NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F054659

Metagenome Family F054659

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054659
Family Type Metagenome
Number of Sequences 139
Average Sequence Length 45 residues
Representative Sequence VRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG
Number of Associated Samples 102
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 31.65 %
% of genes near scaffold ends (potentially truncated) 28.78 %
% of genes from short scaffolds (< 2000 bps) 86.33 %
Associated GOLD sequencing projects 100
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (94.964 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(33.093 % of family members)
Environment Ontology (ENVO) Unclassified
(40.288 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.885 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF05697Trigger_N 48.92
PF05698Trigger_C 10.07
PF06305LapA_dom 9.35
PF01510Amidase_2 2.88
PF01364Peptidase_C25 2.16
PF00654Voltage_CLC 1.44
PF06689zf-C4_ClpX 1.44
PF01612DNA_pol_A_exo1 0.72
PF01594AI-2E_transport 0.72
PF00573Ribosomal_L4 0.72
PF02535Zip 0.72
PF10589NADH_4Fe-4S 0.72
PF00133tRNA-synt_1 0.72
PF03781FGE-sulfatase 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG0544FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor)Posttranslational modification, protein turnover, chaperones [O] 58.99
COG3771Lipopolysaccharide assembly protein YciS/LapA, DUF1049 familyCell wall/membrane/envelope biogenesis [M] 9.35
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 1.44
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG0088Ribosomal protein L4Translation, ribosomal structure and biogenesis [J] 0.72
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG0428Zinc transporter ZupTInorganic ion transport and metabolism [P] 0.72
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.72
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.72
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.96 %
UnclassifiedrootN/A5.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105315751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria808Open in IMG/M
3300003267|soilL1_10095627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1456Open in IMG/M
3300003987|Ga0055471_10025267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1466Open in IMG/M
3300003996|Ga0055467_10148593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales700Open in IMG/M
3300003997|Ga0055466_10184830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales609Open in IMG/M
3300003998|Ga0055472_10036339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1182Open in IMG/M
3300004081|Ga0063454_100246202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1066Open in IMG/M
3300004114|Ga0062593_101035606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales845Open in IMG/M
3300004157|Ga0062590_101709849All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales641Open in IMG/M
3300004463|Ga0063356_100555465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1537Open in IMG/M
3300004479|Ga0062595_100986740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales722Open in IMG/M
3300004480|Ga0062592_101042213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales751Open in IMG/M
3300004643|Ga0062591_100121657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1747Open in IMG/M
3300005093|Ga0062594_100028271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2519Open in IMG/M
3300005093|Ga0062594_100695913All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales916Open in IMG/M
3300005438|Ga0070701_10850662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei626Open in IMG/M
3300005441|Ga0070700_100038516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2914Open in IMG/M
3300005549|Ga0070704_102190862Not Available514Open in IMG/M
3300005578|Ga0068854_100287058All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1327Open in IMG/M
3300005981|Ga0081538_10000758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia35238Open in IMG/M
3300006844|Ga0075428_100008251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia11548Open in IMG/M
3300006845|Ga0075421_100396688All Organisms → cellular organisms → Bacteria1658Open in IMG/M
3300006846|Ga0075430_100603288All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales906Open in IMG/M
3300006847|Ga0075431_100310193All Organisms → cellular organisms → Bacteria1593Open in IMG/M
3300006847|Ga0075431_101005272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales801Open in IMG/M
3300006880|Ga0075429_101396508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales610Open in IMG/M
3300006894|Ga0079215_10085512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1344Open in IMG/M
3300006894|Ga0079215_11079718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales599Open in IMG/M
3300006918|Ga0079216_11747279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales532Open in IMG/M
3300007004|Ga0079218_11352923All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales755Open in IMG/M
3300009094|Ga0111539_10165526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2585Open in IMG/M
3300009094|Ga0111539_10351506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1715Open in IMG/M
3300009094|Ga0111539_11203406All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300009094|Ga0111539_12436746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300009100|Ga0075418_11357949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria771Open in IMG/M
3300009148|Ga0105243_11428144All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales713Open in IMG/M
3300009156|Ga0111538_12911339Not Available599Open in IMG/M
3300009789|Ga0126307_10043601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3490Open in IMG/M
3300009789|Ga0126307_10077081All Organisms → cellular organisms → Bacteria2629Open in IMG/M
3300009789|Ga0126307_10174424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1723Open in IMG/M
3300009840|Ga0126313_10111407All Organisms → cellular organisms → Bacteria2026Open in IMG/M
3300009840|Ga0126313_10703266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales819Open in IMG/M
3300010036|Ga0126305_10756843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales659Open in IMG/M
3300010037|Ga0126304_10127819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1628Open in IMG/M
3300010038|Ga0126315_10002249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album7939Open in IMG/M
3300010039|Ga0126309_10043377All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300010039|Ga0126309_10686456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300010040|Ga0126308_10137606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1532Open in IMG/M
3300010040|Ga0126308_10379972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales940Open in IMG/M
3300010040|Ga0126308_11324769Not Available511Open in IMG/M
3300010041|Ga0126312_10666016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales750Open in IMG/M
3300010042|Ga0126314_10016396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4389Open in IMG/M
3300010044|Ga0126310_10030309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2831Open in IMG/M
3300010044|Ga0126310_10962158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria670Open in IMG/M
3300010045|Ga0126311_11390316Not Available585Open in IMG/M
3300010166|Ga0126306_10111165Not Available1994Open in IMG/M
3300010399|Ga0134127_10177141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1963Open in IMG/M
3300010399|Ga0134127_13534018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300010400|Ga0134122_11433230All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300010403|Ga0134123_12472130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales585Open in IMG/M
3300012204|Ga0137374_10024698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album6717Open in IMG/M
3300012905|Ga0157296_10203690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300012915|Ga0157302_10171697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales755Open in IMG/M
3300014487|Ga0182000_10350788All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300015077|Ga0173483_10089135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300015077|Ga0173483_10924473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300015371|Ga0132258_10412182All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3359Open in IMG/M
3300018422|Ga0190265_10018596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5484Open in IMG/M
3300018422|Ga0190265_10288949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1705Open in IMG/M
3300018422|Ga0190265_11123442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300018422|Ga0190265_11216260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria872Open in IMG/M
3300018422|Ga0190265_13056078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus559Open in IMG/M
3300018422|Ga0190265_13279008Not Available540Open in IMG/M
3300018422|Ga0190265_13407972Not Available530Open in IMG/M
3300018429|Ga0190272_10273244All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300018429|Ga0190272_11278984All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300018429|Ga0190272_11494127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales686Open in IMG/M
3300018429|Ga0190272_11568960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium673Open in IMG/M
3300018429|Ga0190272_12191430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus592Open in IMG/M
3300018432|Ga0190275_10560367All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300018432|Ga0190275_12079004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus647Open in IMG/M
3300018466|Ga0190268_10616159All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300018466|Ga0190268_12174159All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300018466|Ga0190268_12378979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus502Open in IMG/M
3300018469|Ga0190270_10012231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → Thermoleophilum → Thermoleophilum album4928Open in IMG/M
3300018476|Ga0190274_11205630All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus841Open in IMG/M
3300018920|Ga0190273_12114857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales526Open in IMG/M
3300019361|Ga0173482_10123919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300019767|Ga0190267_10597756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300019867|Ga0193704_1042438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria903Open in IMG/M
3300021078|Ga0210381_10412213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300022883|Ga0247786_1031547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1033Open in IMG/M
3300022898|Ga0247745_1033114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria777Open in IMG/M
3300025901|Ga0207688_10030219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2987Open in IMG/M
3300025919|Ga0207657_11460063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300025937|Ga0207669_10505070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria968Open in IMG/M
3300025945|Ga0207679_11823704All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300026041|Ga0207639_12212164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria511Open in IMG/M
3300026075|Ga0207708_10637745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria906Open in IMG/M
3300026121|Ga0207683_10532023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300027873|Ga0209814_10065306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1526Open in IMG/M
3300027880|Ga0209481_10191416All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300027907|Ga0207428_11144840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300028587|Ga0247828_10123335All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1262Open in IMG/M
3300028705|Ga0307276_10018405All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. CPCC 2047081343Open in IMG/M
3300028705|Ga0307276_10079891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales767Open in IMG/M
3300028707|Ga0307291_1090908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300028717|Ga0307298_10236147All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300028719|Ga0307301_10054712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1232Open in IMG/M
3300028721|Ga0307315_10136159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300028722|Ga0307319_10022601All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300028722|Ga0307319_10070263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1108Open in IMG/M
3300028755|Ga0307316_10356617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300028755|Ga0307316_10402850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus507Open in IMG/M
3300028778|Ga0307288_10374985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus576Open in IMG/M
3300028811|Ga0307292_10225647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria774Open in IMG/M
3300028812|Ga0247825_10048958All Organisms → cellular organisms → Bacteria2808Open in IMG/M
3300028878|Ga0307278_10182899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria936Open in IMG/M
3300028880|Ga0307300_10162518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria708Open in IMG/M
3300028881|Ga0307277_10170925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300030336|Ga0247826_11342446All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales577Open in IMG/M
3300031152|Ga0307501_10011654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1488Open in IMG/M
3300031152|Ga0307501_10088723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300031152|Ga0307501_10199100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300031548|Ga0307408_101263119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300031548|Ga0307408_102432668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales509Open in IMG/M
3300031731|Ga0307405_12003954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300031824|Ga0307413_10448804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1023Open in IMG/M
3300031852|Ga0307410_10261132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1351Open in IMG/M
3300031852|Ga0307410_10726127All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300031901|Ga0307406_10062969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2401Open in IMG/M
3300031901|Ga0307406_12017899All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Janibacter → Janibacter limosus516Open in IMG/M
3300031995|Ga0307409_101214429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300032002|Ga0307416_101266294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria843Open in IMG/M
3300032002|Ga0307416_102748498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300032080|Ga0326721_10328230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei863Open in IMG/M
3300032126|Ga0307415_102397875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium neworleansense519Open in IMG/M
3300033550|Ga0247829_11295224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria603Open in IMG/M
3300034176|Ga0364931_0329480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei509Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil33.09%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil13.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere10.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere8.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.04%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.44%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.44%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.44%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.72%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.72%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.72%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.72%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.72%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.72%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.72%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.72%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300003997Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D1EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300014487Bulk soil microbial communities from Mexico - Magueyal (Ma) metaGEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031731Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1Host-AssociatedOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300031852Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3Host-AssociatedOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031995Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2Host-AssociatedOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10531575123300000364SoilVRRPLTEKLQAWIVTGPLGHLWSALADMTLIWARYLAHRAKRS*
soilL1_1009562723300003267Sugarcane Root And Bulk SoilLAAVRRPATERLQAWIVTGPLGHLWSALTDMVLIWARYLAYRARGRA*
Ga0055471_1002526743300003987Natural And Restored WetlandsRRTAAERLQAWIVTGPLGHLWSALTDMVLIWARYLLHRARGRA*
Ga0055467_1014859313300003996Natural And Restored WetlandsKAHERFTAWVVTGPAGHLWSALADMAIIWARWLARRARRGLSRGAG*
Ga0055466_1018483023300003997Natural And Restored WetlandsVKARDSATAWIVTGPIGHLWSALADMTLIWVRYLAHRARGGAR*
Ga0055472_1003633923300003998Natural And Restored WetlandsVKARDSATAWIVTGPLGHLWSALADMTLIWVRYLAHRARGGAR*
Ga0063454_10024620213300004081SoilAEQLRAWIVTGPIGHLWSAIADITLLWARYLANRARGRV*
Ga0062593_10103560623300004114SoilLPPVLRRPAAEKLQAWIVTGPLGHLWSALADVTIIWARYVMNRARGRV*
Ga0062590_10170984923300004157SoilLPQVLRRPASEKLHAWIVTGPLGHLWSALTDMILIWARYLAHRARGRA*
Ga0063356_10055546523300004463Arabidopsis Thaliana RhizosphereVAPVRRPVAEKLRAWIVTGPIGHLWSALADMALIWARYLAHRARRG*
Ga0062595_10098674033300004479SoilLAPVSRPAAEKLHAWVITGPLGHLWSAGADITLIWARYLAHRARMRGAR*
Ga0062592_10104221323300004480SoilVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS*
Ga0062591_10012165723300004643SoilMRGASLPSVRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG*
Ga0062594_10002827123300005093SoilLPPVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARYLANRARGRV*
Ga0062594_10069591323300005093SoilLPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWARYFANRARGRA*
Ga0070701_1085066213300005438Corn, Switchgrass And Miscanthus RhizosphereVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARYLANRARGR
Ga0070700_10003851623300005441Corn, Switchgrass And Miscanthus RhizosphereLPRVLRRTASEKLQAWIVTGPLGHLWSALADMILIWARYLAHRARGRA*
Ga0070704_10219086213300005549Corn, Switchgrass And Miscanthus RhizosphereVAPVRRPAAEKLHAWIVTGPIGHLWSALTDMALIWARYLAR
Ga0068854_10028705823300005578Corn RhizosphereLPPVRRPPAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRV*
Ga0081538_10000758253300005981Tabebuia Heterophylla RhizosphereVRRRPPEQLKAWFVTGPIGHLWSVLADITVLLVRYGVWRLRGRRA*
Ga0075428_10000825143300006844Populus RhizosphereLPRVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG*
Ga0075421_10039668823300006845Populus RhizosphereVRRRPAAEQLQAWIVTGPIGHFWSAMADITLIWARYLANRMRGRV*
Ga0075430_10060328823300006846Populus RhizosphereVRRTAAERLQAWIVTGPLGHLWSALADMVLIWARYLPHRARGRA*
Ga0075431_10031019323300006847Populus RhizosphereVRRRPAAEQLQAWIVTGPIGHFWSAMTDITLLWARYLANRLRGRV*
Ga0075431_10100527223300006847Populus RhizosphereVRRTAAERLQAWIVTGPLGHLWSALADMVLIWARYLVHRARGRA*
Ga0075429_10139650823300006880Populus RhizosphereLVKAQERFSAWLVTGPLGHLWSALTDMILIWARYLAHRARGRA*
Ga0079215_1008551223300006894Agricultural SoilVRRTAAERLQAWIVTGPLGHLWSALTDMVLIWARYLAHRARRRV*
Ga0079215_1107971823300006894Agricultural SoilMRRPATERLQAWIVTGPLGHLWSALADMTAIWARWLVNRARGRA*
Ga0079216_1174727923300006918Agricultural SoilVRRTAAERLHAWILTGPLGHLWSALTDMVLIWARYLANRARGRV*
Ga0079218_1135292323300007004Agricultural SoilVRRTAAERLQAWIVTGPLGHLWSALTDMVLIWARYLAHRAR
Ga0111539_1016552633300009094Populus RhizosphereLRAVRRRPVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRVRGRV*
Ga0111539_1035150633300009094Populus RhizosphereVLRRPASEKLQAWIVTGPLGHLWSSLTDMVLIWMRYLAHRARGRA*
Ga0111539_1120340623300009094Populus RhizosphereVRRRLAAEQLQAWIVTGPIGHFWSAMTDITLLWARYLANRLRGRV*
Ga0111539_1243674623300009094Populus RhizosphereVRRTAVERLQAWIVTGPLGHLWSALTDMILIWARYLAHRARGRV*
Ga0075418_1135794923300009100Populus RhizosphereVLRRPASEKLQAWIVTGPLGHLWSALADIAVALARYGFSRLR
Ga0105243_1142814423300009148Miscanthus RhizosphereLTSVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG*
Ga0111538_1291133923300009156Populus RhizosphereRPVTEKLQAWIITGPLGHLWSALADMTLIWVRYLAHRARRS*
Ga0126307_1004360153300009789Serpentine SoilLVRVRRPAAEKFQAWIVTGPLGHLWSALADMTRIWVRYLAHRARRG*
Ga0126307_1007708123300009789Serpentine SoilLVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWARYLAHRARRG*
Ga0126307_1017442423300009789Serpentine SoilMTYASRVRRRPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG*
Ga0126313_1011140743300009840Serpentine SoilVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLAHRARRG*
Ga0126313_1070326623300009840Serpentine SoilVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLARRARRG*
Ga0126305_1075684323300010036Serpentine SoilLVRVRRPAAEKFQAWIVTGPLGHLWSALVDMTRIWVRYLAHRARRG*
Ga0126304_1012781933300010037Serpentine SoilMTYASRVRRRPGERLQAWIVTGPLGHLWSALADMTPIWVRYLAHRA
Ga0126315_1000224953300010038Serpentine SoilVRRRPAAEQLQAWIVTGPIGHLWSAMVDITLIWARYLANRVRGRA*
Ga0126309_1004337723300010039Serpentine SoilVRRPAAEQLQAWIVTGPLGHLWSAGADITLIWARYVANRARGRT*
Ga0126309_1068645623300010039Serpentine SoilVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG*
Ga0126308_1013760643300010040Serpentine SoilSLRAVRRRPAAEQLQAWIVTGPIGHFWSAMTDITLIWARYLANRVRGRV*
Ga0126308_1037997223300010040Serpentine SoilVRRAAAERLQAWIVTGPLGHLWSALADMVLIWARYLAHRARRRV*
Ga0126308_1132476923300010040Serpentine SoilVRRAASDRVQAWIVTGPIGHLWSAGADITLIWARYFANRARRRA*
Ga0126312_1066601623300010041Serpentine SoilVRRPAAEKLQAWIVTGPLGHLWSALADMAAIWARYLARRARRG*
Ga0126314_1001639623300010042Serpentine SoilVRRRPAAEQLQAWIVTGPIGHLWSAMVDITLIWARYLAKRVRGRA*
Ga0126310_1003030933300010044Serpentine SoilVRRRPPAEQVQAWIVTGPLGHLWSALADMTIIWARYIANRARGRV*
Ga0126310_1096215813300010044Serpentine SoilVAPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLA
Ga0126311_1139031623300010045Serpentine SoilLRAVRRRPAAEQLQAWIVTGPIGHFWSAMTDITLIWARYLANRVRGRV*
Ga0126306_1011116523300010166Serpentine SoilVRRRPAAEQLQAWIVTGPIGHLWSAMLDITLIWARYLANRVRGRV*
Ga0134127_1017714133300010399Terrestrial SoilLPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWARYFTNRARGCA*
Ga0134127_1353401813300010399Terrestrial SoilVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWARYLAHRARRG*
Ga0134122_1143323023300010400Terrestrial SoilLPWVRRRPAAERLQAWIVTGPLGHLWSALADVTIIWTRYLVNRARGRAQ*
Ga0134123_1247213023300010403Terrestrial SoilLPFVRRPITEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS*
Ga0137374_1002469843300012204Vadose Zone SoilVAPVRRPAAEKLEAWIVTGPIGHLWSAVADMAVIWVRYLAHRARRG*
Ga0157296_1020369023300012905SoilVRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG*
Ga0157302_1017169723300012915SoilLPPVRRPPAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRG*
Ga0182000_1035078823300014487SoilCSGVSVAPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLAHRARRG*
Ga0173483_1008913523300015077SoilLPPVRRPAAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRV*
Ga0173483_1092447323300015077SoilLPPVLRRPAAEKLQAWIVTGPLGHLWSALADVTIIWARYVMNR
Ga0132258_1041218233300015371Arabidopsis RhizosphereVRRRPVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRVRGRV*
Ga0190265_1001859633300018422SoilLVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS
Ga0190265_1028894923300018422SoilMTYASRVRRPPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG
Ga0190265_1112344223300018422SoilMRRPATERLQAWIVTGPLGHLWSALADMTAIWTRWLVHRARGRA
Ga0190265_1121626033300018422SoilVRRSPAEKLRAWIVTGPLGHLWSALADMALLWARYLAHRARRRISRGAG
Ga0190265_1305607813300018422SoilVRRPAAEKLKAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG
Ga0190265_1327900813300018422SoilRPAAEKAVAWIVTGPLGHLWSALADMTAIWARYLVNRARGRA
Ga0190265_1340797213300018422SoilVRRPATEKLQAWVVTGPLGHLWSALADMALLWARYLAHRARRRISRGAG
Ga0190272_1027324413300018429SoilMGLMTYASRVRRRPGERLRAWVLTGPLGHLWSALADMTLIWVRYLAHRARRG
Ga0190272_1127898413300018429SoilLVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWVRYL
Ga0190272_1149412723300018429SoilLARVRRPVAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0190272_1156896023300018429SoilMGLMAYASRVRRRPGERLRAWVLTGPLGHLWSALADMTLIWVRYLAHRARRG
Ga0190272_1219143023300018429SoilGRVMTYASRVRRPPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG
Ga0190275_1056036713300018432SoilVRRPAAEKLQAWMVTGPLGHLWSALADMTVLWVRYLAQRARRG
Ga0190275_1207900413300018432SoilLLRVHRPAVEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARGG
Ga0190268_1061615913300018466SoilRLQAWIVTGPIGHLWSALADMILIWARYLVHRARGRA
Ga0190268_1217415933300018466SoilVRRPSAERLQAWIVTGPLGHLWSALADMALIWARYLAHRARRG
Ga0190268_1237897913300018466SoilVKAHERFTAWVVTGPLGHFWSAAADMATIWARWLAHRARGRA
Ga0190270_1001223153300018469SoilVKPLDRARAWLVTGPLGHLWSALVDMTLIWARYLAHRARAGAR
Ga0190274_1120563013300018476SoilVRRPAAEKLHAWIVTGPLGHLWSALADMTVIWARYLAHRARRG
Ga0190273_1211485723300018920SoilLVRVRRPAAEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRD
Ga0173482_1012391923300019361SoilLPPVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARYLANRARGRV
Ga0190267_1059775613300019767SoilLPRVLRRTASEKLQAWIVTGPLGHLWSALADMTLIWTRWLANRARGRV
Ga0193704_104243823300019867SoilVAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWARYLVHRARRG
Ga0210381_1041221313300021078Groundwater SedimentLPPVRRPATEKLHAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0247786_103154713300022883SoilLPPVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWAR
Ga0247745_103311423300022898SoilLPPVRRPAAEKLQAWIVTGPLGHLWSALADMSIIWARYLANRARGRV
Ga0207688_1003021943300025901Corn, Switchgrass And Miscanthus RhizosphereLPRVLRRTASEKLQAWIVTGPLGHLWSALADMILIWARYLAHRARGRA
Ga0207657_1146006323300025919Corn RhizosphereLPRVLRRPASEKLQAWIVTGPLGHLWSSLTDVVLIWARYLANRARGRV
Ga0207669_1050507023300025937Miscanthus RhizosphereLPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWARYFANRARGRA
Ga0207679_1182370413300025945Corn RhizosphereASEKLQAWIVTGPLGHLWSSLTDVVLIWARYLANRARGRV
Ga0207639_1221216413300026041Corn RhizosphereVRRPAAEKLHAWIVTGPLGHLWSALADMSIIWARY
Ga0207708_1063774513300026075Corn, Switchgrass And Miscanthus RhizosphereLPFVRRPITEKLQAWIVTGPLGHLWSALADMTLIWVR
Ga0207683_1053202313300026121Miscanthus RhizosphereLPLVRRPLAEKLQAWVVTGPLGHLWSAMADIVLLWA
Ga0209814_1006530623300027873Populus RhizosphereLPRVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0209481_1019141623300027880Populus RhizosphereVRRRPAAEQLQAWIVTGPIGHFWSAMADITLIWARYLANRMRGRV
Ga0207428_1114484023300027907Populus RhizosphereVRRRPVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRV
Ga0247828_1012333523300028587SoilLPRVLRRTASEKLQAWIVTGPLGHLWSALTDMILIWARYLAHRARGRA
Ga0307276_1001840533300028705SoilLRAVPRRPAAERLQAWIVTGPIGHLWSALADMTLIWSRYLANRARGRV
Ga0307276_1007989123300028705SoilVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG
Ga0307291_109090813300028707SoilVAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWARYLVHRAR
Ga0307298_1023614723300028717SoilRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG
Ga0307301_1005471223300028719SoilVAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWVRYLAHRARRG
Ga0307315_1013615923300028721SoilVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWARYLA
Ga0307319_1002260143300028722SoilVIAYASNVRRGPGERLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRG
Ga0307319_1007026323300028722SoilLPQVLRRPASEKLHAWIVTGPLGHLWSALTDMILIWARYLAHRARGRA
Ga0307316_1035661723300028755SoilMRGASLPSVRRPAAEKLQAWIVTGPLGHLWSALADMTVIWA
Ga0307316_1040285023300028755SoilLPQVLRRPASEKLHAWIVTGPLGHLWSALTDMILIWARYLVHRARGRA
Ga0307288_1037498513300028778SoilRRPVAEQLQAWIVTGPVGHLWSATADITLIWTRYLANRARGRV
Ga0307292_1022564723300028811SoilLPPVRRRPVAEQLQAWIVTGPVGHLWSATADITLIWTRYLANRARGRV
Ga0247825_1004895853300028812SoilVAEQLRAWIVTGPIGHLWSAMADITLLWTRYLANRVRGRV
Ga0307278_1018289923300028878SoilVAPVRRPAAEKLHAWIVTGPLGHLWSALADMALIWARYLAHRARRGQS
Ga0307300_1016251823300028880SoilVAPVRRPVAEKLHAWIVTGPIGHLWSALADMTLIWARYL
Ga0307277_1017092513300028881SoilVAPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLAHRARRG
Ga0247826_1134244623300030336SoilLTSVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS
Ga0307501_1001165423300031152SoilVRRRPAAEQLQGWIVTGPLGHLWSALADMTLIWARYLANRARGRV
Ga0307501_1008872323300031152SoilLRRVRRSAAEKLQAWIVTGPLGHLWSALADMTLIWVRYLAHRARRS
Ga0307501_1019910013300031152SoilVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLVHRARRG
Ga0307408_10126311913300031548RhizosphereVRRPVTEKLQAWIVTGPLGHLWSALADMTLIWVRYLA
Ga0307408_10243266823300031548RhizosphereVRRAAAERLQAWIVTGPLGHLWSALADMVLIWARYLAHRARRRV
Ga0307405_1200395423300031731RhizosphereLPYVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARY
Ga0307413_1044880423300031824RhizosphereVRRPVTEKLQAWIVTGPLGHLWSALADITLIWVRYLAHRARRG
Ga0307410_1026113213300031852RhizosphereLPYVRRPAAEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0307410_1072612723300031852RhizosphereEKLQAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0307406_1006296923300031901RhizosphereVRRTAAERLQAWIVTGPLGHLWSALADMVLIWVRYLAHRARGRA
Ga0307406_1201789923300031901RhizosphereVRRPAAEKLEAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0307409_10121442923300031995RhizosphereVPPVRRPAAEKLQAWIVTGPIGHLWSALADMALIWARYLARRARRG
Ga0307416_10126629423300032002RhizosphereVRRAAAERLQAWIVTGPLGHLWSALADMVLIWARYLA
Ga0307416_10274849813300032002RhizosphereMRGASLPSVRRPAAEKLEAWIVTGPLGHLWSALADMAVIWARYLAHRARRG
Ga0326721_1032823023300032080SoilVRRTAAERLQAWILTGPLGHLWSALADMVLIWARYLANRARGRV
Ga0307415_10239787523300032126RhizosphereGVSLPSVRRPVTEKLQAWIVTGPLGHRWSALADMTLIWVRYLAHRARRG
Ga0247829_1129522423300033550SoilVLRRTASEKLQAWIVTGPLGHLWSALTDMILIWVRYLAHRA
Ga0364931_0329480_252_3833300034176SedimentVRRPAAEKLQAWIVTGPLGHLWSALADMTVIWARYLAHRARRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.