NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F054177

Metagenome / Metatranscriptome Family F054177

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F054177
Family Type Metagenome / Metatranscriptome
Number of Sequences 140
Average Sequence Length 39 residues
Representative Sequence FGKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV
Number of Associated Samples 120
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 13.57 %
% of genes near scaffold ends (potentially truncated) 85.00 %
% of genes from short scaffolds (< 2000 bps) 88.57 %
Associated GOLD sequencing projects 115
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (93.571 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil
(10.714 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.714 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF11737DUF3300 2.86
PF00210Ferritin 2.86
PF13545HTH_Crp_2 2.86
PF00072Response_reg 2.14
PF07238PilZ 2.14
PF01988VIT1 2.14
PF00056Ldh_1_N 1.43
PF01872RibD_C 1.43
PF00873ACR_tran 1.43
PF05532CsbD 1.43
PF01590GAF 0.71
PF00717Peptidase_S24 0.71
PF09699Paired_CXXCH_1 0.71
PF01594AI-2E_transport 0.71
PF00076RRM_1 0.71
PF07676PD40 0.71
PF00691OmpA 0.71
PF00166Cpn10 0.71
PF12836HHH_3 0.71
PF02518HATPase_c 0.71
PF00069Pkinase 0.71
PF08240ADH_N 0.71
PF09537DUF2383 0.71
PF07690MFS_1 0.71
PF07519Tannase 0.71
PF13517FG-GAP_3 0.71
PF00589Phage_integrase 0.71
PF16872putAbiC 0.71
PF04972BON 0.71
PF00665rve 0.71
PF04226Transgly_assoc 0.71
PF01138RNase_PH 0.71
PF07228SpoIIE 0.71
PF12680SnoaL_2 0.71
PF01569PAP2 0.71
PF08281Sigma70_r4_2 0.71
PF04338DUF481 0.71
PF02852Pyr_redox_dim 0.71
PF00196GerE 0.71
PF00106adh_short 0.71
PF03401TctC 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.86
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 2.14
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 2.14
COG0039Malate/lactate dehydrogenaseEnergy production and conversion [C] 1.43
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 1.43
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 1.43
COG1486Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolaseCarbohydrate transport and metabolism [G] 1.43
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 1.43
COG4584TransposaseMobilome: prophages, transposons [X] 0.71
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.71
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.71
COG3137Putative salt-induced outer membrane protein YdiYCell wall/membrane/envelope biogenesis [M] 0.71
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.71
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.71
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.71
COG2123Exosome complex RNA-binding protein Rrp42, RNase PH superfamilyIntracellular trafficking, secretion, and vesicular transport [U] 0.71
COG1185Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase)Translation, ribosomal structure and biogenesis [J] 0.71
COG0689Ribonuclease PHTranslation, ribosomal structure and biogenesis [J] 0.71
COG0628Predicted PurR-regulated permease PerMGeneral function prediction only [R] 0.71
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.71

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.57 %
UnclassifiedrootN/A6.43 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_13075289All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300001137|JGI12637J13337_1019712All Organisms → cellular organisms → Bacteria → Acidobacteria594Open in IMG/M
3300001471|JGI12712J15308_10026261Not Available1511Open in IMG/M
3300001593|JGI12635J15846_10002813All Organisms → cellular organisms → Bacteria → Acidobacteria15187Open in IMG/M
3300001593|JGI12635J15846_10561439All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300002245|JGIcombinedJ26739_100289672All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71522Open in IMG/M
3300002245|JGIcombinedJ26739_100512830All Organisms → cellular organisms → Bacteria → Acidobacteria1076Open in IMG/M
3300004631|Ga0058899_12212411All Organisms → cellular organisms → Bacteria → Acidobacteria835Open in IMG/M
3300005439|Ga0070711_101512272All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300005536|Ga0070697_100001821All Organisms → cellular organisms → Bacteria16288Open in IMG/M
3300005598|Ga0066706_10815707All Organisms → cellular organisms → Bacteria → Acidobacteria734Open in IMG/M
3300005602|Ga0070762_10038914All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2580Open in IMG/M
3300005602|Ga0070762_10998397All Organisms → cellular organisms → Bacteria → Acidobacteria574Open in IMG/M
3300005843|Ga0068860_101524230All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300005921|Ga0070766_11012424All Organisms → cellular organisms → Bacteria → Acidobacteria571Open in IMG/M
3300005944|Ga0066788_10055372All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300005995|Ga0066790_10213933Not Available823Open in IMG/M
3300005995|Ga0066790_10498365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300006028|Ga0070717_10749364All Organisms → cellular organisms → Bacteria → Acidobacteria888Open in IMG/M
3300006041|Ga0075023_100181368All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300006052|Ga0075029_100315193All Organisms → cellular organisms → Bacteria → Acidobacteria1001Open in IMG/M
3300006059|Ga0075017_101264431Not Available579Open in IMG/M
3300006086|Ga0075019_10181918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1239Open in IMG/M
3300006102|Ga0075015_100051510All Organisms → cellular organisms → Bacteria1950Open in IMG/M
3300006176|Ga0070765_101924405All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium554Open in IMG/M
3300006893|Ga0073928_10002675All Organisms → cellular organisms → Bacteria29963Open in IMG/M
3300006893|Ga0073928_10008361All Organisms → cellular organisms → Bacteria13039Open in IMG/M
3300006893|Ga0073928_11082340All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium543Open in IMG/M
3300006903|Ga0075426_11295135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae553Open in IMG/M
3300007255|Ga0099791_10403222All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium659Open in IMG/M
3300009176|Ga0105242_11831513All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium646Open in IMG/M
3300009519|Ga0116108_1012130All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3175Open in IMG/M
3300009519|Ga0116108_1137050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium729Open in IMG/M
3300009524|Ga0116225_1398707All Organisms → cellular organisms → Bacteria → Acidobacteria612Open in IMG/M
3300009547|Ga0116136_1111413All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300009629|Ga0116119_1018066All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300009700|Ga0116217_10588175All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009762|Ga0116130_1089940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae963Open in IMG/M
3300009764|Ga0116134_1297654Not Available555Open in IMG/M
3300009824|Ga0116219_10813119All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300009839|Ga0116223_10741119All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300010341|Ga0074045_10480318All Organisms → cellular organisms → Bacteria → Acidobacteria800Open in IMG/M
3300010876|Ga0126361_10433197All Organisms → cellular organisms → Bacteria → Acidobacteria971Open in IMG/M
3300011120|Ga0150983_12086546All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300011120|Ga0150983_16610361All Organisms → cellular organisms → Bacteria → Acidobacteria521Open in IMG/M
3300012917|Ga0137395_10751865All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300012924|Ga0137413_11761691All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300012961|Ga0164302_11577723All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300012986|Ga0164304_11340859All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300012989|Ga0164305_10609920All Organisms → cellular organisms → Bacteria → Acidobacteria878Open in IMG/M
3300013100|Ga0157373_10448037All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300013296|Ga0157374_10606769All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300014162|Ga0181538_10088161All Organisms → cellular organisms → Bacteria1848Open in IMG/M
3300014164|Ga0181532_10363488All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae809Open in IMG/M
3300014493|Ga0182016_10854483All Organisms → cellular organisms → Bacteria → Acidobacteria504Open in IMG/M
3300014498|Ga0182019_10150185All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300014501|Ga0182024_10230782All Organisms → cellular organisms → Bacteria2499Open in IMG/M
3300014501|Ga0182024_11316433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium837Open in IMG/M
3300015078|Ga0167660_1012112All Organisms → cellular organisms → Bacteria → Acidobacteria946Open in IMG/M
3300015193|Ga0167668_1084779All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300016750|Ga0181505_11140829All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae589Open in IMG/M
3300018005|Ga0187878_1154806All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300018012|Ga0187810_10123698All Organisms → cellular organisms → Bacteria → Acidobacteria1027Open in IMG/M
3300018013|Ga0187873_1206069All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium735Open in IMG/M
3300018015|Ga0187866_1159135All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae870Open in IMG/M
3300018017|Ga0187872_10487207All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300018021|Ga0187882_1225610Not Available731Open in IMG/M
3300018030|Ga0187869_10222606All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae919Open in IMG/M
3300018037|Ga0187883_10124827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1330Open in IMG/M
3300018043|Ga0187887_10384356All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300018047|Ga0187859_10214659All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300018476|Ga0190274_13484089All Organisms → cellular organisms → Bacteria → Acidobacteria531Open in IMG/M
3300019082|Ga0187852_1445728All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300019189|Ga0184585_113385All Organisms → cellular organisms → Bacteria → Acidobacteria1398Open in IMG/M
3300019888|Ga0193751_1126662All Organisms → cellular organisms → Bacteria → Acidobacteria944Open in IMG/M
3300019890|Ga0193728_1062583All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1785Open in IMG/M
3300020579|Ga0210407_10945422All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300020583|Ga0210401_10421591All Organisms → cellular organisms → Bacteria1197Open in IMG/M
3300021088|Ga0210404_10206716All Organisms → cellular organisms → Bacteria1054Open in IMG/M
3300021168|Ga0210406_10670428Not Available802Open in IMG/M
3300021181|Ga0210388_10076430All Organisms → cellular organisms → Bacteria2833Open in IMG/M
3300021420|Ga0210394_10509884All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1058Open in IMG/M
3300021475|Ga0210392_10000468All Organisms → cellular organisms → Bacteria24851Open in IMG/M
3300021477|Ga0210398_10832183All Organisms → cellular organisms → Bacteria → Acidobacteria742Open in IMG/M
3300021478|Ga0210402_10909816All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300021478|Ga0210402_11960343All Organisms → cellular organisms → Bacteria → Acidobacteria511Open in IMG/M
3300021559|Ga0210409_10710879All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300022873|Ga0224550_1006875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1595Open in IMG/M
3300025419|Ga0208036_1012465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1930Open in IMG/M
3300025453|Ga0208455_1060236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300025929|Ga0207664_10382594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1249Open in IMG/M
3300025929|Ga0207664_11326895All Organisms → cellular organisms → Bacteria → Acidobacteria639Open in IMG/M
3300025944|Ga0207661_10159222All Organisms → cellular organisms → Bacteria → Acidobacteria1958Open in IMG/M
3300026078|Ga0207702_11469232All Organisms → cellular organisms → Bacteria → Acidobacteria675Open in IMG/M
3300026223|Ga0209840_1117736All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300026294|Ga0209839_10163913All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300027567|Ga0209115_1000023All Organisms → cellular organisms → Bacteria13119Open in IMG/M
3300027884|Ga0209275_10033526All Organisms → cellular organisms → Bacteria2383Open in IMG/M
3300027889|Ga0209380_10423620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae780Open in IMG/M
3300027895|Ga0209624_10027579All Organisms → cellular organisms → Bacteria → Acidobacteria3608Open in IMG/M
3300027905|Ga0209415_10320361All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71318Open in IMG/M
3300027908|Ga0209006_10001976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae18633Open in IMG/M
3300027908|Ga0209006_10012334All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis7739Open in IMG/M
3300027911|Ga0209698_10059344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3311Open in IMG/M
3300028047|Ga0209526_10173358All Organisms → cellular organisms → Bacteria → Acidobacteria1504Open in IMG/M
3300028047|Ga0209526_10260438All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300028740|Ga0302294_10082462All Organisms → cellular organisms → Bacteria → Acidobacteria770Open in IMG/M
3300028748|Ga0302156_10198844All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300028759|Ga0302224_10129023All Organisms → cellular organisms → Bacteria → Acidobacteria984Open in IMG/M
3300029922|Ga0311363_11374991All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300029943|Ga0311340_10510270All Organisms → cellular organisms → Bacteria → Acidobacteria1072Open in IMG/M
3300029944|Ga0311352_11336595All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300029955|Ga0311342_10343586All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1328Open in IMG/M
3300029999|Ga0311339_10266017All Organisms → cellular organisms → Bacteria1873Open in IMG/M
3300029999|Ga0311339_10607956Not Available1087Open in IMG/M
3300030007|Ga0311338_10285727All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1831Open in IMG/M
3300030007|Ga0311338_12076495All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300030047|Ga0302286_10436006All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300030114|Ga0311333_11754752All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300030520|Ga0311372_11693736All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium763Open in IMG/M
3300030991|Ga0073994_12018902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae636Open in IMG/M
3300030991|Ga0073994_12024224All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300031090|Ga0265760_10245923All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300031090|Ga0265760_10335819All Organisms → cellular organisms → Bacteria → Acidobacteria539Open in IMG/M
3300031239|Ga0265328_10458266Not Available505Open in IMG/M
3300031241|Ga0265325_10278106All Organisms → cellular organisms → Bacteria → Acidobacteria751Open in IMG/M
3300031241|Ga0265325_10524517Not Available513Open in IMG/M
3300031344|Ga0265316_10950021All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300031708|Ga0310686_116323603All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300031715|Ga0307476_11216746All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300031938|Ga0308175_102928174All Organisms → cellular organisms → Bacteria → Acidobacteria532Open in IMG/M
3300031962|Ga0307479_10322932All Organisms → cellular organisms → Bacteria → Acidobacteria1526Open in IMG/M
3300031962|Ga0307479_10676821All Organisms → cellular organisms → Bacteria1011Open in IMG/M
3300032515|Ga0348332_10472034All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1326Open in IMG/M
3300032515|Ga0348332_14594036All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300032756|Ga0315742_12590521All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300033888|Ga0334792_051738All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1273Open in IMG/M
3300034065|Ga0334827_003048All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8268Open in IMG/M
3300034124|Ga0370483_0056061All Organisms → cellular organisms → Bacteria → Acidobacteria1249Open in IMG/M
3300034125|Ga0370484_0149081All Organisms → cellular organisms → Bacteria627Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil10.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland7.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.14%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland5.71%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.71%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.57%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil3.57%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.86%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring2.14%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.14%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.14%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.14%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.43%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.43%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.43%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost1.43%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.43%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.43%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.43%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.71%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.71%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.71%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.71%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.71%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.71%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.71%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001137Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3EnvironmentalOpen in IMG/M
3300001471Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004631Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009629Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015078Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300016750Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018005Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019189Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300025419Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028740Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300032756Forest Soil Metatranscriptomics Site 2 Humus Litter Mineral Combined AssemblyEnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034125Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1307528933300000891SoilTGEFGTVERANEDDAVVKWDDDGRVRLHQPWLKKV*
JGI12637J13337_101971223300001137Forest SoilLGTFGIPTGELGTVEQTNEEDAVVKWDDDGRKRLHQPSLKKI*
JGI12712J15308_1002626123300001471Forest SoilMGLADFGKPTGEFGTIEKTNEDDALVKWDDDDRTRQDQSSLRKV*
JGI12635J15846_10002813153300001593Forest SoilNFGKPTGEFGTVERANEEDAIVKWDDDGRMRLHQPSLKKV*
JGI12635J15846_1056143913300001593Forest SoilEGLGNFGKPTGEFGTIKQANEDDAVVKWDDDGRVRVHQPSLKKV*
JGIcombinedJ26739_10028967213300002245Forest SoilLGDFGIPTGELGTVEQTNEEDAIVKWDDDGRKRLHQLWLKKV*
JGIcombinedJ26739_10051283023300002245Forest SoilGLGDFGKPTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV*
Ga0058899_1221241123300004631Forest SoilLGNFGKPTGEFGTVEQANEEDAIVKWDDDGRMRLHQPWLKKV*
Ga0070711_10151227223300005439Corn, Switchgrass And Miscanthus RhizosphereLGNFGKPTGEFGTVEQANDDDAVVKWDDDGRMRLHQPWLKKV*
Ga0070697_100001821183300005536Corn, Switchgrass And Miscanthus RhizosphereFGKPLGQFGTVEQANEDDAVVKWDDDGRMRLRQPWLKKI*
Ga0066706_1081570723300005598SoilGKPLGQFGTVEQANEDDAVVKWDDDGRMRLRQPWLKKV*
Ga0070762_1003891423300005602SoilLGNFGKPTGELGTVEQANEDDAVVKWDDDRRQRVHRPSLKKV*
Ga0070762_1099839723300005602SoilMGLADFGKPTGEFGTIEKTNEDDALVKREGDGRTRPHQPSLTKV*
Ga0068860_10152423013300005843Switchgrass RhizosphereNPTGELGTVEQSNEDDAVVKWDDDGRMRLRQPWLKKL**
Ga0070766_1101242413300005921SoilEGLGNLGRPTGEIGTVERTNEDDAVVKWDDDGRVRVGQPWLKKV*
Ga0066788_1005537233300005944SoilFGKPTGELGTVEQTNEDDAVVKWDDDGRMRLPQPSLRKT*
Ga0066790_1021393323300005995SoilLGNFGKPTDEFGTVERANEDDAIVKWDDDGRTRVHQPWLKKV*
Ga0066790_1049836513300005995SoilGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV*
Ga0070717_1074936423300006028Corn, Switchgrass And Miscanthus RhizospherePTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKI*
Ga0075023_10018136813300006041WatershedsPTGEFGTVEQTNEDDAVVKWDDDGRMRLHQPWLKKV*
Ga0075029_10031519323300006052WatershedsVEGLGDFGKPTGKFGTVWQTNEDDALVKWDGAGRMRSQQTWLKKV*
Ga0075017_10126443113300006059WatershedsNFGNPTGEIGTVERTNENEPVVKWDDDGRVRVGQTWLKKV*
Ga0075019_1018191813300006086WatershedsTGEFGTVEQANEDDAVVKWDDDGRMRLYQPSLRKV*
Ga0075015_10005151033300006102WatershedsVEGLGDFGKPTGKFGTVWQTNEDDALVKWDGAGCMRSQQTWLKKV*
Ga0070765_10192440523300006176SoilTGEFGTVERTNEDDAEVKWDDDGRVRVHQPSLKKI*
Ga0073928_1000267533300006893Iron-Sulfur Acid SpringLGDFGIPTGDLGTVEQTNEEDAIVKWDDDGRKRLHQPWLKKV*
Ga0073928_1000836183300006893Iron-Sulfur Acid SpringMGLGNFGKPTGEFGTVEQTNEDDALVKWDDDGRVRLHQPSLRKV*
Ga0073928_1108234023300006893Iron-Sulfur Acid SpringGELGTVEQANEDDAVVKWDNDGRMRLHQPSLKKI*
Ga0075426_1129513523300006903Populus RhizosphereNFGKPTGELGTVERANEDDAVVKWDDDGRMRLHQVSLKKI*
Ga0099791_1040322223300007255Vadose Zone SoilGKPTGEFGTVEQANEDDAVVKWDDDGRMRVHQPWLKKI*
Ga0105242_1183151313300009176Miscanthus RhizosphereTGAFGTVEQANEDDAVVKWDDDGRVRLHQPSVKKL*
Ga0116108_101213013300009519PeatlandPTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV*
Ga0116108_113705013300009519PeatlandGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV*
Ga0116225_139870733300009524Peatlands SoilGEFGTVKQANEDDAVVKWDDDGRMRLHQPWLKKV*
Ga0116136_111141313300009547PeatlandTGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV*
Ga0116119_101806643300009629PeatlandGKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV*
Ga0116217_1058817513300009700Peatlands SoilKPTGEFGTVQQTNEDDAVVKWDDDGRMRVHQPSLKKV*
Ga0116130_108994023300009762PeatlandGDFGKPTGVFGTVEQANEDDAVVKWDDYGRARLHQPWLKKV*
Ga0116134_129765423300009764PeatlandGKPNGEFGTVERANDEDAVVKWDDDGRVRLHQPSLKKV*
Ga0116219_1081311923300009824Peatlands SoilFGTVQQANEDDAVVKWDDDGRMRVHQPSLKKVWPA*
Ga0116223_1074111933300009839Peatlands SoilPTGEFGTVERTNDDDALVKWDGDGRMRMHQPWLKKV*
Ga0074045_1048031813300010341Bog Forest SoilPTGEFGTVERTNEDDAVVKWDKDGRIRLHQPQLKRV*
Ga0126361_1043319713300010876Boreal Forest SoilLADFGKPTGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV*
Ga0150983_1208654613300011120Forest SoilTGEFGTVEQANEDDAVVKWDDDGRIRLHQPSLKKV*
Ga0150983_1661036113300011120Forest SoilKPTGELGTVEQTNEDDAVVKWDDDGRTRLRIPLVKKV*
Ga0137395_1075186533300012917Vadose Zone SoilNGEFGTVERTNEQDAVVKWDDDGRMRIHQPSLKKV*
Ga0137413_1176169123300012924Vadose Zone SoilEGLGDFGKPKGEFGTVEQANEDDAVVKWDNDGRRRLHQPWLKKL*
Ga0164302_1157772323300012961SoilTGELGTVQQANEDDAVVKWDNDGRMRVHQPSLKKV*
Ga0164304_1134085923300012986SoilGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV*
Ga0164305_1060992033300012989SoilNFGKPSGEFGTVEQANEDDAVVKWDDAGRMRLHHPWLKKV*
Ga0157373_1044803723300013100Corn RhizosphereLGDFGKPTGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKA*
Ga0157374_1060676933300013296Miscanthus RhizosphereGKPTGEIGTVEQTNEDDAVVKWDDDGRTRLRQLSLKNVPAS*
Ga0181538_1008816153300014162BogTGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKV*
Ga0181532_1036348813300014164BogTGVFGTVEQANEDDAVVKWDDYGRARLHQPWLKKV*
Ga0182016_1085448313300014493BogEGLGNFGKPTGEFGTVKRVNEDDAVVKWDDDGRVRVHQPSLKKV*
Ga0182019_1015018543300014498FenGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKI*
Ga0182024_1023078233300014501PermafrostGTFGKPTGELGTVEQANEDDAIVKWDDDGRMRLHQQSLKKV*
Ga0182024_1131643313300014501PermafrostGEFGTVRQVNDDDAVVKWDDAGRIRVHQPSLKKV*
Ga0167660_101211233300015078Glacier Forefield SoilMGLADFGKPTGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV*
Ga0167668_108477923300015193Glacier Forefield SoilGEFGTVEQANEDDAVVKWDGDGRMRLAQPWLKKV*
Ga0181505_1114082913300016750PeatlandVEGLGDFGKPTGEFGTVQQTNEDDAVVKWDDDGRMRVHQPSLKKV
Ga0187878_115480623300018005PeatlandFGKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV
Ga0187810_1012369823300018012Freshwater SedimentGLGDFGMPTGEFGTVRQVNEDDALVKWDDDGRVRLHQPSLKKL
Ga0187873_120606913300018013PeatlandPTGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV
Ga0187866_115913513300018015PeatlandKPSGEFGTVEQANEDDALVKWDDDGRMRLGQPWLKKV
Ga0187872_1048720713300018017PeatlandNFGKPTGEFGTVKQANEDDAVVKWDDDGRVTVHQPSLKKV
Ga0187882_122561013300018021PeatlandNFGKPTGEFGTVERANEEDAVVKWDDDGRMRLHQPSLKKI
Ga0187869_1022260623300018030PeatlandLGNFGKPSGEFGTVEQANEDDAVVKWDDDGRMRLGQPWLKKV
Ga0187883_1012482713300018037PeatlandGLGDFGMPTGEFGTVRQVNEDDALVKWDDDGRMRVHKPSLKNV
Ga0187887_1038435633300018043PeatlandNFGKPNGEFGTVKQSNADDAVVKWDDDGRVRVHQPSLKKI
Ga0187859_1021465923300018047PeatlandTGVFGTVEQANEDDAVVKWDGDGRVRLHQPWLKKV
Ga0190274_1348408913300018476SoilPTGEFGTVKQANDEDAVVKWDDDGRVRLHQPSLKKL
Ga0187852_144572823300019082PeatlandDFGKPTGVFGTVEQANEDDAVVKWDDYGRARLHQPWLKKV
Ga0184585_11338513300019189SoilGDRVEGLANFGKPTGEFGTVEKTNEDDALVKWDDDGRMRLQQPWLKKVSN
Ga0193751_112666213300019888SoilDFGKPTGESGIVEQANEDDAVVKWDDDGRVRLHQPWLKKL
Ga0193728_106258343300019890SoilTGDLGTVERSNEEDAVVKWDDDGRMRLRQGSLKKI
Ga0210407_1094542213300020579SoilEIASRVWADFGKPTGEFGTVEQTNEDDALVKWDDDGRMRLHQPWLKKV
Ga0210401_1042159113300020583SoilTGEFGTVEQSNEDDAVVKWDDDGRMRLHQPSLRKV
Ga0210404_1020671613300021088SoilNFGKPTGGLGTVEQANEDDAIVKWDDDGRTRLPQPSLKKI
Ga0210406_1067042813300021168SoilLGSFGKTTGEFGTVKQANEEDAIVKWDDDSRTWLQQPRPAASQVTL
Ga0210388_1007643013300021181SoilLRRWRVMGLADFGKPTGEFGTIEKTNEDDALVKWDDDDRTRQHQSSLRKV
Ga0210394_1050988413300021420SoilTGEFGTVEQTNEDDAVVKWDDDGRSRQHQPWLKKV
Ga0210392_10000468173300021475SoilMGLADFGKPTGEFGTVEKTNEDDALVKWDDDGRTRQHQPSLKKV
Ga0210398_1083218313300021477SoilPTGEFGTVQQANDDDAVVKWDDDGRVRVHQPSLKKI
Ga0210402_1090981613300021478SoilNLGKPTGELGTVEQTNEDDALVKWDDDGRVRLHQPSLKKV
Ga0210402_1196034313300021478SoilGKPTGEFGTVERANEEDAVVKWDHDGRVRLHQPSLKKV
Ga0210409_1071087923300021559SoilFGKPTGELGTVEQANEDDAVVKWDDDGRKRLPQPWLKKV
Ga0224550_100687523300022873SoilGKPTGEFGTVERANEDDAEVKWDDDGRVRVHQPSLRRV
Ga0208036_101246513300025419PeatlandGKPTGEFGTVEQANEDDAVVKWDDDGRVRVHQPWLKKV
Ga0208455_106023613300025453PeatlandKPTGEFGTVQRTNEDDAEVKWDDDRRVRVHQPSLKKV
Ga0207664_1038259413300025929Agricultural SoilFGTPTGQLGTVERTNEEDAVVKWDSDGRTRLHQPWLKRV
Ga0207664_1132689523300025929Agricultural SoilTGEFGTVEQTNEEDAVVKWDDDGRMILHQPWLKKV
Ga0207661_1015922253300025944Corn RhizosphereDFGKPTGEFGTVEQTNEDDALVKWDHDGRMRLHQPWLKKISNKSKG
Ga0207702_1146923223300026078Corn RhizosphereGNFGKPTGEFGTVEQANEDDALVKWDDDGRMRLHQPSLKKV
Ga0209840_111773623300026223SoilGNFGKPTGEFGTVEQTNEDDAVVKWDDDGRMRLHQPWLKKV
Ga0209839_1016391313300026294SoilNFGKPTGEFGTVEQANEDDALVKWDDDGRMRLHQPSLKKI
Ga0209115_1000023163300027567Forest SoilMGLADFGKPTGEFGTIEKTNEDDALVKREDDGRTRQHQPSLTKV
Ga0209275_1003352663300027884SoilKPTGEFGTVQQANDDDAVVKWDHDGRVRVHQPSLKKI
Ga0209380_1042362023300027889SoilLGNFGKPTGELGTVEQANEDDAVVKWDDDRRQRVHRPSLKKV
Ga0209624_1002757943300027895Forest SoilMGLADFGKPTGEFGTIEKTNEDDALVKREGDGRTRPHQPSLTKV
Ga0209415_1032036123300027905Peatlands SoilVEGLGDFGKPTGVFGTVEQANEDDAVVKWDDDGRVRLHQPWLKKV
Ga0209006_1000197623300027908Forest SoilMGLADFGKPTGEFGTIEKTNEDDALVKWDDDDRTRQDQSSLRKV
Ga0209006_1001233483300027908Forest SoilTGEIGTVERTNEDDAVVKWDDDGRVRVGQPWLKKI
Ga0209698_1005934453300027911WatershedsVEGLGDFGKPTGKFGTVWQTNEDDALVKWDGAGCMRSQQTWLKKV
Ga0209526_1017335833300028047Forest SoilTGEFGTVEQANEDDAVVKWDDDSRMRLHQPWLKRA
Ga0209526_1026043813300028047Forest SoilGLGNFGKPTGEFGTIERSNEEDAIVKWDDDGRKRLHQPSLKKV
Ga0302294_1008246233300028740FenGLGYFGVPTGQLGTVERTNEVDAVVKWDDDGRMRLRQPWLKKV
Ga0302156_1019884413300028748BogYFGKPTGDFGTVEKSNEYDALVKWDDDGRVRLQQPWLRKVVTEPPLS
Ga0302224_1012902313300028759PalsaGKPTGEFGTVQRTSEDDVDVKWDNDGRVRVSQPSLRKV
Ga0311363_1137499113300029922FenMPTGEFGTVRQVNEDDALVKWDDDSRIRVHQPSLKKV
Ga0311340_1051027013300029943PalsaGKPTGEIGTVERTNEDDALVKWDDDGRVRVGQPWLKRV
Ga0311352_1133659513300029944PalsaGLGNFGKPTSEFGTVQQTNDDDAVVKWDDDGRVRVRQPSLKKV
Ga0311342_1034358623300029955BogGDFGMPTGEFGTVRQVNEDDALVKWDDDSRIRVHQPSLKKV
Ga0311339_1026601713300029999PalsaVEGLSKFGTPTGEFGTVQQANHEDAVVKWDDDGRVRVHQPSLKNV
Ga0311339_1060795623300029999PalsaPTSEFGTVQQTNDDDAVVKWDDDGRVRVRQPSLKKV
Ga0311338_1028572713300030007PalsaTGEFGTVERANEDDAEVKWDDDGRVRVHQPSLRRV
Ga0311338_1207649513300030007PalsaTGEFGTVEQANEDDAVVKWDDDGRMRLHQPSLKKV
Ga0302286_1043600613300030047FenSNFGKPNGEFGTVKLANEEDAVVKWDNDGRVRVHQPSLRKI
Ga0311333_1175475213300030114FenKPNGEFGTVKLANEEDAVVKWDDDGRVRVHQPSLKKI
Ga0311372_1169373623300030520PalsaADGRIGTVRQVNDDDPVVKWDDDGRIRVHQPSLKTV
Ga0073994_1201890213300030991SoilGNFGKPTGEFGTVEQSNDEDAIVKWDDDGRKRLHQPSLKKV
Ga0073994_1202422413300030991SoilGSFGTPTGESGIVERTNEDDAVIKWDGAGRRRVRQTWLKKI
Ga0265760_1024592313300031090SoilGNFGKPTGAIGTVERANEDDAVVKWDDDGRVRLHQPWLKKI
Ga0265760_1033581913300031090SoilGKPTSEFGTVQQTNDDDAVVKWDDDGRVRVRQPSLKKV
Ga0265328_1045826623300031239RhizosphereMPTGEFGTVRQVNEEDAVVKWDDDGRVRVHQPWLKKV
Ga0265325_1027810613300031241RhizosphereLGRPTGEIGTVERTNEDDAVVKWDDDGRVRVGQPWLKKI
Ga0265325_1052451713300031241RhizosphereDFGMLTGEFGTVRQVNEEDAVVKWDDDGRVRVHQPWLKKV
Ga0265316_1095002123300031344RhizosphereEGLGNFGKPTGEFGTVKQANEDDAVVKWDDDGRVRVHQPSLKKA
Ga0310686_11632360313300031708SoilKPTGEFGTVEQANEDDAVVKWDGDGRMRLHQPSLKKV
Ga0307476_1121674623300031715Hardwood Forest SoilFGVPTGELGTVEQANEDDALVKWDDDGRKRIPRLWLKKV
Ga0308175_10292817413300031938SoilADFGKPTGEFGTVEQTNEDDALVKWDHDGRMRLHQPWLKKISNKSKG
Ga0307479_1032293213300031962Hardwood Forest SoilGDFGKPTGEFGTVEQANEDDAVVKWDDDGRKRLPQPRLKKV
Ga0307479_1067682113300031962Hardwood Forest SoilNFGKPTGAFGTVEQANEDDAIVKWDDDGRVRLHRPSLKKV
Ga0348332_1047203423300032515Plant LitterPTGQLGTVERANEDDAVVKWDDDGRVRLHQPSLQKI
Ga0348332_1459403643300032515Plant LitterGKPTDEFGTVERANEDDAIVKWDKDGRTRVHQPWLKKVDRG
Ga0315742_1259052113300032756Forest SoilPTGEFGTVERANEDDAVVKWDDDGRMRLHQPSLKKI
Ga0334792_051738_841_9693300033888SoilMGDFGKPTGVFGTVEQANEDDAVVKWDHDVRARLHQPWLKKV
Ga0334827_003048_1449_15623300034065SoilMPTGEFGTVRQVNEDDALVKWDDDNRIRVHQPSLKKV
Ga0370483_0056061_1126_12393300034124Untreated Peat SoilVPTGELGTVEKATEDDAIVKWDDDGRMKIRQPWLKKI
Ga0370484_0149081_503_6253300034125Untreated Peat SoilNFGRPTGAFGTVEQTNEDDAVVKWDDDGRMRLHQPSLKKV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.