NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F053998

Metagenome Family F053998

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F053998
Family Type Metagenome
Number of Sequences 140
Average Sequence Length 40 residues
Representative Sequence MEKGRKELLKQVPTRKLLASIKKDIRKVIRASASAAKPKKK
Number of Associated Samples 110
Number of Associated Scaffolds 140

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 93.28 %
% of genes near scaffold ends (potentially truncated) 10.71 %
% of genes from short scaffolds (< 2000 bps) 57.14 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.714 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.143 % of family members)
Environment Ontology (ENVO) Unclassified
(27.857 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.857 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.38%    β-sheet: 0.00%    Coil/Unstructured: 53.62%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 140 Family Scaffolds
PF12762DDE_Tnp_IS1595 31.43
PF12760Zn_Tnp_IS1595 20.71
PF00561Abhydrolase_1 2.14
PF00108Thiolase_N 1.43
PF11236DUF3037 1.43
PF00324AA_permease 0.71
PF08282Hydrolase_3 0.71
PF01066CDP-OH_P_transf 0.71
PF07676PD40 0.71
PF00691OmpA 0.71
PF08298AAA_PrkA 0.71
PF13424TPR_12 0.71
PF13520AA_permease_2 0.71
PF00227Proteasome 0.71
PF07726AAA_3 0.71
PF13442Cytochrome_CBB3 0.71
PF02781G6PD_C 0.71
PF08530PepX_C 0.71
PF01797Y1_Tnp 0.71
PF12867DinB_2 0.71
PF03450CO_deh_flav_C 0.71
PF00326Peptidase_S9 0.71
PF01464SLT 0.71
PF00383dCMP_cyt_deam_1 0.71
PF00072Response_reg 0.71
PF02502LacAB_rpiB 0.71
PF03976PPK2 0.71
PF13470PIN_3 0.71
PF00912Transgly 0.71
PF08281Sigma70_r4_2 0.71
PF03648Glyco_hydro_67N 0.71
PF13801Metal_resist 0.71
PF01590GAF 0.71
PF00174Oxidored_molyb 0.71
PF12796Ank_2 0.71
PF02371Transposase_20 0.71
PF07238PilZ 0.71
PF13714PEP_mutase 0.71
PF01887SAM_HAT_N 0.71
PF03069FmdA_AmdA 0.71
PF00528BPD_transp_1 0.71

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 140 Family Scaffolds
COG0183Acetyl-CoA acetyltransferaseLipid transport and metabolism [I] 1.43
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.71
COG5405ATP-dependent protease HslVU (ClpYQ), peptidase subunitPosttranslational modification, protein turnover, chaperones [O] 0.71
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.71
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 0.71
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 0.71
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.71
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.71
COG3661Alpha-glucuronidaseCarbohydrate transport and metabolism [G] 0.71
COG3547TransposaseMobilome: prophages, transposons [X] 0.71
COG3484Predicted proteasome-type proteasePosttranslational modification, protein turnover, chaperones [O] 0.71
COG2936Predicted acyl esteraseGeneral function prediction only [R] 0.71
COG2766Predicted Ser/Thr protein kinaseSignal transduction mechanisms [T] 0.71
COG2421Acetamidase/formamidaseEnergy production and conversion [C] 0.71
COG2326Polyphosphate kinase 2, PPK2 familyEnergy production and conversion [C] 0.71
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.71
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.71
COG1912Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming)Defense mechanisms [V] 0.71
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.71
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.71
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.71
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.71
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.71
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 0.71
COG0698Ribose 5-phosphate isomerase RpiBCarbohydrate transport and metabolism [G] 0.71
COG063820S proteasome, alpha and beta subunitsPosttranslational modification, protein turnover, chaperones [O] 0.71
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.71
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.71
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.71
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.71
COG0364Glucose-6-phosphate 1-dehydrogenaseCarbohydrate transport and metabolism [G] 0.71


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.71 %
UnclassifiedrootN/A9.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101572142All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300000567|JGI12270J11330_10000598All Organisms → cellular organisms → Bacteria27553Open in IMG/M
3300001546|JGI12659J15293_10009218All Organisms → cellular organisms → Bacteria2802Open in IMG/M
3300001593|JGI12635J15846_10061711All Organisms → cellular organisms → Bacteria2808Open in IMG/M
3300004082|Ga0062384_100467504All Organisms → cellular organisms → Bacteria828Open in IMG/M
3300004082|Ga0062384_100867664All Organisms → cellular organisms → Bacteria636Open in IMG/M
3300004091|Ga0062387_100661127All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300004092|Ga0062389_104563839All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300004152|Ga0062386_100192540All Organisms → cellular organisms → Bacteria → Acidobacteria1602Open in IMG/M
3300004152|Ga0062386_101123681All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300005172|Ga0066683_10537469Not Available713Open in IMG/M
3300005537|Ga0070730_10033005All Organisms → cellular organisms → Bacteria → Acidobacteria3889Open in IMG/M
3300005539|Ga0068853_101354298All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300005540|Ga0066697_10045688All Organisms → cellular organisms → Bacteria2470Open in IMG/M
3300005541|Ga0070733_10000041All Organisms → cellular organisms → Bacteria142357Open in IMG/M
3300005541|Ga0070733_10987287Not Available565Open in IMG/M
3300005554|Ga0066661_10105269All Organisms → cellular organisms → Bacteria1691Open in IMG/M
3300005555|Ga0066692_10823791All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300005557|Ga0066704_10524209All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005921|Ga0070766_10088884All Organisms → cellular organisms → Bacteria1811Open in IMG/M
3300006638|Ga0075522_10396816All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300006893|Ga0073928_11157067All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300009088|Ga0099830_10321751All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300009088|Ga0099830_10669742All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium853Open in IMG/M
3300009089|Ga0099828_10023102All Organisms → cellular organisms → Bacteria4893Open in IMG/M
3300009143|Ga0099792_10092531All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300009444|Ga0114945_10004902All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7406Open in IMG/M
3300009444|Ga0114945_10042927All Organisms → cellular organisms → Bacteria → Acidobacteria2448Open in IMG/M
3300009547|Ga0116136_1006963All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4450Open in IMG/M
3300010341|Ga0074045_10053278All Organisms → cellular organisms → Bacteria2920Open in IMG/M
3300010343|Ga0074044_10223332All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300010360|Ga0126372_10140050All Organisms → cellular organisms → Bacteria → Acidobacteria1911Open in IMG/M
3300010379|Ga0136449_100040234All Organisms → cellular organisms → Bacteria10902Open in IMG/M
3300010379|Ga0136449_100254638All Organisms → cellular organisms → Bacteria → Acidobacteria3257Open in IMG/M
3300010396|Ga0134126_10067121All Organisms → cellular organisms → Bacteria → Acidobacteria4459Open in IMG/M
3300011269|Ga0137392_10583982All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300012189|Ga0137388_10015818All Organisms → cellular organisms → Bacteria5520Open in IMG/M
3300012189|Ga0137388_10558413All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300012201|Ga0137365_10037121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3725Open in IMG/M
3300012202|Ga0137363_10324691All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300012202|Ga0137363_11143720All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300012205|Ga0137362_11033647All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300012361|Ga0137360_11068348All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300012362|Ga0137361_10736832All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300012683|Ga0137398_10631098Not Available742Open in IMG/M
3300012917|Ga0137395_10041661All Organisms → cellular organisms → Bacteria2841Open in IMG/M
3300012922|Ga0137394_10065863All Organisms → cellular organisms → Bacteria3012Open in IMG/M
3300012923|Ga0137359_11615539All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300012924|Ga0137413_10159834All Organisms → cellular organisms → Bacteria1480Open in IMG/M
3300012925|Ga0137419_10138686All Organisms → cellular organisms → Bacteria → Acidobacteria1741Open in IMG/M
3300012925|Ga0137419_10557983All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300012931|Ga0153915_10580400All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300014165|Ga0181523_10052746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2520Open in IMG/M
3300014489|Ga0182018_10106158All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter modestus1641Open in IMG/M
3300014495|Ga0182015_10039532All Organisms → cellular organisms → Bacteria3541Open in IMG/M
3300014495|Ga0182015_10495096All Organisms → cellular organisms → Bacteria781Open in IMG/M
3300014501|Ga0182024_11970598All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300015264|Ga0137403_10702392All Organisms → cellular organisms → Bacteria871Open in IMG/M
3300017925|Ga0187856_1010020All Organisms → cellular organisms → Bacteria → Acidobacteria5513Open in IMG/M
3300017930|Ga0187825_10002446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5879Open in IMG/M
3300017934|Ga0187803_10000006All Organisms → cellular organisms → Bacteria92760Open in IMG/M
3300017934|Ga0187803_10003277All Organisms → cellular organisms → Bacteria6375Open in IMG/M
3300017943|Ga0187819_10629103All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300017970|Ga0187783_10801909All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300017972|Ga0187781_10004336All Organisms → cellular organisms → Bacteria → Acidobacteria10588Open in IMG/M
3300017972|Ga0187781_10122571All Organisms → cellular organisms → Bacteria1813Open in IMG/M
3300017975|Ga0187782_10031834All Organisms → cellular organisms → Bacteria3832Open in IMG/M
3300018026|Ga0187857_10504648All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300018038|Ga0187855_10010535All Organisms → cellular organisms → Bacteria6255Open in IMG/M
3300018040|Ga0187862_10022381All Organisms → cellular organisms → Bacteria → Acidobacteria4922Open in IMG/M
3300018047|Ga0187859_10108953All Organisms → cellular organisms → Bacteria → Acidobacteria1459Open in IMG/M
3300018062|Ga0187784_10438146All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300018468|Ga0066662_12095125All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300019458|Ga0187892_10001221All Organisms → cellular organisms → Bacteria60261Open in IMG/M
3300020199|Ga0179592_10076142All Organisms → cellular organisms → Bacteria1538Open in IMG/M
3300020580|Ga0210403_10669726All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300020581|Ga0210399_10202720All Organisms → cellular organisms → Bacteria1650Open in IMG/M
3300020581|Ga0210399_11546860Not Available513Open in IMG/M
3300020583|Ga0210401_10301126All Organisms → cellular organisms → Bacteria1464Open in IMG/M
3300020583|Ga0210401_10978129All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300021046|Ga0215015_10120426All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300021046|Ga0215015_10463303All Organisms → cellular organisms → Bacteria1549Open in IMG/M
3300021088|Ga0210404_10000829All Organisms → cellular organisms → Bacteria14371Open in IMG/M
3300021088|Ga0210404_10184384All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300021168|Ga0210406_10003519All Organisms → cellular organisms → Bacteria → Acidobacteria17126Open in IMG/M
3300021168|Ga0210406_10382820All Organisms → cellular organisms → Bacteria1130Open in IMG/M
3300021420|Ga0210394_10124019All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300021432|Ga0210384_10620023All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300021474|Ga0210390_11139491All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300021476|Ga0187846_10062277All Organisms → cellular organisms → Bacteria1636Open in IMG/M
3300022563|Ga0212128_10015152All Organisms → cellular organisms → Bacteria4947Open in IMG/M
3300022563|Ga0212128_10062556All Organisms → cellular organisms → Bacteria2399Open in IMG/M
3300026041|Ga0207639_11673417All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026296|Ga0209235_1163240All Organisms → cellular organisms → Bacteria860Open in IMG/M
3300026313|Ga0209761_1158109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1061Open in IMG/M
3300026538|Ga0209056_10490840All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300027645|Ga0209117_1037503All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300027725|Ga0209178_1079168All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300027767|Ga0209655_10035288All Organisms → cellular organisms → Bacteria1676Open in IMG/M
3300027815|Ga0209726_10070374All Organisms → cellular organisms → Bacteria2274Open in IMG/M
3300027854|Ga0209517_10000057All Organisms → cellular organisms → Bacteria179527Open in IMG/M
3300027854|Ga0209517_10019064All Organisms → cellular organisms → Bacteria → Acidobacteria6521Open in IMG/M
3300027867|Ga0209167_10000055All Organisms → cellular organisms → Bacteria142355Open in IMG/M
3300027875|Ga0209283_10012688All Organisms → cellular organisms → Bacteria → Acidobacteria5026Open in IMG/M
3300027908|Ga0209006_10026924All Organisms → cellular organisms → Bacteria → Acidobacteria5209Open in IMG/M
3300028379|Ga0268266_11405472Not Available673Open in IMG/M
3300031231|Ga0170824_120594724All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300031236|Ga0302324_100146393All Organisms → cellular organisms → Bacteria3881Open in IMG/M
3300031236|Ga0302324_100146793All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3875Open in IMG/M
3300031670|Ga0307374_10006644All Organisms → cellular organisms → Bacteria18099Open in IMG/M
3300031670|Ga0307374_10171843All Organisms → cellular organisms → Bacteria1622Open in IMG/M
3300031708|Ga0310686_102065790All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300031708|Ga0310686_103542064All Organisms → cellular organisms → Bacteria1966Open in IMG/M
3300031708|Ga0310686_107008613All Organisms → cellular organisms → Bacteria53850Open in IMG/M
3300031718|Ga0307474_11279464Not Available579Open in IMG/M
3300031754|Ga0307475_10278069All Organisms → cellular organisms → Bacteria1343Open in IMG/M
3300031823|Ga0307478_10048331All Organisms → cellular organisms → Bacteria → Acidobacteria3147Open in IMG/M
3300031962|Ga0307479_10032517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4975Open in IMG/M
3300031965|Ga0326597_11909842All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300032160|Ga0311301_10277476All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2718Open in IMG/M
3300032180|Ga0307471_100353003All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300032180|Ga0307471_100772700All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300032205|Ga0307472_100090925All Organisms → cellular organisms → Bacteria2066Open in IMG/M
3300032783|Ga0335079_11671554All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300032805|Ga0335078_10058582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5665Open in IMG/M
3300032805|Ga0335078_10110023All Organisms → cellular organisms → Bacteria3962Open in IMG/M
3300032805|Ga0335078_11129177All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300032805|Ga0335078_11372317All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300032892|Ga0335081_10113328All Organisms → cellular organisms → Bacteria3990Open in IMG/M
3300032893|Ga0335069_10224015All Organisms → cellular organisms → Bacteria2276Open in IMG/M
3300032896|Ga0335075_10085553All Organisms → cellular organisms → Bacteria → Acidobacteria4200Open in IMG/M
3300032954|Ga0335083_10999683Not Available658Open in IMG/M
3300033402|Ga0326728_10012258All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae19128Open in IMG/M
3300033547|Ga0316212_1023363All Organisms → cellular organisms → Bacteria866Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.43%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil6.43%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil5.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.29%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.29%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland3.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.57%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs2.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.86%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.86%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.14%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.14%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.43%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.43%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.43%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.43%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.43%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.71%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.71%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.71%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.71%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.71%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.71%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.71%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.71%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.71%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.71%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.71%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.71%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.71%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.71%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.71%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001546Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006638Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-AEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009444Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027767Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033547Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10157214223300000364SoilLDEGRKKLLEKVPTRKLLASIKRDMRKLAAQAKPAAKPKKK*
JGI12270J11330_10000598203300000567Peatlands SoilMDEGRKKLLKKVPTRKLLASIKRDIRQLGRVTASAAKPKKK*
JGI12659J15293_1000921823300001546Forest SoilMEKGRKEMLKRVPTRKLLASIKRDLRQAVRVSASAGKSKKD*
JGI12635J15846_1006171123300001593Forest SoilLEEGRKKLLKQVPTRKLLASIKKDIRQNIRASAASAKPKKK*
Ga0062384_10046750423300004082Bog Forest SoilMEKGRQQLLKKVPTRKLIASIKRDMRKLVREASASAKPKKK*
Ga0062384_10086766413300004082Bog Forest SoilMEEGRKKLLRKIPTRKLLASIKRDIHKSLKTAQSEGKRKKD*
Ga0062387_10066112713300004091Bog Forest SoilVEKGRKHMLKKVPTRKLLASIKKDLRQAIMASASAAKPKKG*
Ga0062389_10456383913300004092Bog Forest SoilMEKGRKHMLKKVPTRKLLASIKKDLRHAIRASASAAKSKKG*
Ga0062386_10019254023300004152Bog Forest SoilVEKGRKRMLEKVPTRKLLASIKKDLRQAIRATAASAKPKKK*
Ga0062386_10112368113300004152Bog Forest SoilMDEGRKKLLKQVPTRKLLASIKKDIRRTIRASASAAKQKK
Ga0066683_1053746933300005172SoilLDEGRKKLLKRVPTRKLLASIKKDIRQTIRESAAAAKPKKK*
Ga0070730_1003300523300005537Surface SoilMEKGRKELLKRVPTRKLLASVKKDLRHAIRASTASSKPKK*
Ga0068853_10135429823300005539Corn RhizosphereMDEGRKKLIKKISTRTLLASIKKDLRKVARASAAAAKPKKK*
Ga0066697_1004568823300005540SoilMEKGRKELLKQVPTRKLLASIKKDMRKLAAAAKPKKK*
Ga0070733_100000411333300005541Surface SoilMEKGRKELLKRVPTRKLLASIKKDLRHAIRASAASAKSKKK*
Ga0070733_1098728733300005541Surface SoilMEKGRKNMLKRVPTRKLLASIKKDLRQAIQYSAATSKPKKG*
Ga0066661_1010526913300005554SoilMEKGRRKLLEQVPTRKLLASIKKDMRKAVKASASAAKPKKK*
Ga0066692_1082379123300005555SoilMEKGRRKLLKQVPMRKLLASIKKDMRKLAAAAKPKKK*
Ga0066704_1052420923300005557SoilMDKGRRELLRKVETRKILASIKKDMRKLAAAAKPKKK*
Ga0070766_1008888413300005921SoilMEEGRKKMLKKVPTRKLLASIKKDIRKVLSPSASTSKSKK*
Ga0075522_1039681623300006638Arctic Peat SoilMEKGRKQMLKKVPTRKLLASIKKDLRQAIRASASAAKPKKG*
Ga0066665_1086107923300006796SoilVNERKERELLRKVPTRKLLASIKKDLKRQIRASASVRKSKK
Ga0073928_1115706713300006893Iron-Sulfur Acid SpringMEKGRKEMLKKVPTRKLLESIKKDLRRAIRASASPAKSKKR*
Ga0099830_1032175123300009088Vadose Zone SoilMDKGRRKLLKQVPTRKLLASIKQDMRKLAKEATSTVKSKRK*
Ga0099830_1066974213300009088Vadose Zone SoilPLDEGRKKLLKQVPTRKLLASIKKDIRKTLAAAKPKKG*
Ga0099828_1002310223300009089Vadose Zone SoilMEKGRQELLKKVPTRKLIASIKRDMRKLVREAAASAKRKKK*
Ga0099792_1009253123300009143Vadose Zone SoilMEKGRKELLKKVPTRKLLASIRKDLRKITASANRKKK*
Ga0114945_1000490253300009444Thermal SpringsMEKARRKMLERMPTRKLIASVKKDIRRIIRAAANPKRKKK*
Ga0114945_1004292743300009444Thermal SpringsMEKARKKLLKRVPTRKLLASIKQDIRRTVAAAKPKRK*
Ga0116136_100696383300009547PeatlandMEKGRKHMLKKVPTRKLLASIKKDLRHAIRESASAAKPKKD*
Ga0074045_1005327823300010341Bog Forest SoilMDEGRKRLLKKVPTRKLLASIKKDMRQLGRVTTSDAKPKKK*
Ga0074044_1022333223300010343Bog Forest SoilLEEGRKKLLEKVPTRKLLSFIKKDMLKLAAAAKTKPKK*
Ga0126372_1014005023300010360Tropical Forest SoilMDKGRKKLLKQVPTRKLVASIKKDARELIRTMEEKFGKPKKK*
Ga0136449_100040234113300010379Peatlands SoilMEKGRKNMLKQVPTRKLLASIKKDLRHAIRASASAAKPKKG*
Ga0136449_10025463823300010379Peatlands SoilMDEGRKKLLKRVPTRKLLASIKKDIRQTIRASASAAKPRKK*
Ga0134126_1006712123300010396Terrestrial SoilMEKGRKELLKRVPTRKLLASVKKDLRHAIRASAASAKPKK*
Ga0137392_1058398233300011269Vadose Zone SoilMEKGRKKLLKRMPTRKLVASIKKDLRRIVAASKPKKK*
Ga0137388_1001581843300012189Vadose Zone SoilMEKGRQELLKKVPTRKLIASIKTDMRKLVREAAASAKRKKK*
Ga0137388_1055841313300012189Vadose Zone SoilMDKGRKKLLEKVPTRKLLASIKKDMRKMLRATASAAKPLKKK*
Ga0137365_1003712113300012201Vadose Zone SoilMDKGRRELLRKVPTRKLLASIKKDMRKLAAAAKPKKK*
Ga0137363_1032469123300012202Vadose Zone SoilMEKGRKKLLKRMPTRKLVASIKKDLRRIVVASKPKKK*
Ga0137363_1114372023300012202Vadose Zone SoilLEEGRKKLIKKVPTRTLLASIKKDMRKALRSTASAAKPLKKK*
Ga0137362_1103364723300012205Vadose Zone SoilMEEGRKKLIKKVPTRTLLASIKKDMRKTLKMAASAAKPKKK
Ga0137360_1106834813300012361Vadose Zone SoilLDEGRKKLLEKVPTRKLLASIKRDMRKMLKATASAAKPLKKK*
Ga0137361_1073683223300012362Vadose Zone SoilMDEGRKKLLEKVPTRKLLASIRKDLRQMAAKAKSAVKPRKK*
Ga0137398_1063109823300012683Vadose Zone SoilMEEGRKKLIKKVPTRTLLASIKKDMRKTLKMAASAAKPKKK*
Ga0137395_1004166123300012917Vadose Zone SoilLDEGRKKLIKKVPTRTLLASIKKDMRKALRASASAAKPKKK*
Ga0137394_1006586353300012922Vadose Zone SoilMDKGRRKLLEAVPTRKLLASIKKDMRKLTTAAKPKKK*
Ga0137359_1161553923300012923Vadose Zone SoilMEKGRKKLIKKVPTRTLLASIKKDLRKTLRASASAAKPKKG*
Ga0137413_1015983413300012924Vadose Zone SoilEGRKKLLKRVPTRKLLASIKKDLRKVVAAAKRKKK*
Ga0137419_1013868623300012925Vadose Zone SoilMDKGRKKLLKQVPTRKLLASIKKDIRKTLAAAKPKKK*
Ga0137419_1055798323300012925Vadose Zone SoilMEKGRKELLKKVPTRKLLASIKKDLRKVTASANRKKK*
Ga0153915_1058040023300012931Freshwater WetlandsMEEGRKKLLKRVPTRKLLASIKKDIRKTLRVAASAAKPKKK*
Ga0181523_1005274623300014165BogMEKGRKELLKRVPMRKLLASIKKDARQVIRASAASGKPKKK*
Ga0182018_1010615823300014489PalsaMEKGRKQILKKVPTRKLLASIKKDLRQAIRASTSTVKPKKE*
Ga0182015_1003953213300014495PalsaMEKGRKNMLKRVPTRKLVASIKRDLRAAIRASAASAKPKKR*
Ga0182015_1049509623300014495PalsaMEKGRKELLKQVPTRKLLASIKKDIRKVIRASASAAKPKKK*
Ga0182024_1197059813300014501PermafrostMEEGRKKLLKKVPTRTLLASIKKDLRKVMRPTASAGKPKK*
Ga0137403_1070239223300015264Vadose Zone SoilMEEARKKLLKKVPTRKLLASIKKDLRKAIKPLQSAGRSKK*
Ga0187818_1058909023300017823Freshwater SedimentMEKGRRELLKKVPTRKLLASIKKDMRQALREAKAAS
Ga0187856_101002093300017925PeatlandMEKGRKHMLKKVPTRKLLASIKKDLRHAIRESASAAKPKKD
Ga0187825_1000244663300017930Freshwater SedimentMEKGRRELLKRVPTRKLLAAIKKDIRQTLREAKAADKPKKK
Ga0187803_10000006693300017934Freshwater SedimentMEKGRKELLKRIPMRKLAASVKKDLRKLVAAAKSKPR
Ga0187803_1000327723300017934Freshwater SedimentMEKGRRKLLKQVPTRKLLASIKKDIRRIVAAGKSKKK
Ga0187819_1062910323300017943Freshwater SedimentMEKGRRKLLEKVPTRKLLASIKRDLRQVIRASAASAK
Ga0187783_1080190923300017970Tropical PeatlandMEKGRKELLKGVPMRKLLASIKKDLRRGIKASASAGKPKKG
Ga0187781_1000433663300017972Tropical PeatlandMEKARRKMLEKMPTRKLLASIKKDLRKQLRASASAAKPKKG
Ga0187781_1005717053300017972Tropical PeatlandMEKGRKELLKRVPMRKLAASVKKDLRKIVAAGKSKKP
Ga0187781_1012257133300017972Tropical PeatlandMEKARRKMLEKVPTRKLLASIKKDLRKQLRASAAAAKPKKS
Ga0187782_1003183423300017975Tropical PeatlandMDEGRKKLIKQVPMRKLVASIKKDLRKITASAKPKKK
Ga0187857_1050464813300018026PeatlandMEKSRRELLKQMPTRKLLASIKRDIRQVIRAGTAKSKPK
Ga0187855_1001053553300018038PeatlandMEKGRKQLLKKVPTRKLVASIKKDLKQIIRASNSRKIK
Ga0187862_1002238183300018040PeatlandMEKGRKELLKRVPTRKLLASIKRDIRRTIAESSKPKSK
Ga0187859_1010895313300018047PeatlandHMEKGRKQLLKKVPTRKLVASIKKDLKQIIRASNSRKIK
Ga0187784_1043814613300018062Tropical PeatlandMEKGRRDLLKQVPTRKLVASIKKDMRKALREVKASGKPKRK
Ga0066662_1209512513300018468Grasslands SoilMEKGRKELLKQVPTRKLLASIKKDMRKLAAAAKPKKK
Ga0187892_10001221353300019458Bio-OozeMEKGRKKLLERVPTRKLVASVKKDIRRIIRAAAASAKPKKK
Ga0179592_1007614223300020199Vadose Zone SoilMEKGRKELLKKVPTRKLLASIKKDLRKVTASANRKKK
Ga0210403_1066972633300020580SoilLEAGRKKLLKQVPTRKLLASIKKDLRKVVAAAKPKKK
Ga0210399_1020272013300020581SoilMEEGRKKLLKQVPTRKLLASIKQDIRKAIRSTASAGKPLKKK
Ga0210399_1154686013300020581SoilLEEGRKKLLKRVPTRKLLASIKKDLRKVVAAAKPKKK
Ga0210401_1030112623300020583SoilMDKGRKKLLKQVPTRKLLASIRKDIRKVVASANRKKK
Ga0210401_1097812913300020583SoilMDEGRKKLLEKVPTRKLLASIKRDMRKMLRTTATAAKPKKK
Ga0215015_1012042623300021046SoilMDRVRKKLLKQVPTRKLLASIKKDIRKTLAAAKPKKK
Ga0215015_1046330323300021046SoilMEKGRRKLLKQVPTRKLLASIKKDIRKVVAAAKPKRK
Ga0210404_1000082923300021088SoilMEKGRKAMLKKVPLRTLVASVKRDLRRAIKASAAASKPKKG
Ga0210404_1018438423300021088SoilMDEGRKRLLEKVPTRKLLASIKKDLRKMAAKAKSAAKPNKK
Ga0210406_10003519113300021168SoilMDAGRKKLLKRVPTRKLLASIKKDIRQTLTAAKPKKK
Ga0210406_1038282013300021168SoilLEEGRKKLLKQVPTRKLLASIKKDIRKVVAAAKPKKK
Ga0210394_1012401923300021420SoilMEKGRKELLKRVPTRKLLASIKKDIRQTIRQAQAAGKPKKK
Ga0210384_1062002323300021432SoilMEKGRKELLKKVPTRKLLASIKRDIRKITASANRKKK
Ga0210390_1113949123300021474SoilSTRFTGAPRMEEGRKKMLKKVPTRKLLASIKKDIRKVLSPSASTSKSKK
Ga0187846_1006227713300021476BiofilmMDEGRKKLLTKVPTRKLLASIKRDMRKLAAQAKAAAKPKKK
Ga0187846_1023183913300021476BiofilmMEKGRRKLLEKMPTRKLMASIKRDLRHAIREGQAKPKKK
Ga0212128_1001515213300022563Thermal SpringsMEKARRKMLERMPTRKLIASVKKDIRRIIRAAANPKRKKK
Ga0212128_1006255643300022563Thermal SpringsMEKARKKLLKRVPTRKLLASIKQDIRRTVAAAKPKRK
Ga0207639_1167341713300026041Corn RhizosphereMDEGRKKLIKKISTRTLLASIKKDLRKVARASAAAAKPKKK
Ga0209235_116324023300026296Grasslands SoilMDKGRRKLLKQVPTRKLLASIKQDMRKLAREAASAAKSKRK
Ga0209761_115810923300026313Grasslands SoilMEKGRRKLLKQVPMRKLLASIKKDMRKLAAAAKPKKK
Ga0209056_1044377223300026538SoilVNERKERELLRKVPTRKLLASIKKDLKRQIRASASVRKSKKR
Ga0209056_1049084023300026538SoilLDEGRKKLLKKVPTRKLLASIKKDMRKLERESQAAAKSK
Ga0209117_103750323300027645Forest SoilLEEGRKKLLKQVPTRKLLASIKKDIRQNIRASAASAKPKKK
Ga0209178_107916823300027725Agricultural SoilMEKGRKELLKKVSTRKLLASVKRDMRKLAAAVKPKPKK
Ga0209655_1003528823300027767Bog Forest SoilMDERKKELHRVPTRKLLASIKKDLKQGIRAVGKPKKK
Ga0209726_1007037443300027815GroundwaterMEKGRKKLLKQVPTRKLLASVKRDIRHAIRAAAASGKPRGK
Ga0209180_1025932613300027846Vadose Zone SoilEQLKKVPTRKLLASIKKDIRRSLRATAAASGLKKRGK
Ga0209517_10000057303300027854Peatlands SoilMDEGRKKLLKKVPTRKLLASIKRDIRQLGRVTASAAKPKKK
Ga0209517_1001906473300027854Peatlands SoilMEKGRKNMLKQVPTRKLLASIKKDLRHAIRASASAAKPKKG
Ga0209167_100000551263300027867Surface SoilMEKGRKELLKRVPTRKLLASIKKDLRHAIRASAASAKSKKK
Ga0209283_1001268833300027875Vadose Zone SoilMEKGRQELLKKVPTRKLIASIKTDMRKLVREAAASAKRKKK
Ga0209006_1002692453300027908Forest SoilMEKGRKELLKKVPTRKLLASIKKDLRKITASANRKKK
Ga0268266_1140547213300028379Switchgrass RhizosphereLDEGRKKLIKKVPTRTLLASIKKDMRKALRATASAAKPLKKK
Ga0170824_12059472413300031231Forest SoilLDEGRKKIIKKVPTRTLLASIKKDMRKALRTTASAANPLKKK
Ga0302324_10014639323300031236PalsaMEKGRRKLLEKVPTRKLLASIKKDLRKEIRATASAAKPKKG
Ga0302324_10014679333300031236PalsaMERDARNKLLKQVPTRKLLASVKKDIRRTIRAAAAKSKPK
Ga0307374_1000664493300031670SoilMENGRKGMLKRVPTRKLAASIKRDLRKAIKAAVSAAKPKKD
Ga0307374_1017184313300031670SoilMEKGRKELLKRVPTRKLVASIKKELRHAIRASAASAKPRKK
Ga0310686_10206579023300031708SoilMENGRKKLLKRVPTRELLASIKRDLREVIAKANPKKK
Ga0310686_10354206433300031708SoilMEKGRREMLKKVPLRTLVASVKKDLRQAIRASAASAKPKKK
Ga0310686_10700861343300031708SoilMEKGRKKLLAEMPTRKLLASIKRDLRKYKTIAAASAKPKKG
Ga0307474_1127946413300031718Hardwood Forest SoilMEKGRKELLKKVPTRKLLAAIKKDIRRTLRASASTTKLKKK
Ga0307475_1027806913300031754Hardwood Forest SoilMEKARKKMLKEVPTRKLLASIKKDLRQAIRASAASAKPKKK
Ga0307478_1004833153300031823Hardwood Forest SoilMEKGRKKLLKKVPTRKLLASIKRDIRQVVASANRKKK
Ga0307479_1003251763300031962Hardwood Forest SoilMDKGRRKLLEKVPTRKLLASIKQDMRKLAAATKPKKK
Ga0326597_1190984213300031965SoilMEKGRKELLKRVPTRKLLASIKKDIRQAIRASAATRKPKK
Ga0311301_1027747633300032160Peatlands SoilMDEGRKKLLKRVPTRKLLASIKKDIRQTIRASASAAKPRKK
Ga0307471_10035300333300032180Hardwood Forest SoilMEKARKDMLKRVPLRKLLASVKKDLRRELRAVAASSKPKKK
Ga0307471_10077270013300032180Hardwood Forest SoilMEKARKKLLKEVPTRKLLASIKKDLREAIRASAASAKTKKK
Ga0307472_10009092523300032205Hardwood Forest SoilMERGRKKLLEKVPTRKLLAAVKRDMRMLAKAAKPKKK
Ga0335079_1167155413300032783SoilLEEGRKKLLKQVPTRKLLASIKKDLRQTIRRAEAAAKRKGK
Ga0335078_1005858233300032805SoilMDEGRKKLLEKVPTRKLLASVKRDMRKLAAQAKAAAKPKPKK
Ga0335078_1011002323300032805SoilMEKGRKELLKRVPTRKLLASIKKDVRQVIRASAASSKLKKK
Ga0335078_1112917723300032805SoilMEKGRKQLLKRVPMRKLAASIKKDLRQIVAAGKSKSR
Ga0335078_1137231723300032805SoilMNEQEKRELLKKVPTRKLLASIKKDIRRAVRASASAGKSKKK
Ga0335081_1011332843300032892SoilVEEGRKKLLKKVPTRKLVASIKKDLRKVINPPKPKKK
Ga0335069_1022401513300032893SoilMDEGRKKLIKRVPMRKLVASIKKDLRKVVNPPKPKKK
Ga0335075_1008555333300032896SoilMEKGRKQMLKKVPTRKLLASIKRDLRRELQASESTGKRRKD
Ga0335083_1099968323300032954SoilMEKGRKEMLKKVPTRKLVASIKKNLRQAIRASASAAKPKKG
Ga0326728_10012258113300033402Peat SoilMEKGRKALLKRVPTRKLLASIKKDLRQEIRVTRSEPKPNEK
Ga0316212_102336313300033547RootsKKLLAEMPTRKLLASIKRDLRKYKTIAAASAKPKKG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.