Metagenome / Metatranscriptome Family F053399

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F053399
Family Type	Metagenome / Metatranscriptome
Number of Sequences	141
Average Sequence Length	38 residues
Representative Sequence	MGLEPSDVLFIAIVIWLAIEIINGGGGGHRSRVPAR
Number of Associated Samples	105
Number of Associated Scaffolds	141

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	60.28 %
% of genes near scaffold ends (potentially truncated)	7.80 %
% of genes from short scaffolds (< 2000 bps)	72.34 %
Associated GOLD sequencing projects	98
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.199 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (13.475 % of family members)
Environment Ontology (ENVO)	Unclassified (17.730 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (54.610 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 28.12% β-sheet: 0.00% Coil/Unstructured: 71.88%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 141 Family Scaffolds
PF01593	Amino_oxidase	25.53
PF13450	NAD_binding_8	19.86
PF00117	GATase	13.48
PF00425	Chorismate_bind	7.09
PF00990	GGDEF	2.13
PF13620	CarboxypepD_reg	1.42
PF01180	DHO_dh	1.42
PF08282	Hydrolase_3	1.42
PF07589	PEP-CTERM	0.71
PF00710	Asparaginase	0.71
PF07676	PD40	0.71
PF01799	Fer2_2	0.71
PF04715	Anth_synt_I_N	0.71
PF01255	Prenyltransf	0.71
PF09997	DUF2238	0.71
PF00743	FMO-like	0.71
PF02148	zf-UBP	0.71
PF02913	FAD-oxidase_C	0.71
PF00326	Peptidase_S9	0.71
PF01212	Beta_elim_lyase	0.71
PF04964	Flp_Fap	0.71
PF01502	PRA-CH	0.71
PF00890	FAD_binding_2	0.71
PF05050	Methyltransf_21	0.71
PF09586	YfhO	0.71
PF00486	Trans_reg_C	0.71
PF00156	Pribosyltran	0.71
PF01042	Ribonuc_L-PSP	0.71
PF00155	Aminotran_1_2	0.71
PF06480	FtsH_ext	0.71

COG ID	Name	Functional Category	% Frequency in 141 Family Scaffolds
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	1.42
COG3769	Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily	Carbohydrate transport and metabolism [G]	1.42
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	1.42
COG2070	NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family	General function prediction only [R]	1.42
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	1.42
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	1.42
COG1167	DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain	Transcription [K]	1.42
COG0561	Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases	Coenzyme transport and metabolism [H]	1.42
COG0560	Phosphoserine phosphatase	Amino acid transport and metabolism [E]	1.42
COG0252	L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D	Translation, ribosomal structure and biogenesis [J]	1.42
COG0167	Dihydroorotate dehydrogenase	Nucleotide transport and metabolism [F]	1.42
COG0147	Anthranilate/para-aminobenzoate synthases component I	Amino acid transport and metabolism [E]	1.42
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	1.42
COG5207	Uncharacterized Zn-finger protein, UBP-type	General function prediction only [R]	0.71
COG0251	Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family	Defense mechanisms [V]	0.71
COG4992	Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase	Amino acid transport and metabolism [E]	0.71
COG3847	Flp pilus assembly protein, pilin Flp	Extracellular structures [W]	0.71
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	0.71
COG3033	Tryptophanase	Amino acid transport and metabolism [E]	0.71
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	0.71
COG2072	Predicted flavoprotein CzcO associated with the cation diffusion facilitator CzcD	Inorganic ion transport and metabolism [P]	0.71
COG0075	Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG	Amino acid transport and metabolism [E]	0.71
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	0.71
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	0.71
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	0.71
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.71
COG0112	Glycine/serine hydroxymethyltransferase	Amino acid transport and metabolism [E]	0.71
COG0139	Phosphoribosyl-AMP cyclohydrolase	Amino acid transport and metabolism [E]	0.71
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	0.71
COG1003	Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain	Amino acid transport and metabolism [E]	0.71
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	0.71
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	0.71
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	0.71
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	0.71
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	0.71
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	0.71
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.71

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.20 %
Unclassified	root	N/A	7.80 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.20 %
Unclassified	root	N/A	7.80 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.20 %
Unclassified	root	N/A	7.80 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	56.03 %
Unclassified	root	N/A	7.80 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.71 %

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	17.73 %
Unclassified	root	N/A	7.80 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.71 %

Name	Rank	Taxonomy	Distribution
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	8.51 %
Unclassified	root	N/A	7.80 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	4.96 %
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	0.71 %
Candidatus Brocadiia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.80 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4.96 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	3.55 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.71 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.71 %
unclassified Candidatus Brocadiae	no rank	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.80 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	3.55 %
unclassified Acidobacteriaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae	0.71 %
Bryobacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter	0.71 %
Candidatus Brocadiae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	0.71 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.71 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	7.80 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	3.55 %
Bryobacter aggregatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	0.71 %
Acidobacteriaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	0.71 %
Candidatus Brocadiae bacterium	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	0.71 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.71 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908009\|FWIRA_GRAM18401DV5QC	Not Available	516	Open in IMG/M
3300000567\|JGI12270J11330_10067630	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → unclassified Candidatus Brocadiae → Candidatus Brocadiae bacterium	1802	Open in IMG/M
3300005524\|Ga0070737_10000031	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	357283	Open in IMG/M
3300005524\|Ga0070737_10156337	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	978	Open in IMG/M
3300005531\|Ga0070738_10000208	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	184752	Open in IMG/M
3300005533\|Ga0070734_10627527	Not Available	611	Open in IMG/M
3300005534\|Ga0070735_10015075	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5737	Open in IMG/M
3300005537\|Ga0070730_10087683	All Organisms → cellular organisms → Bacteria → Acidobacteria	2171	Open in IMG/M
3300005541\|Ga0070733_10013075	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5210	Open in IMG/M
3300005541\|Ga0070733_10510837	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300005541\|Ga0070733_11075357	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus	540	Open in IMG/M
3300005591\|Ga0070761_10288789	All Organisms → cellular organisms → Bacteria → Acidobacteria	985	Open in IMG/M
3300005607\|Ga0070740_10070335	All Organisms → cellular organisms → Bacteria	1672	Open in IMG/M
3300005719\|Ga0068861_101101462	All Organisms → cellular organisms → Bacteria	763	Open in IMG/M
3300006050\|Ga0075028_100315635	All Organisms → cellular organisms → Bacteria	875	Open in IMG/M
3300006052\|Ga0075029_100000308	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	27630	Open in IMG/M
3300006052\|Ga0075029_101106087	All Organisms → cellular organisms → Bacteria → Acidobacteria	550	Open in IMG/M
3300006176\|Ga0070765_101697786	All Organisms → cellular organisms → Bacteria → Acidobacteria	593	Open in IMG/M
3300006354\|Ga0075021_10012654	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	4616	Open in IMG/M
3300007819\|Ga0104322_104247	All Organisms → cellular organisms → Bacteria	1040	Open in IMG/M
3300009038\|Ga0099829_10588053	All Organisms → cellular organisms → Bacteria → Acidobacteria	925	Open in IMG/M
3300009088\|Ga0099830_10654460	All Organisms → cellular organisms → Bacteria	864	Open in IMG/M
3300009089\|Ga0099828_10290647	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium	1469	Open in IMG/M
3300009090\|Ga0099827_10686414	All Organisms → cellular organisms → Bacteria → Acidobacteria	885	Open in IMG/M
3300009177\|Ga0105248_12791449	Not Available	557	Open in IMG/M
3300009633\|Ga0116129_1000293	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	34322	Open in IMG/M
3300010048\|Ga0126373_10496418	All Organisms → cellular organisms → Bacteria	1262	Open in IMG/M
3300010376\|Ga0126381_100017697	All Organisms → cellular organisms → Bacteria	8251	Open in IMG/M
3300010379\|Ga0136449_100740998	All Organisms → cellular organisms → Bacteria	1638	Open in IMG/M
3300010379\|Ga0136449_104123533	All Organisms → cellular organisms → Bacteria → Acidobacteria	540	Open in IMG/M
3300010396\|Ga0134126_11477749	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300010401\|Ga0134121_10255080	All Organisms → cellular organisms → Bacteria	1536	Open in IMG/M
3300010403\|Ga0134123_10899208	All Organisms → cellular organisms → Bacteria	891	Open in IMG/M
3300010880\|Ga0126350_12311156	All Organisms → cellular organisms → Bacteria → Acidobacteria	612	Open in IMG/M
3300011120\|Ga0150983_14479860	Not Available	532	Open in IMG/M
3300011271\|Ga0137393_10681195	All Organisms → cellular organisms → Bacteria → Acidobacteria	881	Open in IMG/M
3300012361\|Ga0137360_10206120	All Organisms → cellular organisms → Bacteria	1594	Open in IMG/M
3300012362\|Ga0137361_11372359	All Organisms → cellular organisms → Bacteria	630	Open in IMG/M
3300012363\|Ga0137390_10888354	All Organisms → cellular organisms → Bacteria	846	Open in IMG/M
3300012923\|Ga0137359_10049312	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	3659	Open in IMG/M
3300012929\|Ga0137404_12203047	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300014162\|Ga0181538_10117812	All Organisms → cellular organisms → Bacteria	1549	Open in IMG/M
3300014162\|Ga0181538_10406375	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	725	Open in IMG/M
3300014326\|Ga0157380_11397685	All Organisms → cellular organisms → Bacteria	750	Open in IMG/M
3300014489\|Ga0182018_10415162	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	719	Open in IMG/M
3300014495\|Ga0182015_10164226	All Organisms → cellular organisms → Bacteria → Acidobacteria	1502	Open in IMG/M
3300014499\|Ga0182012_10108304	All Organisms → cellular organisms → Bacteria → Acidobacteria	2072	Open in IMG/M
3300014501\|Ga0182024_10009383	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	20248	Open in IMG/M
3300014501\|Ga0182024_10043007	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	7359	Open in IMG/M
3300014501\|Ga0182024_11166582	All Organisms → cellular organisms → Bacteria	904	Open in IMG/M
3300014501\|Ga0182024_11782650	All Organisms → cellular organisms → Bacteria → Acidobacteria	689	Open in IMG/M
3300014838\|Ga0182030_10001883	All Organisms → cellular organisms → Bacteria → Acidobacteria	44005	Open in IMG/M
3300014838\|Ga0182030_10050566	All Organisms → cellular organisms → Bacteria	6632	Open in IMG/M
3300014968\|Ga0157379_10665340	All Organisms → cellular organisms → Bacteria	976	Open in IMG/M
3300016750\|Ga0181505_10736552	Not Available	519	Open in IMG/M
3300017943\|Ga0187819_10151857	Not Available	1379	Open in IMG/M
3300017948\|Ga0187847_10619802	All Organisms → cellular organisms → Bacteria → Acidobacteria	605	Open in IMG/M
3300017970\|Ga0187783_10636705	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300017972\|Ga0187781_10582267	All Organisms → cellular organisms → Bacteria → Acidobacteria	806	Open in IMG/M
3300017972\|Ga0187781_10771901	All Organisms → cellular organisms → Bacteria → Acidobacteria	697	Open in IMG/M
3300017975\|Ga0187782_10122206	All Organisms → cellular organisms → Bacteria → Acidobacteria	1926	Open in IMG/M
3300018007\|Ga0187805_10129006	All Organisms → cellular organisms → Bacteria	1148	Open in IMG/M
3300018014\|Ga0187860_1023935	All Organisms → cellular organisms → Bacteria	3456	Open in IMG/M
3300018086\|Ga0187769_10394774	All Organisms → cellular organisms → Bacteria → Acidobacteria	1040	Open in IMG/M
3300018088\|Ga0187771_11739891	Not Available	529	Open in IMG/M
3300020579\|Ga0210407_10059728	All Organisms → cellular organisms → Bacteria → Acidobacteria	2854	Open in IMG/M
3300020580\|Ga0210403_10000366	All Organisms → cellular organisms → Bacteria → Acidobacteria	48987	Open in IMG/M
3300021168\|Ga0210406_10529495	All Organisms → cellular organisms → Bacteria	928	Open in IMG/M
3300021171\|Ga0210405_10266474	All Organisms → cellular organisms → Bacteria	1355	Open in IMG/M
3300021171\|Ga0210405_10922713	All Organisms → cellular organisms → Bacteria → Acidobacteria	662	Open in IMG/M
3300021181\|Ga0210388_10000008	All Organisms → cellular organisms → Bacteria → Acidobacteria	446328	Open in IMG/M
3300021403\|Ga0210397_11548029	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300021405\|Ga0210387_10622176	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300021420\|Ga0210394_10499665	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1070	Open in IMG/M
3300021432\|Ga0210384_10609554	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	980	Open in IMG/M
3300021432\|Ga0210384_11499091	All Organisms → cellular organisms → Bacteria	580	Open in IMG/M
3300021475\|Ga0210392_11439899	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300025463\|Ga0208193_1000716	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	15962	Open in IMG/M
3300026075\|Ga0207708_10626675	All Organisms → cellular organisms → Bacteria → Acidobacteria	913	Open in IMG/M
3300026320\|Ga0209131_1083186	All Organisms → cellular organisms → Bacteria	1721	Open in IMG/M
3300027706\|Ga0209581_1000006	All Organisms → cellular organisms → Bacteria → Acidobacteria	993998	Open in IMG/M
3300027706\|Ga0209581_1012131	All Organisms → cellular organisms → Bacteria → Acidobacteria	5266	Open in IMG/M
3300027706\|Ga0209581_1114460	All Organisms → cellular organisms → Bacteria	909	Open in IMG/M
3300027795\|Ga0209139_10162541	All Organisms → cellular organisms → Bacteria	790	Open in IMG/M
3300027842\|Ga0209580_10309207	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	787	Open in IMG/M
3300027867\|Ga0209167_10117794	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1372	Open in IMG/M
3300027867\|Ga0209167_10581810	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300027869\|Ga0209579_10005484	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	8607	Open in IMG/M
3300027875\|Ga0209283_10296057	All Organisms → cellular organisms → Bacteria	1068	Open in IMG/M
3300027905\|Ga0209415_10151731	All Organisms → cellular organisms → Bacteria → Acidobacteria	2327	Open in IMG/M
3300027910\|Ga0209583_10268995	Not Available	760	Open in IMG/M
3300027911\|Ga0209698_10001649	All Organisms → cellular organisms → Bacteria → Acidobacteria	25715	Open in IMG/M
3300027911\|Ga0209698_10106760	All Organisms → cellular organisms → Bacteria → Acidobacteria	2338	Open in IMG/M
3300027965\|Ga0209062_1000021	All Organisms → cellular organisms → Bacteria → Acidobacteria	718977	Open in IMG/M
3300027986\|Ga0209168_10144559	All Organisms → cellular organisms → Bacteria	1208	Open in IMG/M
3300028780\|Ga0302225_10503036	All Organisms → cellular organisms → Bacteria	565	Open in IMG/M
3300028792\|Ga0307504_10424723	Not Available	528	Open in IMG/M
3300029911\|Ga0311361_10244231	All Organisms → cellular organisms → Bacteria → Acidobacteria	2115	Open in IMG/M
3300029911\|Ga0311361_10299129	All Organisms → cellular organisms → Bacteria	1811	Open in IMG/M
3300029999\|Ga0311339_10125837	All Organisms → cellular organisms → Bacteria → Acidobacteria	3079	Open in IMG/M
3300030991\|Ga0073994_11623134	All Organisms → cellular organisms → Bacteria → Acidobacteria	503	Open in IMG/M
3300031122\|Ga0170822_16823232	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300031231\|Ga0170824_101503152	All Organisms → cellular organisms → Bacteria → Acidobacteria	500	Open in IMG/M
3300031231\|Ga0170824_102896048	Not Available	703	Open in IMG/M
3300031234\|Ga0302325_10464803	All Organisms → cellular organisms → Bacteria	1932	Open in IMG/M
3300031234\|Ga0302325_10625343	All Organisms → cellular organisms → Bacteria	1577	Open in IMG/M
3300031234\|Ga0302325_11907876	All Organisms → cellular organisms → Bacteria → Acidobacteria	738	Open in IMG/M
3300031234\|Ga0302325_12242197	All Organisms → cellular organisms → Bacteria → Acidobacteria	663	Open in IMG/M
3300031236\|Ga0302324_102807785	All Organisms → cellular organisms → Bacteria → Acidobacteria	586	Open in IMG/M
3300031250\|Ga0265331_10528827	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300031525\|Ga0302326_10169646	All Organisms → cellular organisms → Bacteria → Acidobacteria	3711	Open in IMG/M
3300031525\|Ga0302326_10681570	All Organisms → cellular organisms → Bacteria → Acidobacteria	1508	Open in IMG/M
3300031525\|Ga0302326_12931377	All Organisms → cellular organisms → Bacteria	585	Open in IMG/M
3300031708\|Ga0310686_100088885	All Organisms → cellular organisms → Bacteria → Acidobacteria	1388	Open in IMG/M
3300031708\|Ga0310686_104066854	All Organisms → cellular organisms → Bacteria → Acidobacteria	19587	Open in IMG/M
3300031708\|Ga0310686_105134641	All Organisms → cellular organisms → Bacteria → Acidobacteria	522	Open in IMG/M
3300031708\|Ga0310686_108246245	All Organisms → cellular organisms → Bacteria → Acidobacteria	2960	Open in IMG/M
3300031708\|Ga0310686_112518371	All Organisms → cellular organisms → Bacteria → Acidobacteria	1677	Open in IMG/M
3300031708\|Ga0310686_113784878	Not Available	515	Open in IMG/M
3300031708\|Ga0310686_115674183	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	12794	Open in IMG/M
3300031708\|Ga0310686_116499428	All Organisms → cellular organisms → Bacteria	7192	Open in IMG/M
3300031715\|Ga0307476_10301341	All Organisms → cellular organisms → Bacteria → Acidobacteria	1176	Open in IMG/M
3300031715\|Ga0307476_11139695	All Organisms → cellular organisms → Bacteria → Acidobacteria	572	Open in IMG/M
3300031718\|Ga0307474_10262752	All Organisms → cellular organisms → Bacteria → Acidobacteria	1324	Open in IMG/M
3300031718\|Ga0307474_10427491	All Organisms → cellular organisms → Bacteria	1033	Open in IMG/M
3300031718\|Ga0307474_10753126	All Organisms → cellular organisms → Bacteria	770	Open in IMG/M
3300032160\|Ga0311301_10002162	All Organisms → cellular organisms → Bacteria → Acidobacteria	74546	Open in IMG/M
3300032160\|Ga0311301_10472763	All Organisms → cellular organisms → Bacteria → Acidobacteria	1875	Open in IMG/M
3300032160\|Ga0311301_12631580	All Organisms → cellular organisms → Bacteria → Acidobacteria	557	Open in IMG/M
3300032205\|Ga0307472_100457298	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	1087	Open in IMG/M
3300032515\|Ga0348332_14736253	All Organisms → cellular organisms → Bacteria → Acidobacteria	1006	Open in IMG/M
3300032770\|Ga0335085_10622493	All Organisms → cellular organisms → Bacteria	1211	Open in IMG/M
3300032783\|Ga0335079_11210604	All Organisms → cellular organisms → Bacteria → Acidobacteria	759	Open in IMG/M
3300032805\|Ga0335078_10379970	All Organisms → cellular organisms → Bacteria	1863	Open in IMG/M
3300032829\|Ga0335070_10000011	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	339217	Open in IMG/M
3300032892\|Ga0335081_10379491	All Organisms → cellular organisms → Bacteria → Acidobacteria	1828	Open in IMG/M
3300032895\|Ga0335074_10052344	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	5614	Open in IMG/M
3300032897\|Ga0335071_10180834	All Organisms → cellular organisms → Bacteria	2062	Open in IMG/M
3300032954\|Ga0335083_10747639	All Organisms → cellular organisms → Bacteria	789	Open in IMG/M
3300033405\|Ga0326727_10908433	All Organisms → cellular organisms → Bacteria → Acidobacteria	658	Open in IMG/M
3300033887\|Ga0334790_030022	All Organisms → cellular organisms → Bacteria → Acidobacteria	2267	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	96.45%
Host-Associated	Host-Associated	3.55%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	84.40%
Aquatic	Environmental → Aquatic	12.06%
Plants	Host-Associated → Plants	3.55%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	73.76%
Peat	Environmental → Terrestrial → Peat	9.93%
Freshwater	Environmental → Aquatic → Freshwater	7.09%
Sediment	Environmental → Aquatic → Sediment	4.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.84%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.71%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.61%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	16.31%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	9.93%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	7.09%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.96%
Loam	Environmental → Terrestrial → Soil → Loam	2.84%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.13%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.71%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.71%
Soil	Host-Associated → Plants → Rhizosphere → Soil	0.71%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	38.30%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	15.60%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	9.93%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	9.93%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	6.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.96%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	4.26%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.13%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.13%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.42%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.42%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.71%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.71%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.71%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	0.71%

Habitat	Taxonomy	Distribution
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	13.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	9.22%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	7.80%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	7.09%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	6.38%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	5.67%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	4.96%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	4.96%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	4.26%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.26%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost	2.84%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.13%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	2.13%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	2.13%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.42%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.42%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.42%
Palsa	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa	1.42%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.42%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	1.42%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.42%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.71%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.71%
Permafrost Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil	0.71%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.71%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.71%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.71%
Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil	0.71%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.71%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.71%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.71%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.71%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.71%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908009	Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2	Environmental	Open in IMG/M
3300000567	Peat soil microbial communities from Weissenstadt, Germany - SII-2010	Environmental	Open in IMG/M
3300005524	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1	Environmental	Open in IMG/M
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental	Open in IMG/M
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005537	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1	Environmental	Open in IMG/M
3300005541	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1	Environmental	Open in IMG/M
3300005591	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1	Environmental	Open in IMG/M
3300005607	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2	Environmental	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300006050	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014	Environmental	Open in IMG/M
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006354	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012	Environmental	Open in IMG/M
3300007819	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009633	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010379	Sb_50d combined assembly	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental	Open in IMG/M
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental	Open in IMG/M
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental	Open in IMG/M
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300014162	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014489	Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG	Environmental	Open in IMG/M
3300014495	Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG	Environmental	Open in IMG/M
3300014499	Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG	Environmental	Open in IMG/M
3300014501	Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300016750	Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017948	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10	Environmental	Open in IMG/M
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental	Open in IMG/M
3300018007	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5	Environmental	Open in IMG/M
3300018014	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40	Environmental	Open in IMG/M
3300018086	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG	Environmental	Open in IMG/M
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental	Open in IMG/M
3300020579	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300021168	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M	Environmental	Open in IMG/M
3300021171	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M	Environmental	Open in IMG/M
3300021181	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O	Environmental	Open in IMG/M
3300021403	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O	Environmental	Open in IMG/M
3300021405	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O	Environmental	Open in IMG/M
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental	Open in IMG/M
3300021432	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300025463	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026320	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)	Environmental	Open in IMG/M
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027795	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)	Environmental	Open in IMG/M
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027867	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027965	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028780	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300029911	III_Bog_N2 coassembly	Environmental	Open in IMG/M
3300029999	I_Palsa_E3 coassembly	Environmental	Open in IMG/M
3300030991	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031122	Oak Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental	Open in IMG/M
3300031236	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1	Environmental	Open in IMG/M
3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Host-Associated	Open in IMG/M
3300031525	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031715	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032515	FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032805	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2	Environmental	Open in IMG/M
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental	Open in IMG/M
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental	Open in IMG/M
3300032895	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033405	Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY	Environmental	Open in IMG/M
3300033887	Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIRA_01886560	2124908009	Soil	MGLEPSDVLFIVIVIWIALEIINGDWGGGHRGRVPVQ
JGI12270J11330_100676302	3300000567	Peatlands Soil	MQLEPSDVVFIAIVIWLAIEIINGDWGGGFRSRVPVR*
Ga0070737_10000031242	3300005524	Surface Soil	MGVEPSDVLFIAIVVWIILEIINGDWGGGHRARVPARS*
Ga0070737_101563372	3300005524	Surface Soil	MGVEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPARS*
Ga0070738_1000020835	3300005531	Surface Soil	MGLEPSDVLFIAIILWIILEIINGDWGGGHRARVPATTR*
Ga0070734_106275272	3300005533	Surface Soil	MGLEPSDVLFIAIVLWLIFEIINGDWGGGRRARVPVF*
Ga0070735_100150755	3300005534	Surface Soil	MGLEPSDVLFIAIIIWIVLEIIDDDWGGGHRARVPAH*
Ga0070730_100876832	3300005537	Surface Soil	MPLDPSDAVFLAIVIWLALEIMDGGGGGRRSRVPAAS*
Ga0070733_100130755	3300005541	Surface Soil	MPLDPSDVVFLAIVIWLALEIMNGGGGGHRARLPLSS*
Ga0070733_105108372	3300005541	Surface Soil	MGLEPSDVLFISIVLWLIFEIINGDSGGGRRARVPVR*
Ga0070733_110753572	3300005541	Surface Soil	MPLDPSDAVFLAIVIWLALEIMNGGGGGRRSRVPAAS*
Ga0070761_102887891	3300005591	Soil	MVLEPSDVLFIAMVIWLAIEIINGGGGGRRSRLPAQVRA*
Ga0070740_100703352	3300005607	Surface Soil	MGIEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPEPAPAPTR*
Ga0068861_1011014621	3300005719	Switchgrass Rhizosphere	MGLQPTDVLFIAIVVWIAIQIIDGDWGGGRRARQSAR*
Ga0075028_1003156352	3300006050	Watersheds	MALEPGDVVFLAIVIWIAVQITSGGDGGRRRRVPVAL*
Ga0075029_10000030820	3300006052	Watersheds	MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRVGAQ*
Ga0075029_1011060871	3300006052	Watersheds	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS*
Ga0070765_1016977862	3300006176	Soil	MFVLMALEPSDVLFIVMVIWLALEIIKGDGGGGHRKRIPVMG*
Ga0075021_100126545	3300006354	Watersheds	MILEPSDVVFLALVIWLAVQITNGGDGGRRARLPVAI*
Ga0104322_1042472	3300007819	Permafrost Soil	MALEPSDILFIAIVIWLAVEILSGGGGGRRSRLPAFAR*
Ga0099829_105880532	3300009038	Vadose Zone Soil	MPLDPSDVVFLAIVIWLALEIMNGGGGGRRARLPVSS*
Ga0099830_106544601	3300009088	Vadose Zone Soil	MGIEPSDVLFLIIILWIVVEIINNGDWGGGHRARVPAA*
Ga0099828_102906472	3300009089	Vadose Zone Soil	MGIEPSDIVFIAIVIWLAFEIINGDSGGGRRARVPAK*
Ga0099827_106864142	3300009090	Vadose Zone Soil	MGIEPSDIVFVAIVIWLAFEIINGDSGGGRRARVPAK*
Ga0105248_127914491	3300009177	Switchgrass Rhizosphere	MGLQPSDVLFIAIVVWIAIQVIDGDWGGGRRARQSAR*
Ga0116129_100029314	3300009633	Peatland	MGLQPSDVLFIAIVIWLAIQIIDGGGGGRRSRLPVRI*
Ga0126373_104964182	3300010048	Tropical Forest Soil	MAIEPSDVLFIAIILWIILEIINGDWGGGHRARVPVR*
Ga0126381_1000176978	3300010376	Tropical Forest Soil	MGLEPSDVLFIAIVIWLAIEIINGDWGGGKRSRVPAL*
Ga0136449_1007409982	3300010379	Peatlands Soil	MELEPSDLLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS*
Ga0136449_1041235332	3300010379	Peatlands Soil	MGLEPSDVLFIAIVIWLAFEIINGGGGGHRSRVPAK*
Ga0134126_114777492	3300010396	Terrestrial Soil	MGLDPSDVLFIAIVIWLILEIINGDWGGGHHARVPVR*
Ga0134121_102550802	3300010401	Terrestrial Soil	MGLQPSDVLFIAIVVWIAIQINGDWGGGRRARQPIR*
Ga0134123_108992081	3300010403	Terrestrial Soil	MGLQPSDVLFIAIVVWIVIQIINGDWGGGRRTRQPVR*
Ga0126350_123111561	3300010880	Boreal Forest Soil	MVLEPSDVLFIAIVIWLAIQIINGDSGGGRRKRVPV
Ga0150983_144798601	3300011120	Forest Soil	LEPSDVLFISIVLWLIFEIINGDSGGGRRARVPVR*
Ga0137393_106811953	3300011271	Vadose Zone Soil	MGLDMVLNPGDVLFVAIVIWIAIQIIDGDSGGGRRARQPVRY*
Ga0137360_102061203	3300012361	Vadose Zone Soil	MALEPSDFLFIAVVIWLAFEIINSDWGGGKRSRVPAQ*
Ga0137361_113723591	3300012362	Vadose Zone Soil	MALEPSDFLFIAVVIWLAFEIINLDWGGGKRSRVPAQ*
Ga0137390_108883542	3300012363	Vadose Zone Soil	YMGIEPSDVLFLIIILWIVVEIINNGDWGGGHRARVPAA*
Ga0137359_100493124	3300012923	Vadose Zone Soil	MGLEPSDVLFIIILLWIVLEIINNGDWGGGHRARVPVT*
Ga0137404_122030472	3300012929	Vadose Zone Soil	MRIEPSDVLFIAIVIWIAVQLINGDWGGGRRARQPIR*
Ga0181538_101178122	3300014162	Bog	MGLEPSDVLFIAIVIWLAIEIINGGGGGHRSRVPAR*
Ga0181538_104063752	3300014162	Bog	MGLEPSDVLFILIVIWLALEIINGDWGGGHTARVPAA*
Ga0157380_113976852	3300014326	Switchgrass Rhizosphere	MGLQPSDVLFIAIVVWIAIQIINGDWGGGRRTRQPVR*
Ga0182018_104151622	3300014489	Palsa	MGLEPSDVLFILIVIWLALEIINGDWGGGHRARVPAA*
Ga0182015_101642262	3300014495	Palsa	MGLQPSDVLFIAIVIWLAIEIINGGGGGRRSRLPIRIH*
Ga0182012_101083042	3300014499	Bog	MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRAGAL*
Ga0182024_100093836	3300014501	Permafrost	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRVPIRAQ*
Ga0182024_100430072	3300014501	Permafrost	MVLEPSDVLFIAIVIWLAIEILNGGGGGRRSRLPLRTI*
Ga0182024_111665821	3300014501	Permafrost	MGLEPSDVLFIVIVIWIALEIINGDWGGGHRGRVPV*
Ga0182024_117826501	3300014501	Permafrost	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLRVPA*
Ga0182030_1000188330	3300014838	Bog	MGIEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRANS*
Ga0182030_100505666	3300014838	Bog	MQMGLEPSDVLFIVIVIWLAIQITDGGSGGGRRRARVPAQ*
Ga0157379_106653401	3300014968	Switchgrass Rhizosphere	MGLQPSDVLFIAIVVWIAIQIINGDWGGGRRTRQPIR*
Ga0181505_107365522	3300016750	Peatland	MGLEPSDVLFILIVIWLALEIINGDWGGGHTARVPAA
Ga0187819_101518571	3300017943	Freshwater Sediment	MGLEPSDILFIAIILWIILEIINGDWGGGHRSRVPAR
Ga0187847_106198021	3300017948	Peatland	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLRVPA
Ga0187783_106367052	3300017970	Tropical Peatland	KFRMTIQPSDVLLIAIVIWLVIEIISGGGGGRRSRLRIPA
Ga0187781_105822673	3300017972	Tropical Peatland	MGPSDILFIAIILWLIVEIINGEGGGGHRARVPSR
Ga0187781_107719011	3300017972	Tropical Peatland	MNLQPSDVVFIAIVIWMLLEIINGDGGGGRRARVPA
Ga0187782_101222062	3300017975	Tropical Peatland	MGLQPSDVVFIAIVIWIAIEIINGDGGGGWRDRVPVH
Ga0187805_101290062	3300018007	Freshwater Sediment	MGLQPSDILFIAIILWIILEIINGDWGGGHRSRVPAR
Ga0187860_10239356	3300018014	Peatland	MGLEPSDVLFIAIVIWLAIEIINGGGGGHRSRVPAR
Ga0187769_103947742	3300018086	Tropical Peatland	MGLQPSDVVFIAIVIWIAIEIINGDGGGGRRDRVPVH
Ga0187771_117398912	3300018088	Tropical Peatland	MGLEPSDVVFIAIVIWLALEIINGDWGGGHRARVPAR
Ga0210407_100597284	3300020579	Soil	MGLEPTDVLFIAIVIWLALEIINGDWGGWHRVRGPER
Ga0210403_100003663	3300020580	Soil	MGLEPTDVLFIAIVIWLALEIINGDWGGGHRVRVPAR
Ga0210406_105294952	3300021168	Soil	MGLEPSDIIFIAIVLWIVLEIINNDDWGSGHRARVPARS
Ga0210405_102664743	3300021171	Soil	MGLEPSDVLFISIVLWLIFEIINGDSGGGRRARVPVR
Ga0210405_109227132	3300021171	Soil	MPLDPSDVVFLAIVIWLALEIMNGGGGGRRARAPLSS
Ga0210388_1000000866	3300021181	Soil	MGLEPSDVLFIAVVIWLAIEIINGGGGGRRSRLPILGH
Ga0210397_115480291	3300021403	Soil	CCPAGISAILELHMGLEPSDVLFIAIVIWLAIEIINSGGGGRRSRLPLRAH
Ga0210387_106221761	3300021405	Soil	MVLEPSDILFIAIVLWLALEILNGGGGGRRRSRLPLLSN
Ga0210394_104996652	3300021420	Soil	MSIEPSDVLFIAIVIWLAIEIINGDWGGGKRSRVPAN
Ga0210384_106095542	3300021432	Soil	MPIDPSDVVFLAIVIWLALEIMNGGGGGRRARVPASS
Ga0210384_114990912	3300021432	Soil	MGLEPSDVLFIAVVIWIAVKIIDGDSGGGRRSRQPV
Ga0210392_114398991	3300021475	Soil	YWKDLTMDLQPSDVLFIAIVIWIAVTLMNSDGGGGFRKRIPVPVR
Ga0208193_10007164	3300025463	Peatland	MGLQPSDVLFIAIVIWLAIQIIDGGGGGRRSRLPVRI
Ga0207708_106266751	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MGLQPSDVLFIAIVVWIAIQIINGDWGGGRRTRQPIR
Ga0209131_10831862	3300026320	Grasslands Soil	MQFDPSDVLFIAIVIWIAVQIINGDWGGGRRARQPIR
Ga0209581_1000006216	3300027706	Surface Soil	MGVEPSDVLFIAIVVWIILEIINGDWGGGHRARVPARS
Ga0209581_10121313	3300027706	Surface Soil	MGVEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPARS
Ga0209581_11144601	3300027706	Surface Soil	MGIEPSDVLFIAIIIWIVLEIINGDWGGGHRARVPEPAPAPTR
Ga0209139_101625412	3300027795	Bog Forest Soil	MGLEPTDVLFIGIILWLIFEIINGDSGGGRRAPVPVR
Ga0209580_103092072	3300027842	Surface Soil	MPLDPSDAVFLAIVIWLALEIMDGGGGGRRSRVPAAS
Ga0209167_101177942	3300027867	Surface Soil	MPLDPSDVVFLAIVIWLALEIMNGGGGGHRARLPLSS
Ga0209167_105818102	3300027867	Surface Soil	MQFDPSDILFIAIILWLILEIINGDWGGGHRARVPTN
Ga0209579_100054847	3300027869	Surface Soil	MGLEPSDVLFIAIVLWLIFEIINGDWGGGRRARVPVF
Ga0209283_102960572	3300027875	Vadose Zone Soil	MGIEPSDIVFIAIVIWLAFEIINGDSGGGRRARVPAK
Ga0209415_101517311	3300027905	Peatlands Soil	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS
Ga0209583_102689952	3300027910	Watersheds	MGLEPSDFVFIAIVIWLAFEIINGDSGGGRRARVPAQ
Ga0209698_1000164911	3300027911	Watersheds	MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRVGAQ
Ga0209698_101067602	3300027911	Watersheds	MGLEPSDVVFIAIVIWLAIEILNGNSGGGKRSRVPA
Ga0209062_1000021124	3300027965	Surface Soil	MGLEPSDVLFIAIILWIILEIINGDWGGGHRARVPATTR
Ga0209168_101445591	3300027986	Surface Soil	MGLEPSDVLFIAIIIWIVLEIIDDDWGGGHRARVPAH
Ga0302225_105030362	3300028780	Palsa	MALEPTDVLFIGIVLWLIFEIINGDSGGGRRAPVPAR
Ga0307504_104247232	3300028792	Soil	MPLDPSDAIFLAIVIWLALEIMDGGGGGRRARLPVSS
Ga0311361_102442313	3300029911	Bog	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAH
Ga0311361_102991292	3300029911	Bog	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPIHAN
Ga0311339_101258373	3300029999	Palsa	MGLEPSDVLFIAIVVWLAIEIINGGGGGRRSRLPLRVS
Ga0073994_116231342	3300030991	Soil	MAIEPSDVLFITIVIWLAIEIINGGGGGRRSRVPLRAL
Ga0170822_168232322	3300031122	Forest Soil	MPIDPSDVVFLAIVIWLALEIMNGGGGGRRARLPASS
Ga0170824_1015031522	3300031231	Forest Soil	MGLQPSDVLFIAIVIWLAIEIINGGGGGRRSRIPLRAN
Ga0170824_1028960481	3300031231	Forest Soil	AILEVPMGLQPSDILFIAIVIWLAIEILNGGGGGRRSRLPLRAYS
Ga0302325_104648033	3300031234	Palsa	MALEPTDVLFIAIVIWLALEIINGGGGGRRSRLPVRA
Ga0302325_106253432	3300031234	Palsa	MGLEPSDVLFILIVIWIALEIINGDWGGGHTARIPSA
Ga0302325_119078762	3300031234	Palsa	MGLEPSDVVFIAIVIWLAIEIINGGGGGRRSRLRVPA
Ga0302325_122421972	3300031234	Palsa	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRARVHAH
Ga0302324_1028077851	3300031236	Palsa	MVLEPSDVLFIAIVIWLAIEIINGGGGGRRSRARVHAH
Ga0265331_105288271	3300031250	Rhizosphere	MGLEPSDVLFILIVIWIALDIINGDWGGGHRARVPAA
Ga0302326_101696461	3300031525	Palsa	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRALS
Ga0302326_106815702	3300031525	Palsa	MQLEPSDVLFIAIVIWIAIVIINGDWGGGHRSRVPARI
Ga0302326_129313772	3300031525	Palsa	ELGILDMGLEPSDVVFIAIVIWLAIEIINGGGGGRRSRLRVPA
Ga0310686_1000888851	3300031708	Soil	MVLEPSDVLFIAMVIWLAIEIINGGGGGRRSRLPAQVYS
Ga0310686_10406685412	3300031708	Soil	MGLEPSDILFIAIVLWLIIEIINGDWGGGHRSRVPAR
Ga0310686_1051346412	3300031708	Soil	MSLEPSDVIFIAIVIWLAIEIINGGGGGRRSRVPVRA
Ga0310686_1082462452	3300031708	Soil	MVLEPSDVLFIAIVIWLALEIINGGGGGRRSRLPVRAH
Ga0310686_1125183711	3300031708	Soil	MGLQPSDVLFIAIVVWLAIEIINGGGGGRRSRLPIRIH
Ga0310686_1137848782	3300031708	Soil	MALEPSDVLFLAIVIWLAIEITNGGSGGRRKRIPVPI
Ga0310686_1156741837	3300031708	Soil	MALEPSDILFIAIVIWLILEIINSDGGGGHRARVPVR
Ga0310686_1164994288	3300031708	Soil	MGLEPSDVLFIAIVIWLAIEIINGGGGGRRSRNRLPVGAH
Ga0307476_103013413	3300031715	Hardwood Forest Soil	MGLEPSDVLFIAIVLWIIMEIINGDWGGGHRARVP
Ga0307476_111396952	3300031715	Hardwood Forest Soil	MGLEPSDILFIAIVLWLILEIINSDGGGGHRARVPAR
Ga0307474_102627522	3300031718	Hardwood Forest Soil	MGLEPSDVLFIAIVIWLAIEIINSGGGGRRSRLPIRVT
Ga0307474_104274912	3300031718	Hardwood Forest Soil	MDLQPSDILFIAIVIWIAILLINGDPGGGHRSRVPAH
Ga0307474_107531262	3300031718	Hardwood Forest Soil	MGLEPNDVLFIAMVIWIAVKIIDGDSGGGRRSRQPV
Ga0311301_1000216217	3300032160	Peatlands Soil	MQLEPSDVVFIAIVIWLAIEIINGDWGGGFRSRVPVR
Ga0311301_104727632	3300032160	Peatlands Soil	MELQPSDVLFIAFVIWLAFEAIGGSGGGGRRSRVPAAL
Ga0311301_126315802	3300032160	Peatlands Soil	MELEPSDLLFIAIVIWLAIEIINGGGGGRRSRLPLRAHS
Ga0307472_1004572982	3300032205	Hardwood Forest Soil	MPLDPSDVVFLAIVIWLALEIMDGGGGGRRSRVPASS
Ga0348332_147362532	3300032515	Plant Litter	MVLEPSDVLFIAMVIWLAIEIINGGGGGRRSRLRIPAN
Ga0335085_106224932	3300032770	Soil	MGLEPSDIVFIAIVIWLILEIINGDWGGGHRARVPAR
Ga0335079_112106043	3300032783	Soil	MGLEPSDVLFIAIVLWLIFEIINGDWGGGRRARVPAF
Ga0335078_103799703	3300032805	Soil	MGLDPSDILFIAIILWLIIEIINGDWGGGHRARVPAR
Ga0335070_10000011316	3300032829	Soil	MLLEPSDVLFIAIVIWLAIEIINGGGGGRRRSRLPVQI
Ga0335081_103794912	3300032892	Soil	MGLEPSDVLFIGIVLWLIFEIINGDSGGGRRARVPVR
Ga0335074_100523446	3300032895	Soil	MGIDPTDILFIAIILWLILEIINGDWGGGHRARVPTR
Ga0335071_101808342	3300032897	Soil	MGLEPSDVLFIAIVIWLAIEIISGGGGGRRSRLPLRANS
Ga0335083_107476392	3300032954	Soil	MGLQPSDVLFIAIVLWLIFEIINGDWGGGRRARVPAF
Ga0326727_109084331	3300033405	Peat Soil	MGLQPSDVLFIAIVIWLAIEILNGGGGGRRRRLRAGAQ
Ga0334790_030022_1941_2057	3300033887	Soil	MGFEPSDVLFIAIVIWLAIEIINGGGGGRRSRLPLRAY

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F053399

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences