYEMGNLILSVDLGDERGTGNP* |
Ga0007873_10484491 | 3300006124 | Freshwater | EQRREMRLRFTSNTEGGNYQLGNVLLSADIGDERSTGNP* |
Ga0007873_10861143 | 3300006124 | Freshwater | LKIDMKEQRRELRLRFTSNTQNGDYFLGRTLLSLDTGDIRGSGNP* |
Ga0007828_10095515 | 3300006128 | Freshwater | EQRREMRLKFESNVTGGNYEMGNLILSVDLGDERGTGNP* |
Ga0007828_11336483 | 3300006128 | Freshwater | DLKLQRREMRLRIISNVAGGNYEMGNCLLSVDLGDERGTGNP* |
Ga0075464_110734491 | 3300006805 | Aqueous | RRLLRLRFESNTFNGNYYMGKILISADLGDERSTGNP* |
Ga0114973_103497811 | 3300009068 | Freshwater Lake | PYYFDSDTLKIDLREQRREMRLRFQSNVVNGNYETGQNMLSIDVGDERGTGNP* |
Ga0114962_100101261 | 3300009151 | Freshwater Lake | SDPYYFDPDTLKVDMREQRREMRLRFGSNIYNGNYFMGKTLLSLDTGDVRGTGNP* |
Ga0114962_102742591 | 3300009151 | Freshwater Lake | IKIDMREQRREMRLRFESNTENGDYQTGSVMLSLATSDVRSTGNP* |
Ga0114962_105179503 | 3300009151 | Freshwater Lake | PSAPYYFDPDTLKIDIRQQRREMRLRFGSNIVNGNYECGLNFLSADVGDERSTGNP* |
Ga0114962_105857761 | 3300009151 | Freshwater Lake | LKIDMREQRREMRLRFESNTAGGTYQTGRVLLSITTGDVRGTGNP* |
Ga0114963_103043391 | 3300009154 | Freshwater Lake | RREMRLRFESNTQNGNYQMGKVLLLAEAGDERATGNP* |
Ga0114963_105086641 | 3300009154 | Freshwater Lake | QRREMRLRFTSNVAGGNFETGNVLLSAETGDERSTGNP* |
Ga0114963_106195451 | 3300009154 | Freshwater Lake | VDLKIQRREMRLRFSSNVAGGDYFMGNVLIGADLGDVRGDGNP* |
Ga0114981_101860321 | 3300009160 | Freshwater Lake | YEFDPTTLKVDMREQRREMRVRFSSNIFNGNYETGNILLSVDLGDVRSTGNP* |
Ga0114975_103499131 | 3300009164 | Freshwater Lake | EQRREMRLRFESNTAGGTYQTGRVLLSVTTGDVRGTGNP* |
Ga0114976_103832741 | 3300009184 | Freshwater Lake | TTGPYEFDPTTLKVDMREQRREMRVRFSSNIFNGNYETGNILLSVDLGDVRSTGNP* |
Ga0114976_105124261 | 3300009184 | Freshwater Lake | MKEQRREMRLRFVSNVVNGNYQLGKVLLSGDVGDVRGY* |
Ga0114951_102457064 | 3300009502 | Freshwater | TTLKVDMREQRREMRLRFSSNVTDGDYFMGHVLLSLDTGDVRGTGNP* |
Ga0114964_101633673 | 3300010157 | Freshwater Lake | RREMRLRFESNVVNGNYVTGNILVSADAGDVRSTGNP* |
Ga0114964_101788443 | 3300010157 | Freshwater Lake | DMREQRREMRLRFQSNTYNGTYQTGRVLLSLTTGDVRSTGNP* |
Ga0114960_100771671 | 3300010158 | Freshwater Lake | KIDMREQRREMRLRFESNTAGGTYQTGRVLLSITTGDVRGTGNP* |
Ga0133913_100331761 | 3300010885 | Freshwater Lake | MRLRFISNTQNGDFFLGRVVLSIDTGDVRGTGNP* |
Ga0133913_106229601 | 3300010885 | Freshwater Lake | MREQRREMRLRFESNTLNGNYETGQIMLSADIGDERGTGNP* |
Ga0133913_111870151 | 3300010885 | Freshwater Lake | IFSSSTLKIDLKEQRRLMKLKFTSNQTGGSYFMGRVVLNIETGDVRGTGNP* |
Ga0133913_112563011 | 3300010885 | Freshwater Lake | KIDMREQRREMRLRFQSNTYNGTYQTGRVLLSLTTGDVRSTGNP* |
Ga0164296_10600011 | 3300013093 | Freshwater | QRREMRLRFTSNVQNGNYFMGRVILNVEAGDVRGTGSP* |
Ga0164296_12829251 | 3300013093 | Freshwater | LKIDMKEQRREMRLRITSNDFGGDYQLGNCIMSVDMGDERGTGSP* |
Ga0164297_102102911 | 3300013094 | Freshwater | REMRIRFQSNTFNGNYQMGNILLSADFGDERGTGNP* |
Ga0119960_10283551 | 3300014811 | Aquatic | VVVVVLLCFPVTIEVDMREQRREMRLRFGSNTTNRNYFMGKVLLSLDTGDVRSTGNP* |
Ga0181362_10741083 | 3300017723 | Freshwater Lake | MREQRREMRLKFESNIVNGNYETGQILLSADFGDERGTGNP |
Ga0181344_10043785 | 3300017754 | Freshwater Lake | LKIDMKEQRREMRLKFTSNRVNGDYFMGRVVMNIETGDVRGTGNP |
Ga0181344_10051595 | 3300017754 | Freshwater Lake | VDMREQRREMRMRFGSNTQNGNYYAGRILLSLETGDVRGTGNP |
Ga0181344_11317181 | 3300017754 | Freshwater Lake | QPSPPVYFAPDALKVDMREQRREMRMRFGSNTLGGNYFMGKVLLSLDTGDVRGTGNP |
Ga0181344_11921301 | 3300017754 | Freshwater Lake | DMREQRREMRLRFISNEAGGTYQTGRVLLSMTTGDTRGTGNP |
Ga0181343_11851561 | 3300017766 | Freshwater Lake | LKVDMREQRREMRMRFGSNTVNGNYFMGKVLLSIDTGDVRGTGNP |
Ga0181361_1210881 | 3300019783 | Freshwater Lake | REQRREMRVRFSSNIFNGNYETGNILLSVDLGDVRSTGNP |
Ga0194038_11028303 | 3300020158 | Anoxic Zone Freshwater | REQRREMRIRFESNIARGDYEAGQVLISADFGDERGTGNP |
Ga0211729_109585571 | 3300020172 | Freshwater | PSTLKLDLREQRREMRLKFISNTVNGNYQMGNVLISADIGDERSTGNP |
Ga0214190_10148214 | 3300020695 | Freshwater | TTLKIDMKEQRREMRLKIGSNTYNGDYQLGNCVMSVDLGDERGTGSP |
Ga0214199_10089854 | 3300021124 | Freshwater | EMRLRFESNTQDGNYFLGRVVLNVETGDVRGTGNP |
Ga0214211_10030461 | 3300021125 | Freshwater | FDPTTLKVDMREQRREMRLRFTSNTTGGNYFMGKVLLSLDVGDSRSTGNP |
Ga0214166_10334281 | 3300021139 | Freshwater | QRREMRIRFTSNTQNGNYFMGRVILNVETGDVRGTGSP |
Ga0212029_10729091 | 3300022063 | Aqueous | NPDTLKIDMKEQRREMRLRFRSNTQNGDYFMGRVLLSIDTGDVRGTGNP |
Ga0181351_11365651 | 3300022407 | Freshwater Lake | TEKIDMREQRREMRLRFESNVVNGNYVTGNILLSCEAGDIRGEGNP |
Ga0248169_1137615 | 3300022602 | Freshwater | LKIDLKEQRREMRIRFTSNTQNGNYFMGRVILNVETGDVRGTGNP |
Ga0228702_10488911 | 3300022748 | Freshwater | EMRLRFTSNVQNGDYFMGRVLLSVETGDVRGTGNP |
Ga0208501_1087621 | 3300025338 | Freshwater | LKIDMREQRREMRIRFESNVVNGNYETGNILISAEVGDMRGTGNP |
Ga0208502_10124703 | 3300025339 | Freshwater | EIRLKFISNVSNGDYFLGKVVLNIDTGDVRGTGNP |
Ga0208621_10109454 | 3300025365 | Freshwater | QRRELRLRFTSNTQNGDYFLGRTLLSLDTGDIRGSGNP |
Ga0207957_10319151 | 3300025372 | Freshwater | EQRREMRLRFSSNVVNGDYFMGRIVLNIETGDVRGTGNP |
Ga0208256_10200103 | 3300025382 | Freshwater | LKIDMKEQRREMRLKFISNVSNGDYFLGKVVLNIDTGDVRGTGNP |
Ga0208250_10371681 | 3300025383 | Freshwater | QPSVMYNFDPGTLKIDMKEQRREMRLHFESNTYGGNYQMGKVLISFTVGDVRGTGNP |
Ga0208743_10389321 | 3300025390 | Freshwater | QRREMRLRFTSNTQNGNYFMGRVVLSVETGDVRGTGNP |
Ga0208380_10241033 | 3300025392 | Freshwater | MKEQRREMRLKFISNVSNGDYFLGKVVLNIDTGDVRGTGNP |
Ga0208865_10042311 | 3300025411 | Freshwater | QRREMRLRITSNDFGGDYQLGNCLLSVDMGDERSTGSP |
Ga0208111_10372293 | 3300025420 | Freshwater | REMRLRFESNTFNGDYEMGNILLSADMGDERSTGNP |
Ga0208746_10347874 | 3300025423 | Freshwater | MKEQRREMRLRIGSNTFGGDYQLGNCIMSVDMGDERSTGNP |
Ga0208389_10222211 | 3300025470 | Freshwater | YNFDPTTLKVDMREQRREMRLRFTSNTTGGNYFMGKVLLSLDVGDSRSTGNP |
Ga0208379_10486614 | 3300025598 | Freshwater | KEQRREMRLRIGSNTFGGDYQLGNCIMSVDMGDERGTGSP |
Ga0208379_10771771 | 3300025598 | Freshwater | EQRREMRLRFESNTFNGNYQMGKIILSVDTGDVRGTGSP |
Ga0208110_10271831 | 3300025777 | Freshwater | FDPTTLKVDMREQRREMRLRFGSNVTGGNYFMGKVLLSLDTGDSRSTGNP |
Ga0208388_10049341 | 3300025778 | Freshwater | TLKIDMKEQRREMRLKFISNVSNGDYFLGKVVLNIDTGDVRGTGNP |
Ga0208942_11359151 | 3300027627 | Freshwater Lentic | LKIDLREQRREMRLRFGSNVVNGNYETGLILLSAEGGDERSTGNP |
Ga0208975_10491203 | 3300027659 | Freshwater Lentic | KIDLREQRREMRLRFESNVVNGNYECGLNLLSADVGDMRSTGNP |
Ga0209085_10024321 | 3300027741 | Freshwater Lake | LTALFPDTLKVDMREQRREMRLRFGSNIYNGNYFMGKTLLSLDTGDVRGTGNP |
Ga0209084_10977901 | 3300027749 | Freshwater Lake | LKIDMREQRREMRLRFQSNTYNGTYQTGRVLLSLTTGDVRSTGNP |
Ga0209084_11642963 | 3300027749 | Freshwater Lake | REMRLRFESNTENGDYQTGSVMLSLATSDVRSTGNP |
Ga0209829_100918503 | 3300027777 | Freshwater Lake | YDPDTLKIDLREQRREMRLRFTSNVAGGNFETGNVLLSAETGDERSTGNP |
Ga0209829_103594443 | 3300027777 | Freshwater Lake | REMRLRFISNTQNGDFFLGRVVLSIDTGDVRGTGNP |
Ga0209246_101462711 | 3300027785 | Freshwater Lake | DTLKVDMREQRREMRLRFGSNTVNGNYFMGKVLLNLDTGDVRGTGNP |
Ga0209777_103191404 | 3300027896 | Freshwater Lake Sediment | KIDLKLQRREMRLRIISNVAGGNYQTGNCLLSVDLGDERGTGNP |
Ga0209777_110269631 | 3300027896 | Freshwater Lake Sediment | DPYNFDPTTLKIDMKEQRRELRLRFTSNTQNGDYFMGRVVLSVDTGDVRGTGNP |
Ga0209777_111210893 | 3300027896 | Freshwater Lake Sediment | KIDIREQRREMRLRFESNVVNGNYECGLNLLSADVGDMRSTGNP |
Ga0209536_1016085363 | 3300027917 | Marine Sediment | TTNKIDMKEQRREMRLRFESDQAGGDYQMGRVILNATFGDVRGY |
Ga0209298_102937163 | 3300027973 | Freshwater Lake | EQRREMRLRFTSNTQNGNYFMGRIVLSIDTGDVRGNGNP |
Ga0247723_10605731 | 3300028025 | Deep Subsurface Sediment | RRLLRLKFESNTFNGDYYMGKILISADMGDERSTGNP |
Ga0304729_12462513 | 3300028392 | Freshwater Lake | DMREQRREMRLRFQSNTYNGTYQTGRVLLSLTTGDVRSTGNP |
Ga0302321_1010257793 | 3300031726 | Fen | DPTTLKIDLKEQRREMRLRFSSNTQNGNYFMGRIILSVDTGDVRGNGTP |
Ga0316219_11751033 | 3300031759 | Freshwater | STTLKIDMREQRREMRLKFISNTVGGNYQLGNVLISADVGDERGTGNP |
Ga0316220_11424391 | 3300031884 | Freshwater | DMKEQRREMRLKFESNTQNGNYFMGRVVLNVESGDVRGTGNP |
Ga0315294_107418973 | 3300031952 | Sediment | RREMRLRFGSNVVNGNYETGLILLSAEGGDERSTGNP |
Ga0316223_11258351 | 3300032560 | Freshwater | QRREMRLRFESNTQDGNYFLGRVVLNVETGDVRGTGNP |
Ga0316223_11800061 | 3300032560 | Freshwater | KIDMREQRREMRLKFISNTVGGNYQLGNVLISADVGDERGTGNP |
Ga0316222_10513965 | 3300032561 | Freshwater | STTLKIDMKEQRREMRLRFTSNTQNGNYFMGRVVLSVETGDVRGTGNP |
Ga0316226_10770281 | 3300032562 | Freshwater | TLKIDMKEQRREMRLRFTSNVQNGNYFMGRVILNVEAGDVRGTGSP |
Ga0316226_13281033 | 3300032562 | Freshwater | TLKIDMKEQRREMRLRFTSNDYNGNYQCGNILLHADLGDVRSTGNP |
Ga0316232_12311873 | 3300032605 | Freshwater | DSTTLKIDMREQRREMRLKFISNTVGGNYQLGNVLISADVGDERGTGNP |
Ga0316232_12738201 | 3300032605 | Freshwater | QRREMRLRIGSNTYNGDYQLGNCIMSVDLGDERGTGSP |
Ga0316221_10555271 | 3300032665 | Freshwater | PYSYDYNTLKIDMKEQRREMRLRFISNTVNGNYFMGRVVLNVETGDVRGTGNP |
Ga0316221_11369811 | 3300032665 | Freshwater | EMRLKFESNVTGGNYEMGNLILSVDIGDERGTGNP |
Ga0316230_10799621 | 3300032668 | Freshwater | LKIDMKEQRREMRLRFTSNTQNGNYFMGRVVLSVETGDVRGTGNP |
Ga0316230_11218464 | 3300032668 | Freshwater | QRREMRLRFTSNVSGGNYETGNILLSADIGDERSTGNP |
Ga0316225_11754773 | 3300032675 | Freshwater | LKVDMREQRRELRMRFESNIVNGNYETGNILISAEIGDVRSTGNP |
Ga0316229_10937414 | 3300032676 | Freshwater | TPSTLKIDMKEQRREMRLRITSNTFGGDYQLGNCLMSVDIGDERSTGNPN |
Ga0316231_13291443 | 3300032722 | Freshwater | RREMRLRFESNTQDGNYFLGRVVLNVETGDVRGTGNP |
Ga0335003_0234420_737_856 | 3300033995 | Freshwater | EQRREMRLRFQSNVVNGNFQMGRILLSAEIGDVRGTGNP |
⦗Top⦘ |