NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054229

Metagenome / Metatranscriptome Family F054229

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054229
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 41 residues
Representative Sequence ACVQGGMTQLLVAGVQPAAGGGGLAGIRAGARFSSRVAR
Number of Associated Samples 130
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.29 %
% of genes from short scaffolds (< 2000 bps) 97.86 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.286 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(32.143 % of family members)
Environment Ontology (ENVO) Unclassified
(34.286 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.714 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 55.22%    β-sheet: 0.00%    Coil/Unstructured: 44.78%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF13518HTH_28 78.57
PF13551HTH_29 8.57
PF02371Transposase_20 3.57
PF13565HTH_32 2.14
PF13683rve_3 1.43
PF13305TetR_C_33 0.71
PF13006Nterm_IS4 0.71
PF00126HTH_1 0.71
PF09299Mu-transpos_C 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 3.57


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig1230921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. USK10523Open in IMG/M
3300005158|Ga0066816_1009213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300005178|Ga0066688_10632081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia687Open in IMG/M
3300005327|Ga0070658_10578978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia972Open in IMG/M
3300005343|Ga0070687_100208559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1189Open in IMG/M
3300005356|Ga0070674_101027755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300005435|Ga0070714_101589683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia639Open in IMG/M
3300005552|Ga0066701_10222746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1162Open in IMG/M
3300005554|Ga0066661_10217327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii1185Open in IMG/M
3300005617|Ga0068859_101756215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300005618|Ga0068864_102248347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia552Open in IMG/M
3300006028|Ga0070717_11903585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia537Open in IMG/M
3300006052|Ga0075029_100475949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300006059|Ga0075017_101218640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia590Open in IMG/M
3300006162|Ga0075030_100731424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300006175|Ga0070712_100305745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1288Open in IMG/M
3300006800|Ga0066660_10365802All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1177Open in IMG/M
3300006804|Ga0079221_11810243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300006854|Ga0075425_101415032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia786Open in IMG/M
3300006903|Ga0075426_10828426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia697Open in IMG/M
3300006954|Ga0079219_10109054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1381Open in IMG/M
3300009523|Ga0116221_1434833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia572Open in IMG/M
3300009524|Ga0116225_1389433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300009672|Ga0116215_1083311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1436Open in IMG/M
3300010301|Ga0134070_10363062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300010361|Ga0126378_12335120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia611Open in IMG/M
3300010867|Ga0126347_1490083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia500Open in IMG/M
3300010876|Ga0126361_10123917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300011270|Ga0137391_10552191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia970Open in IMG/M
3300012206|Ga0137380_10549487All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1014Open in IMG/M
3300012207|Ga0137381_11476678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia572Open in IMG/M
3300012208|Ga0137376_10745806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia844Open in IMG/M
3300012353|Ga0137367_10108932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2039Open in IMG/M
3300012360|Ga0137375_10502489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1032Open in IMG/M
3300012917|Ga0137395_10142691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1633Open in IMG/M
3300012917|Ga0137395_10246415All Organisms → cellular organisms → Bacteria1254Open in IMG/M
3300012975|Ga0134110_10197985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300012989|Ga0164305_10536266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia928Open in IMG/M
3300014200|Ga0181526_10719916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300014495|Ga0182015_10222480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus jostii1255Open in IMG/M
3300016319|Ga0182033_10189161All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1628Open in IMG/M
3300016357|Ga0182032_11752031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia542Open in IMG/M
3300016404|Ga0182037_11710478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia561Open in IMG/M
3300017821|Ga0187812_1252330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300017924|Ga0187820_1297107All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300017929|Ga0187849_1136454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1002Open in IMG/M
3300017947|Ga0187785_10666351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia543Open in IMG/M
3300018037|Ga0187883_10599980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300018044|Ga0187890_10665006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300018078|Ga0184612_10285772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300018086|Ga0187769_10554020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia869Open in IMG/M
3300018089|Ga0187774_10423559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia817Open in IMG/M
3300018433|Ga0066667_10450112All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1051Open in IMG/M
3300020580|Ga0210403_11470362All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300020582|Ga0210395_10306940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1193Open in IMG/M
3300021860|Ga0213851_1399379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia567Open in IMG/M
3300025574|Ga0208717_1082532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia724Open in IMG/M
3300025898|Ga0207692_10380569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia876Open in IMG/M
3300025910|Ga0207684_10609227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300025935|Ga0207709_11171299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300026322|Ga0209687_1195754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia626Open in IMG/M
3300026374|Ga0257146_1017245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1177Open in IMG/M
3300026494|Ga0257159_1017306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1163Open in IMG/M
3300026524|Ga0209690_1100204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1186Open in IMG/M
3300026995|Ga0208761_1010159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia798Open in IMG/M
3300026998|Ga0208369_1011986All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia803Open in IMG/M
3300027371|Ga0209418_1040041All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300027548|Ga0209523_1042329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia927Open in IMG/M
3300028773|Ga0302234_10089571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1360Open in IMG/M
3300028787|Ga0307323_10096020All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1062Open in IMG/M
3300028808|Ga0302228_10255643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia789Open in IMG/M
3300028824|Ga0307310_10528833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia596Open in IMG/M
3300028828|Ga0307312_10516850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia788Open in IMG/M
3300029882|Ga0311368_10343594All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1115Open in IMG/M
3300029910|Ga0311369_10357597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1282Open in IMG/M
3300029910|Ga0311369_10419591All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1157Open in IMG/M
3300029910|Ga0311369_10545786All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia977Open in IMG/M
3300029997|Ga0302302_1112113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1100Open in IMG/M
3300030056|Ga0302181_10142679All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1150Open in IMG/M
3300030057|Ga0302176_10394598All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia558Open in IMG/M
3300030520|Ga0311372_10962192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1134Open in IMG/M
3300030707|Ga0310038_10289556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia743Open in IMG/M
3300031226|Ga0307497_10182350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia896Open in IMG/M
3300031233|Ga0302307_10144380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1236Open in IMG/M
3300031236|Ga0302324_100041392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8474Open in IMG/M
3300031545|Ga0318541_10145138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1300Open in IMG/M
3300031546|Ga0318538_10095178All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1530Open in IMG/M
3300031549|Ga0318571_10331183All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300031564|Ga0318573_10140828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1261Open in IMG/M
3300031564|Ga0318573_10319096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia832Open in IMG/M
3300031572|Ga0318515_10734432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia522Open in IMG/M
3300031668|Ga0318542_10248611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300031668|Ga0318542_10687796All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia535Open in IMG/M
3300031682|Ga0318560_10165596All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1173Open in IMG/M
3300031708|Ga0310686_117002429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300031713|Ga0318496_10094307All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1600Open in IMG/M
3300031723|Ga0318493_10391031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300031753|Ga0307477_10258778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. LB11205Open in IMG/M
3300031768|Ga0318509_10620973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia602Open in IMG/M
3300031770|Ga0318521_10155119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1302Open in IMG/M
3300031779|Ga0318566_10438765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia641Open in IMG/M
3300031779|Ga0318566_10639933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300031780|Ga0318508_1087722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia856Open in IMG/M
3300031781|Ga0318547_10565604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia704Open in IMG/M
3300031796|Ga0318576_10176728All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1001Open in IMG/M
3300031820|Ga0307473_11074529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300031821|Ga0318567_10119299All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1441Open in IMG/M
3300031846|Ga0318512_10311807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300031859|Ga0318527_10275207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300031880|Ga0318544_10400363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300031893|Ga0318536_10183311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae1066Open in IMG/M
3300031896|Ga0318551_10114427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1448Open in IMG/M
3300031912|Ga0306921_11887658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia640Open in IMG/M
3300031912|Ga0306921_12691475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia511Open in IMG/M
3300031945|Ga0310913_10308545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1117Open in IMG/M
3300031947|Ga0310909_10208582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1625Open in IMG/M
3300031947|Ga0310909_11440570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia550Open in IMG/M
3300031954|Ga0306926_11168763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia906Open in IMG/M
3300032009|Ga0318563_10143871All Organisms → cellular organisms → Bacteria1277Open in IMG/M
3300032025|Ga0318507_10261252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia752Open in IMG/M
3300032039|Ga0318559_10126272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae1150Open in IMG/M
3300032043|Ga0318556_10051204All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1999Open in IMG/M
3300032044|Ga0318558_10281168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300032052|Ga0318506_10452515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia569Open in IMG/M
3300032054|Ga0318570_10073553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1458Open in IMG/M
3300032059|Ga0318533_11428030All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia505Open in IMG/M
3300032065|Ga0318513_10039666All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus2072Open in IMG/M
3300032066|Ga0318514_10135298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1271Open in IMG/M
3300032066|Ga0318514_10418301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia712Open in IMG/M
3300032090|Ga0318518_10101014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300032090|Ga0318518_10686972All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia521Open in IMG/M
3300032174|Ga0307470_10225622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus1218Open in IMG/M
3300032261|Ga0306920_100828763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1356Open in IMG/M
3300032783|Ga0335079_11870804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300032805|Ga0335078_11200466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia876Open in IMG/M
3300032895|Ga0335074_11059502All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus705Open in IMG/M
3300033004|Ga0335084_10289617All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1693Open in IMG/M
3300033158|Ga0335077_12237605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300033290|Ga0318519_10204642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae1127Open in IMG/M
3300034163|Ga0370515_0431036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia556Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil32.14%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.57%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.57%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.14%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.14%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.14%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.14%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.14%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.43%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.43%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.43%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil1.43%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.71%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.71%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.71%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.71%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009523Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025574Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026995Soil and rhizosphere microbial communities from Laval, Canada - mgLAB (SPAdes)EnvironmentalOpen in IMG/M
3300026998Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes)EnvironmentalOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027548Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029997Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300034163Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_151005302124908045SoilERERLRACVQGGVTQLLVAGIQPAAGGGDLAGIRAGARFSSRVAR
Ga0066816_100921323300005158SoilACVQGGMTQLLVAGVQPAAGNGVLAGIRAVTRFSSRGARRWW*
Ga0066688_1063208123300005178SoilERERLAARVQGGMTQLLVAGVQPAAGNGGLAGIRAVTRFSSRGARRWW*
Ga0070658_1057897813300005327Corn RhizosphereRLGACVQGGVTQLLVAGIQPGTGGGDLAGIRAGARFSSRVAR*
Ga0070687_10020855913300005343Switchgrass RhizospherePERERLGARAQGSMAQLLVAGVQPAAGGTVLAGIQAGAWFSSRTAR*
Ga0070674_10102775523300005356Miscanthus RhizosphereEGERLGACVQGGVTQLLVAGIQPGTGGGDLAGIRAGARFSSRVAR*
Ga0070714_10158968323300005435Agricultural SoilQAERERLAARVQGGMAELLVAGVQPAAGSGSLAGIQARAWFSSRVAR*
Ga0066701_1022274613300005552SoilGACVQDGMTQVLVAGIQPAAGNVVLAGIRAVARFSSRVAR*
Ga0066661_1021732713300005554SoilPERERLGACVQGGMTQVLVAGIQPAAGNVVLAGIRAVARFSSRVAR*
Ga0068859_10175621513300005617Switchgrass RhizosphereERLGACVQGGMTQLLVAGIQPAAGSAGLAGIRAGARFSSRVAR*
Ga0068864_10224834713300005618Switchgrass RhizosphereGACVQGGMAQLLVAGIEPAAGGGDLAGIRAVARFSSRSAR*
Ga0070717_1190358523300006028Corn, Switchgrass And Miscanthus RhizosphereERLRACVQGGMAQVLVAGIQPAAGGGDLAGLRAGARFSSRSAR*
Ga0075029_10047594913300006052WatershedsACVQGGMAQLLVAGIQPAAGSAGLAGIRAGARFSSRTAR*
Ga0075017_10121864023300006059WatershedsGGMAQFLVAGIQPAAGGGDLAGIRAGARFSSRSAR*
Ga0075030_10073142413300006162WatershedsERLGACVQGGMTQLLVAGIQPAAGSVVLAGIRAGARFSSRVAR*
Ga0070712_10030574513300006175Corn, Switchgrass And Miscanthus RhizosphereLGACVQGGMAQFLVAGVQPAAGSTSPAGIRAGARFSSRVAR*
Ga0066660_1036580213300006800SoilGMAELLIAGVQPAAGSGSLAGIQARAWFSSRVAR*
Ga0079221_1181024323300006804Agricultural SoilERLGACVQGSMAQLFVAGVQPAAGNAVLAGIQAGAWFSSRMAR*
Ga0075425_10141503213300006854Populus RhizosphereACVQGGMAQLLVAGIEPAAGGGDLASIWAGAQFSSRSAR*
Ga0075426_1082842613300006903Populus RhizosphereGGGGERLGACVQGGVTQLLVAGIAPGTGGGDLAGIRAGARFSSRVAR*
Ga0079219_1010905413300006954Agricultural SoilQGSMTQLLVAGVQHAAGSTGLAGIRIGARFSSRAAR*
Ga0116221_143483313300009523Peatlands SoilERERLGARVQGSMAKLLVAGVQPAAGGTVLAGIQAGAWFSIRVAR*
Ga0116225_138943313300009524Peatlands SoilRERLAARVQGGMTELLVAGVEPAAGSAGLAGIQAGAWFSSRVAR*
Ga0116215_108331113300009672Peatlands SoilGGMTQLLVAGVQPAAGNAILADIRTVLRFSSRVAR*
Ga0134070_1036306223300010301Grasslands SoilLRACVQGGMAQFLVAGVQPAAGGGDLAGIRAGTRFSSRSAR*
Ga0126378_1233512023300010361Tropical Forest SoilRERLGARVQGSMTQLLVAGVQPAAGSTVLAGIQAGAWFSSRVAR*
Ga0126347_149008323300010867Boreal Forest SoilRLGACVQRGMAQVLVAGIEPAAGGGDLAGIRAGARFSSRVAR*
Ga0126361_1012391723300010876Boreal Forest SoilARVQGGMAELLVAGVQHAAGGTVLAGIQAGAWFSSRAAR*
Ga0137391_1055219133300011270Vadose Zone SoilTQLLVAGVQPAAGNGVLAGIRAVTRFSSRGARRWW*
Ga0137380_1054948713300012206Vadose Zone SoilERERARACVQGGMTQLLVAGVQPAAGGGGLVGIRAGARFSSRVAR*
Ga0137381_1147667823300012207Vadose Zone SoilRERLGARVQRGMTQLLVAGVQPAAGSTVLAGIQAGAWFSSRVAR*
Ga0137376_1074580613300012208Vadose Zone SoilGMTQLLVAGIQPGTGGGDLAGIRAGARFSSRVAR*
Ga0137367_1010893243300012353Vadose Zone SoilAERERLGACVQGSMTQLLVAGVQPAAGSAVLAGIRAVFRFSSRVAR*
Ga0137375_1050248943300012360Vadose Zone SoilERLAARVQGSMAELLVAGVQPAAGRGGLAGIQAGAWFSSRVAR*
Ga0137395_1014269143300012917Vadose Zone SoilACVQGGMTQLLVAGVQPAAGGGGLAGIRAGARFSSRVAR*
Ga0137395_1024641553300012917Vadose Zone SoilVQGGMAELLVAGVQHAAGGTILAGIRACVRFSSRVAR*
Ga0134110_1019798513300012975Grasslands SoilQGSMAQLLVAGVQPAAGGTVLAGIQAGARFSSRVAR*
Ga0164305_1053626613300012989SoilECLGARVQGSVTQLLVAGVEPGTGSGVLAGIQAGAWFSSRMAR*
Ga0181526_1071991623300014200BogERPGARVQGGMAELLVAGVQHAAGGTVLAGIQAGAWFSSRAAR*
Ga0182015_1022248013300014495PalsaGVAQLLVAGVQHAAGSMSLAGIRARGGRAWFSSRVAR*
Ga0182033_1018916143300016319SoilAARVQGGMAELLVAGVQPAAGSGALAGIQAGAWFSSRVAR
Ga0182032_1175203123300016357SoilQGGMTQLLVAGIQPATGDAVLAGIRAGTRFSSRVAR
Ga0182037_1171047813300016404SoilRVQGGMPEFLVAGVQPAAGSGGLAGIQAGAWFSSRVAR
Ga0187812_125233023300017821Freshwater SedimentARVQGGMAELLVAGIQPAAGGTVLAGIRAGARFSSRVAR
Ga0187820_129710713300017924Freshwater SedimentACVQGSMAQFLVAGVQPAAGSSGLAGIRAGARFSSRVAR
Ga0187849_113645413300017929PeatlandCVQGGVTQLLVAGIQPGTGGGDLAGIRAGARFSSRVAR
Ga0187785_1066635123300017947Tropical PeatlandVQRGMTQLLVAGVQPAAGNAGLAGIRAVARVSSRVAR
Ga0187883_1059998023300018037PeatlandQGSMAQLLVAGVEPAAGGTVLAGIQAGAWFSSRVAR
Ga0187890_1066500613300018044PeatlandERLGARMQGSMAQLLVAGVEPAAGGTVLAGIQAGAWFSSRVAR
Ga0184612_1028577223300018078Groundwater SedimentLGACVQGGVAQLFVAGDQPGTGSAGLAGIRAGARVSSRGAR
Ga0187769_1055402013300018086Tropical PeatlandGSMAQLLVAGVQPAAGSTVLAGIQARAWFSSRTAR
Ga0187774_1042355923300018089Tropical PeatlandGARVQGGMAQLLVAGVQHAAGGTSLAGIQAGARFSSRVAR
Ga0066667_1045011233300018433Grasslands SoilAARVQGGMAELLVAGVQPAAGGDSLAGIQAGAWFSSRVAR
Ga0210403_1147036223300020580SoilLGACVQGGMAQLLIAGIEPAAGGGDLAGIQAGAWFSSRVAR
Ga0210395_1030694013300020582SoilACVQGGMAQLLVAGVEPAAGGGGLAGIRAVARFSSRVAR
Ga0213851_139937913300021860WatershedsERERLAARVQGGMAKLLVAGVQPAAGSTVLAGIQAGAWFSSRVAR
Ga0208717_108253213300025574Arctic Peat SoilPERERARACVQGGMTQLLVAGVQPAAGSMSLAGIRIGVRFSSRVAR
Ga0207692_1038056923300025898Corn, Switchgrass And Miscanthus RhizosphereLGARVQGGMAQLLVAGIPPAAGGGGLAGIRAGARFSSRVAR
Ga0207684_1060922713300025910Corn, Switchgrass And Miscanthus RhizosphereAAGVQGGMAELLVAGVQPAAGGTVLAGLQARAWVSSRVAR
Ga0207709_1117129923300025935Miscanthus RhizosphereCVQGGMTQLLVAGIQPGTGDGDLAGIRAGARFSSRVAR
Ga0209687_119575423300026322SoilERLRACVQGSMAQLLVAGVQPAAGGTVLAGIQAGARFSSRVAR
Ga0257146_101724523300026374SoilRLGARVQGGMTQLLVAGIQPAAGNGVLAGIRTVTRFSSRTAR
Ga0257159_101730613300026494SoilLGARVQGGMTQLLVAGIQPAAGNAILAGIRTVLRFSSRVAR
Ga0209690_110020423300026524SoilGACVQDGMTQVLVAGIQPAAGNVVLAGIRAVARFSSRVAR
Ga0208761_101015923300026995SoilERERLGARVQGGMTQLLVAGVQPAAGNGVLAGIRAVTRFSSRGARRWW
Ga0208369_101198613300026998Forest SoilLGARVQGSMAQLLVAGVEPAAGSGSLAGLQVGAWFSSRVAR
Ga0209418_104004113300027371Forest SoilERERLGARVQGGMAQLLVAGVQPAAGNGVLAGIRAVTRFSSRGARRWW
Ga0209523_104232933300027548Forest SoilRVQGGMAQLLVAGIPPAAGGGGLAGIRAGARFSSRVAR
Ga0302234_1008957143300028773PalsaARVQGGMAQLLVAGVQHAAGGTVLAGIQAGAWFSSRVAR
Ga0307323_1009602013300028787SoilGACVQGGMAQVLIAGIEPAAGGGDLAGIRAVARFSSRVAR
Ga0302228_1025564313300028808PalsaRLGARVQRGMTQLLVAGIQPAAEGGDLASIRAGARFSSRTAR
Ga0307310_1052883323300028824SoilACVQGGMAQLLVAGVQPAAGGGDLAGIRAGARFSSRSAR
Ga0307312_1051685013300028828SoilRACVQGGMAQLLVAGIQPAAGGGDLAGFRAVARFSSRLAR
Ga0311368_1034359413300029882PalsaPERERLGARVQRGMTQLLVAGIQPAAEGGDLASIRAGARFSSRTAR
Ga0311369_1035759743300029910PalsaMQGSMAQLLVAGVEPAAGGTVLAGIQAGAWFSSRVAR
Ga0311369_1041959133300029910PalsaRGMTQLLVAGIQPAAEGGDLASIRAGARFSSRTAR
Ga0311369_1054578613300029910PalsaRERPGARVQGGMAKLLVAGVQHAAGGTVLAGIQAGAWFSSRAAR
Ga0302302_111211333300029997PalsaERERLGARVQRGMTQLLVAGIQPAAEGGDLASIRAGARFSSRTAR
Ga0302181_1014267913300030056PalsaRERLAARVQGGMAELLVAGVEPAAGSGGLAGIQAGAWFSSRVAR
Ga0302176_1039459823300030057PalsaRLGARMQGSMAQLLVAGVEPAAGGTVLAGIQAGAWFSSRVAR
Ga0311372_1096219243300030520PalsaARVQGGMAELLVAGVQHAAGGTVLAGIQAGAWFSSRAAR
Ga0310038_1028955613300030707Peatlands SoilERERLGARVQGGMAQLLVAGVQHAAGGTVLAGIQAGAWFSSRVAR
Ga0307497_1018235013300031226SoilEHKRERLRACVQGGMAQLLVAGIQPAAGGGDLAGIRAGARFSSRVAR
Ga0302307_1014438013300031233PalsaAERERLAARVQGGMTELLVAGVEPAAGSGSLAGIQAGAWFSSRVAR
Ga0302324_10004139213300031236PalsaEPERERLGARVQGGMAQLLVAGVQHAAGGTVLAGIQAGAWFSSRVAR
Ga0318541_1014513843300031545SoilRERLRACVQGGMAQLLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0318538_1009517813300031546SoilLAARVQGGMAELLVAGVQPAAGSTVLAGIQAGAWFSSRVAR
Ga0318571_1033118323300031549SoilQGGMAQFLVAGISPAAGGGGLAGIRAGARFSSRSAR
Ga0318573_1014082843300031564SoilERLSACVQGGMAELLVAGVQPAAGSTVLAGIQAGAWFSSRVAR
Ga0318573_1031909613300031564SoilGACVQGGMTQLLVAGIQPAAGNVVLAGIRAGARFSSRVAR
Ga0318515_1073443223300031572SoilLAACVQGGMAELLVAGVQPAAGSGSLAGIQAGAWFSSRVAR
Ga0318542_1024861113300031668SoilERLRACVQGGMAQLLVAGVQPAAGGGDLAGIRAVARFSSRSAR
Ga0318542_1068779613300031668SoilERLGARVQGGMAQLLVAGIEPAAGGGGLAGIRAGARFSSRSAR
Ga0318560_1016559633300031682SoilGGVTQLLVAGIQPGTGGGDLAGIRAGARFSSRVAR
Ga0310686_11700242923300031708SoilARVQGSMTQLLVAGIQPAAGGGDLASIRAGARFSSRTAR
Ga0318496_1009430713300031713SoilLGACVQGGMAQLLVAGVQPAAGGGDLAGIRAVARFSSRSAR
Ga0318493_1039103113300031723SoilGGITQLLIAGVQPAAGGTVLAGIRAGARFSSRVAR
Ga0307477_1025877813300031753Hardwood Forest SoilQAERERLGARVQGSMAQLFVAGVQPAAGSMILAGIQAGAWFSSRVAR
Ga0318509_1062097313300031768SoilGARVQGSMTKLLIAGVQPAAGGAVLAGIQARAWFSSRVAR
Ga0318521_1015511913300031770SoilRRAARVQGGMAELLVAGVQPAAGSGALAGIQAGAWFSSRVAR
Ga0318566_1043876523300031779SoilRLRACVQGGMAQLLVAGIQPAAGGGGLAGIRAGARFSSRSAR
Ga0318566_1063993313300031779SoilAARVQGSMTQQLVAGIQPAAGNAGLAGFRACAQVSSRVAR
Ga0318508_108772213300031780SoilAERERLGARVQGSMTKLLIAGVQPAAGGAVLAGIQARAWFSSRVAR
Ga0318547_1056560413300031781SoilLRACVQGGTAQVLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0318576_1017672813300031796SoilLGACVQGGMTQLLVAGIQPAAGNVVLAGIRAGARFSSRVAR
Ga0307473_1107452913300031820Hardwood Forest SoilVQGGMTQVLVAGIQPAAGNVVLAGIRAGARFSSRVAR
Ga0318567_1011929913300031821SoilCVQGGTAQVLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0318512_1031180713300031846SoilEPERERLRACVQGGMAQLLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0318527_1027520713300031859SoilRERLRACVQGGMAQLLVAGIQPAAGGGGLAGIRAGARFSSRSAR
Ga0318544_1040036323300031880SoilRLAARVQGGMAELLVEGVQPAAGNWGLAGIRARARFSSRVAR
Ga0318536_1018331113300031893SoilARVQGSMTKLLIAGVQPAAGGAVLAGIQARAWFSSRVAR
Ga0318551_1011442743300031896SoilGGMAELLVAGVQPAAGSGALAGIQAGAWFSSRVAR
Ga0306921_1188765823300031912SoilGGMAQLLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0306921_1269147523300031912SoilLRACVQGGMAQLLVAGIQPAAGGGDLAVIRAGARFSSRVAR
Ga0310913_1030854513300031945SoilLRACVQGGMAQLLVAGVQPAAGGAVLAGIRAGARFSSRVAR
Ga0310909_1020858253300031947SoilLAARVQGGMTELLVAGVQPAAGGTVLAGIQARAWVSSRVAR
Ga0310909_1144057023300031947SoilRACVQGGTAQVLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0306926_1116876313300031954SoilERLRACVQGGMTQLLVAGVQPAAGGRVLAGIRAGARFSSRVAR
Ga0318563_1014387143300032009SoilCVQGGMAQLLVAGVQPAAGGGDLAGIRAVARFSSRSAR
Ga0318507_1026125223300032025SoilQAERERLSARVQRGMTKLLVAGIQPAAGGTVLAGIQARAWFSSRVAR
Ga0318559_1012627233300032039SoilGSMTQQLVAGIQPAAGNAGLAGFRACAQVSSRVAR
Ga0318556_1005120443300032043SoilQGGVAQLLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0318558_1028116813300032044SoilACVQGGMAQLLVAGIQPAAGGRVLAGIRAGARFSSRVAR
Ga0318506_1045251523300032052SoilVQGGMAELLVAGVQPAAGSGALAGIQAGAWFSSRVAR
Ga0318570_1007355343300032054SoilERLRACVQGGTAQVLVAGVQPAAGGGDLAGIRAGARFSSRVAR
Ga0318533_1142803013300032059SoilQGSMTQLFVAGIQPAAGSTILAGIRAGLRFSSRVAR
Ga0318513_1003966613300032065SoilSACVQGGMAELLVAGVQPAAGSTVLAGIQAGAWFSSRVAR
Ga0318514_1013529843300032066SoilPERERLRACVQGGMAQLLVAGVQPAAGGGDLAGIRAVARFSSRSAR
Ga0318514_1041830113300032066SoilAARVQGGMTELLVAGVQPAAGGTVLAGIQARAWVSSRVAR
Ga0318518_1010101453300032090SoilLRACVQGGMAQVLVAGVQPAAGGGGLAGIRAGARFSSRSAR
Ga0318518_1068697213300032090SoilLAARVQGGMAQLLVAGVQPAAGSTVLAGIQAGAWFSSRVAR
Ga0307470_1022562233300032174Hardwood Forest SoilVQGGMAQLLVAGIEPAAGGGDLAGIRAVARFSSRSAR
Ga0306920_10082876313300032261SoilQGSMTKLLIAGVQLAAGGAVLAGIQARAWFSSRVAR
Ga0335079_1187080423300032783SoilPERERLGARVQGGMAQLLVAGVQPAGGGIVLAGIQAGAWFSSRVAR
Ga0335078_1120046623300032805SoilARVQGGMAKLLVAGVQHAAGGTSLAGIQAGARFSSRVAR
Ga0335074_1105950223300032895SoilMQGSMAQLLVAGIQPAAGGGDLAGIRAVARFSSRVAR
Ga0335084_1028961753300033004SoilGSMTQLLVAGVQPAAESTVLAGIQAGAWFSSRVAR
Ga0335077_1223760513300033158SoilCVQGGMAQLLVAGIQPAAGGGDLAGIRAGTRFSSRSAR
Ga0318519_1020464233300033290SoilRERLAARVQGSMTQQLVAGIQPAAGNAGLAGFRACAQVSSRVAR
Ga0370515_0431036_449_5563300034163Untreated Peat SoilGGMAQLLVAGVQHAAGGTVLAGIQAGAWFSSRAAR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.