Basic Information | |
---|---|
Family ID | F051825 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 45 residues |
Representative Sequence | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFV |
Number of Associated Samples | 120 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.07 % |
% of genes near scaffold ends (potentially truncated) | 97.90 % |
% of genes from short scaffolds (< 2000 bps) | 88.11 % |
Associated GOLD sequencing projects | 109 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.804 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (26.573 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.853 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.944 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.35% β-sheet: 0.00% Coil/Unstructured: 48.65% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF12732 | YtxH | 69.93 |
PF01116 | F_bP_aldolase | 9.09 |
PF12706 | Lactamase_B_2 | 6.29 |
PF02146 | SIR2 | 1.40 |
PF02887 | PK_C | 1.40 |
PF00005 | ABC_tran | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 9.09 |
COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 1.40 |
COG0846 | NAD-dependent protein deacetylase, SIR2 family | Posttranslational modification, protein turnover, chaperones [O] | 1.40 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.80 % |
Unclassified | root | N/A | 4.20 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002560|JGI25383J37093_10031349 | All Organisms → cellular organisms → Bacteria | 1777 | Open in IMG/M |
3300002561|JGI25384J37096_10159743 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300002561|JGI25384J37096_10260361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 505 | Open in IMG/M |
3300002911|JGI25390J43892_10106245 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300004157|Ga0062590_101332587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 709 | Open in IMG/M |
3300005171|Ga0066677_10751023 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005172|Ga0066683_10685562 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 609 | Open in IMG/M |
3300005180|Ga0066685_10892964 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300005186|Ga0066676_10740646 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 669 | Open in IMG/M |
3300005186|Ga0066676_11126776 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 516 | Open in IMG/M |
3300005341|Ga0070691_10215264 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
3300005446|Ga0066686_10237802 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1227 | Open in IMG/M |
3300005451|Ga0066681_10203903 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1184 | Open in IMG/M |
3300005451|Ga0066681_10982492 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 504 | Open in IMG/M |
3300005554|Ga0066661_10636266 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
3300005555|Ga0066692_10054730 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2231 | Open in IMG/M |
3300005555|Ga0066692_11006335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
3300005556|Ga0066707_10070973 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2077 | Open in IMG/M |
3300005557|Ga0066704_10307414 | Not Available | 1070 | Open in IMG/M |
3300005559|Ga0066700_10012783 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 4433 | Open in IMG/M |
3300005566|Ga0066693_10056965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1320 | Open in IMG/M |
3300005576|Ga0066708_10435491 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300005586|Ga0066691_10125609 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300005842|Ga0068858_102441732 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 516 | Open in IMG/M |
3300005843|Ga0068860_102274707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 563 | Open in IMG/M |
3300005890|Ga0075285_1017794 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300006031|Ga0066651_10403601 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300006034|Ga0066656_10188187 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1309 | Open in IMG/M |
3300006034|Ga0066656_11133406 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300006796|Ga0066665_10013689 | All Organisms → cellular organisms → Bacteria | 4832 | Open in IMG/M |
3300006796|Ga0066665_10487822 | All Organisms → cellular organisms → Bacteria | 1011 | Open in IMG/M |
3300006800|Ga0066660_10224357 | All Organisms → cellular organisms → Bacteria | 1451 | Open in IMG/M |
3300006846|Ga0075430_100101734 | All Organisms → cellular organisms → Bacteria | 2399 | Open in IMG/M |
3300006854|Ga0075425_100038430 | All Organisms → cellular organisms → Bacteria | 5337 | Open in IMG/M |
3300006854|Ga0075425_100346112 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. | 1711 | Open in IMG/M |
3300006903|Ga0075426_10596406 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
3300006954|Ga0079219_10324941 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 970 | Open in IMG/M |
3300007076|Ga0075435_100020798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 5036 | Open in IMG/M |
3300009012|Ga0066710_102853422 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 680 | Open in IMG/M |
3300009092|Ga0105250_10391034 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 615 | Open in IMG/M |
3300009100|Ga0075418_11904716 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 647 | Open in IMG/M |
3300009597|Ga0105259_1181049 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 514 | Open in IMG/M |
3300010303|Ga0134082_10073843 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1329 | Open in IMG/M |
3300010303|Ga0134082_10126395 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1024 | Open in IMG/M |
3300010323|Ga0134086_10322628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 604 | Open in IMG/M |
3300010325|Ga0134064_10081176 | Not Available | 1040 | Open in IMG/M |
3300010326|Ga0134065_10357096 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 575 | Open in IMG/M |
3300010333|Ga0134080_10210379 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300010335|Ga0134063_10718435 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300010336|Ga0134071_10147483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1143 | Open in IMG/M |
3300010336|Ga0134071_10286822 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 825 | Open in IMG/M |
3300010336|Ga0134071_10624552 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300010336|Ga0134071_10778735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
3300010337|Ga0134062_10246587 | Not Available | 829 | Open in IMG/M |
3300010359|Ga0126376_13185613 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 508 | Open in IMG/M |
3300010391|Ga0136847_10890654 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 505 | Open in IMG/M |
3300010403|Ga0134123_11551498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 708 | Open in IMG/M |
3300011270|Ga0137391_10805250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 774 | Open in IMG/M |
3300011413|Ga0137333_1133220 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300011430|Ga0137423_1073518 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1015 | Open in IMG/M |
3300011443|Ga0137457_1163993 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 744 | Open in IMG/M |
3300012039|Ga0137421_1008986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2164 | Open in IMG/M |
3300012198|Ga0137364_11396539 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 518 | Open in IMG/M |
3300012200|Ga0137382_10024227 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3537 | Open in IMG/M |
3300012200|Ga0137382_10450592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 911 | Open in IMG/M |
3300012207|Ga0137381_11617908 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 539 | Open in IMG/M |
3300012211|Ga0137377_11110150 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 721 | Open in IMG/M |
3300012211|Ga0137377_11393142 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 630 | Open in IMG/M |
3300012285|Ga0137370_10290932 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 974 | Open in IMG/M |
3300012285|Ga0137370_10637081 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
3300012349|Ga0137387_10396851 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1000 | Open in IMG/M |
3300012349|Ga0137387_10487505 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 895 | Open in IMG/M |
3300012351|Ga0137386_11260644 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 514 | Open in IMG/M |
3300012359|Ga0137385_10982451 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300012361|Ga0137360_10975744 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
3300012398|Ga0134051_1295499 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300012917|Ga0137395_10842591 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 664 | Open in IMG/M |
3300012918|Ga0137396_10072432 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2410 | Open in IMG/M |
3300012918|Ga0137396_10713760 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 739 | Open in IMG/M |
3300012922|Ga0137394_10900898 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300012925|Ga0137419_10210928 | All Organisms → cellular organisms → Bacteria | 1443 | Open in IMG/M |
3300012927|Ga0137416_10935106 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 772 | Open in IMG/M |
3300012930|Ga0137407_12232070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 523 | Open in IMG/M |
3300012931|Ga0153915_13120577 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 539 | Open in IMG/M |
3300012931|Ga0153915_13476248 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 510 | Open in IMG/M |
3300012976|Ga0134076_10284896 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 712 | Open in IMG/M |
3300012986|Ga0164304_11702423 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 527 | Open in IMG/M |
3300014150|Ga0134081_10211525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 663 | Open in IMG/M |
3300014154|Ga0134075_10392533 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 612 | Open in IMG/M |
3300014157|Ga0134078_10628452 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 518 | Open in IMG/M |
3300014308|Ga0075354_1014198 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
3300014874|Ga0180084_1014559 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1402 | Open in IMG/M |
3300015241|Ga0137418_10225202 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
3300015241|Ga0137418_10225207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1606 | Open in IMG/M |
3300015241|Ga0137418_10368773 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
3300015359|Ga0134085_10205075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 849 | Open in IMG/M |
3300017654|Ga0134069_1277380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 589 | Open in IMG/M |
3300017657|Ga0134074_1177146 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 751 | Open in IMG/M |
3300018077|Ga0184633_10590507 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 525 | Open in IMG/M |
3300018082|Ga0184639_10398621 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
3300018431|Ga0066655_11180691 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
3300018433|Ga0066667_10699653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 850 | Open in IMG/M |
3300019789|Ga0137408_1404247 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300020015|Ga0193734_1067748 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
3300021073|Ga0210378_10379388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 525 | Open in IMG/M |
3300021086|Ga0179596_10344551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 748 | Open in IMG/M |
3300021178|Ga0210408_10691169 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300024330|Ga0137417_1362685 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1328 | Open in IMG/M |
3300026300|Ga0209027_1155502 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 774 | Open in IMG/M |
3300026300|Ga0209027_1287182 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 530 | Open in IMG/M |
3300026307|Ga0209469_1041064 | Not Available | 1498 | Open in IMG/M |
3300026323|Ga0209472_1265498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 547 | Open in IMG/M |
3300026324|Ga0209470_1111048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1223 | Open in IMG/M |
3300026329|Ga0209375_1034222 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
3300026334|Ga0209377_1159630 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
3300026335|Ga0209804_1280491 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 580 | Open in IMG/M |
3300026523|Ga0209808_1003456 | All Organisms → cellular organisms → Bacteria | 8098 | Open in IMG/M |
3300026523|Ga0209808_1141172 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 949 | Open in IMG/M |
3300026527|Ga0209059_1344862 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 505 | Open in IMG/M |
3300026529|Ga0209806_1001593 | All Organisms → cellular organisms → Bacteria | 14836 | Open in IMG/M |
3300026529|Ga0209806_1002893 | All Organisms → cellular organisms → Bacteria | 10512 | Open in IMG/M |
3300026530|Ga0209807_1126452 | Not Available | 1028 | Open in IMG/M |
3300026540|Ga0209376_1277393 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
3300026548|Ga0209161_10282549 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 828 | Open in IMG/M |
3300026550|Ga0209474_10022472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4852 | Open in IMG/M |
3300026552|Ga0209577_10504483 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300027273|Ga0209886_1013254 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300027616|Ga0209106_1095954 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300027765|Ga0209073_10301023 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
3300027775|Ga0209177_10284522 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300027846|Ga0209180_10797269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 506 | Open in IMG/M |
3300028072|Ga0247675_1023798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 884 | Open in IMG/M |
3300028381|Ga0268264_11872869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 610 | Open in IMG/M |
3300030620|Ga0302046_11264898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 578 | Open in IMG/M |
3300031170|Ga0307498_10492960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 500 | Open in IMG/M |
3300031226|Ga0307497_10010618 | All Organisms → cellular organisms → Bacteria | 2605 | Open in IMG/M |
3300031720|Ga0307469_11142936 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 733 | Open in IMG/M |
3300031720|Ga0307469_11831033 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 587 | Open in IMG/M |
3300031753|Ga0307477_10334431 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300031962|Ga0307479_10195063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1994 | Open in IMG/M |
3300032174|Ga0307470_10310622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1074 | Open in IMG/M |
3300032180|Ga0307471_104240729 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_65_7 | 506 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 26.57% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.58% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 13.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.29% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.20% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.20% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.50% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.80% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.10% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.40% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.40% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.40% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.70% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.70% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.70% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.70% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.70% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.70% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.70% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.70% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005890 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011413 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012398 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020015 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m1 | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI25383J37093_100313491 | 3300002560 | Grasslands Soil | VNGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDILLTAIPFV |
JGI25384J37096_101597431 | 3300002561 | Grasslands Soil | VNPEGGWHRTVTGVVRRTLEAAYEDNIPFLASAVAFDVLL |
JGI25384J37096_102603612 | 3300002561 | Grasslands Soil | VRHEGGWHRSVTGVVRRTLEAAFEDNIPFLASALSFDLLLTTLPFVILLL |
JGI25390J43892_101062453 | 3300002911 | Grasslands Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFVAVLLAAVGYLVEHQ |
Ga0062590_1013325871 | 3300004157 | Soil | VNRDGGWHDSITGIGRRTLQAAYEDNIPFLAGALSFDLLLTTIPFIVLLLAV |
Ga0066677_107510232 | 3300005171 | Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFVAVL |
Ga0066683_106855621 | 3300005172 | Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAMLLATV |
Ga0066685_108929641 | 3300005180 | Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVALLLA |
Ga0066676_107406461 | 3300005186 | Soil | VNGGGEGGWHRTVTGVVRRTLEAAYEDNVPFLASAVSFDILL |
Ga0066676_111267762 | 3300005186 | Soil | VTLEGGWHRSITGVIRRTLEAAYEDNIPFLSSALAFDFLLTAIPFVAVL |
Ga0070691_102152641 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | VNGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDIILTAIPF |
Ga0066686_102378023 | 3300005446 | Soil | VRHEGGWHRSVTGVVRRTLEAAFEDNIPFLASALSFDLLLTTLPFV |
Ga0066681_102039031 | 3300005451 | Soil | VKTQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDLLLTI |
Ga0066681_109824921 | 3300005451 | Soil | VNREGGWHRTVTGVVRRTLEAAYEDNIPFLASAVSFDILLTAIP |
Ga0066661_106362661 | 3300005554 | Soil | VNGEGGWHRTVTGVIRRTLEAAYEDNIPFLASAVSFDILLTAIPFVGLVLAV |
Ga0066692_100547301 | 3300005555 | Soil | VKAEGGWHRSLTGIVRRTLEAAYEDNIPFLASALSFDLLLTIIPFVAVLLA |
Ga0066692_110063351 | 3300005555 | Soil | VKAEGGWHQSLTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPF |
Ga0066707_100709734 | 3300005556 | Soil | VKADGGWHRSLTGIVRRTVEAAYEDNIPFLASALSFDLLLTIIPFV |
Ga0066704_103074143 | 3300005557 | Soil | VRAEAGWHRSVTGVVRRTLEAAYEDNIPFLASALS |
Ga0066700_100127836 | 3300005559 | Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFV |
Ga0066693_100569651 | 3300005566 | Soil | VKAQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSF |
Ga0066708_104354911 | 3300005576 | Soil | VKAQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDL |
Ga0066691_101256093 | 3300005586 | Soil | VNREGGWHNSILGVARRTLEAAFEDNIPFLASALSFDLLL |
Ga0068858_1024417321 | 3300005842 | Switchgrass Rhizosphere | VNGEGGWHRTVTGVIRRTLEAAYEDNIPFLAGALSFDIILTAI |
Ga0068860_1022747071 | 3300005843 | Switchgrass Rhizosphere | VNRDGGWHDSITGIGRRTLQAAYEDNIPFLAGALSFDLLLTTIPFIVLL |
Ga0075285_10177941 | 3300005890 | Rice Paddy Soil | VRAEGGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLLLTV |
Ga0066651_104036011 | 3300006031 | Soil | VNGAGGGEGGWHRTVTGVVRRTLEAAYEDNIPFLA |
Ga0066656_101881873 | 3300006034 | Soil | VKAEGGWHQSLTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFV |
Ga0066656_111334062 | 3300006034 | Soil | VNGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDILLTAIPFVG |
Ga0066665_100136891 | 3300006796 | Soil | VRAEAGWHRSVTGVVRRTLEAAYEDNIPFLASALSF |
Ga0066665_104878223 | 3300006796 | Soil | VNGEGGWHRTVTGVIRRTLEAAYEDNIPFLAGALSFDILLTAIPFVGLVL |
Ga0066660_102243573 | 3300006800 | Soil | VNGAGGGEGGWHRTVTGVVRRTLEAAYEDNIPFLAS |
Ga0079221_115391191 | 3300006804 | Agricultural Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFVAVLLAALGYLVEHQ |
Ga0075430_1001017344 | 3300006846 | Populus Rhizosphere | VNGEGGWHRTVTGIVRRTIEAAYEDNIPFLAGALSFD |
Ga0075425_1000384307 | 3300006854 | Populus Rhizosphere | VKAERGWHQSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVALLL |
Ga0075425_1003461121 | 3300006854 | Populus Rhizosphere | MKSRFVEGWHQSVWGVIKRTLELTYEDNVPFLASALSFDVILTSIPF |
Ga0075426_105964061 | 3300006903 | Populus Rhizosphere | VKAERGWHQSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVA |
Ga0079219_103249411 | 3300006954 | Agricultural Soil | VKAEGGWHQSLTGIARRTFEAAYEDNIPFLASALSFDLLLTIIPFV |
Ga0075435_1000207987 | 3300007076 | Populus Rhizosphere | VKAERGWHQSVTGIARRTFEAAFEDNIPFLASALSFDLLLTII |
Ga0066710_1028534223 | 3300009012 | Grasslands Soil | VNGEGGWHRTVTGVIRRTLEAAYEDNIPFLAGALSFDILL |
Ga0105250_103910341 | 3300009092 | Switchgrass Rhizosphere | VNGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDIIL |
Ga0075418_119047161 | 3300009100 | Populus Rhizosphere | VKREGGWHRSVTGILSRTLEAAVEDNIPFLASALS |
Ga0105259_11810491 | 3300009597 | Soil | VNGEGGWHRTATGVVRRTLEAAYEDNIPFLAGALSFDILLTAIPFVGLVL |
Ga0134082_100738433 | 3300010303 | Grasslands Soil | VKAEAGWHRSVTGVVRRTLEAAYEDNIPFLASALSF |
Ga0134082_101263951 | 3300010303 | Grasslands Soil | VKTQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFD |
Ga0134086_103226281 | 3300010323 | Grasslands Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLL |
Ga0134064_100811761 | 3300010325 | Grasslands Soil | VNGGGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDILLTAIPFVGLV |
Ga0134065_103570961 | 3300010326 | Grasslands Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAML |
Ga0134080_102103791 | 3300010333 | Grasslands Soil | VNRESGWHGSIPGIARRTIEAAFEDNIPFLASALSFDLLLTTIP |
Ga0134063_107184353 | 3300010335 | Grasslands Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTII |
Ga0134071_101474833 | 3300010336 | Grasslands Soil | VNGEGGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDIL |
Ga0134071_102868221 | 3300010336 | Grasslands Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVA |
Ga0134071_106245522 | 3300010336 | Grasslands Soil | VTRAGGWHRSVTGVVRRTAEAAFEDNIPFLASALSFDFLLTLIPFIVLLLAVVG* |
Ga0134071_107787351 | 3300010336 | Grasslands Soil | VRHEGGWHRSVTGVVRRTLEAAFEDNIPFLASALSF |
Ga0134062_102465873 | 3300010337 | Grasslands Soil | VRHAAGWHQSVRGVVRRTLEAAFEDNIPFLASALAFDLL |
Ga0126376_131856131 | 3300010359 | Tropical Forest Soil | MTRKIVEGWHQSLWGVVKRTLELAYEDRIPFLASALSFDVILTSIPFLVL |
Ga0136847_108906543 | 3300010391 | Freshwater Sediment | VNRDGGWHHSIAGVGRRTLEASYEDNIAFLASGLSFDLLLTTI |
Ga0134123_115514981 | 3300010403 | Terrestrial Soil | VRGDGGWHRSIIGVVRRTLEAAVEDNIPFLASAVSFDLLLTAIPFAVLLLGA |
Ga0137391_108052503 | 3300011270 | Vadose Zone Soil | VKAERGWHQSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVALLLAT |
Ga0137333_11332202 | 3300011413 | Soil | VTTDGGWHSSITGVGRRTLEAAYEDNLPFLAGALAFDLLLTSIPLIAVLLAVASYLVHHQITTY |
Ga0137423_10735181 | 3300011430 | Soil | VNGKGGWHRTVTGVVRRTFEAAYEDNMPFLAGAPAFDI |
Ga0137457_11639931 | 3300011443 | Soil | VNGEGGWHRTVTGVVRRTIEAAYEDNIPFLAGALSFDILLTAI |
Ga0137421_10089864 | 3300012039 | Soil | VNGEGGWHRTVTGVVRRTFEAAYEDNIPFLAGALAFDILL |
Ga0137364_113965391 | 3300012198 | Vadose Zone Soil | VNGEGGWHRTVTGIIRRTLEAAYEDNIPFLAGALSFDI |
Ga0137382_100242275 | 3300012200 | Vadose Zone Soil | VKTQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDLLLTII |
Ga0137382_104505923 | 3300012200 | Vadose Zone Soil | VNGEGGWHRTATGVARRTLEAAYEDNIPFLASAVSFDILLTAIPFV |
Ga0137381_116179081 | 3300012207 | Vadose Zone Soil | VNGEGGWHRTVTGVIRRTLEAAYEDNIPFLASAVSFDILLTTI |
Ga0137377_111101503 | 3300012211 | Vadose Zone Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFV |
Ga0137377_113931421 | 3300012211 | Vadose Zone Soil | VNREGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDILLT |
Ga0137370_102909323 | 3300012285 | Vadose Zone Soil | VKAQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDLLLTIIPFV |
Ga0137370_106370811 | 3300012285 | Vadose Zone Soil | VKAEHGWHQSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAM |
Ga0137387_103968511 | 3300012349 | Vadose Zone Soil | VNRESGWHGSITGIARRTIEAAFEDNIPFLASALSFDLLLTTI |
Ga0137387_104875051 | 3300012349 | Vadose Zone Soil | VNAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIP |
Ga0137386_112606443 | 3300012351 | Vadose Zone Soil | VNREGGWHNSIPGVVRRTLEATFEDNIPFLASALSF |
Ga0137385_109824511 | 3300012359 | Vadose Zone Soil | VKAERGWHQSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAMLL |
Ga0137360_109757441 | 3300012361 | Vadose Zone Soil | VKAERGWHQSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAMLLAT |
Ga0134051_12954992 | 3300012398 | Grasslands Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAMLLATV* |
Ga0137395_108425913 | 3300012917 | Vadose Zone Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLLL |
Ga0137396_100724321 | 3300012918 | Vadose Zone Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALS |
Ga0137396_107137601 | 3300012918 | Vadose Zone Soil | VNGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDIL |
Ga0137394_109008981 | 3300012922 | Vadose Zone Soil | VKVERGWHRSLAGIARRTFDAAFEDNIPFLASALSFDLL |
Ga0137419_102109281 | 3300012925 | Vadose Zone Soil | VNHEGGWHRSPWGIVRRTLEAAFEDNIPFLASALSFDLLLTAIPFLVL |
Ga0137416_109351063 | 3300012927 | Vadose Zone Soil | VKAEGGWHRSVIGVVRRTLEAAYEDNIPFLASALSFDLLLTVIPFVA |
Ga0137407_122320701 | 3300012930 | Vadose Zone Soil | VTLEGGWHRSITGVIRRTLEAAYEDNIPFLSSALAFDFLLTAIPFVAVLL |
Ga0153915_131205772 | 3300012931 | Freshwater Wetlands | MRAARGWHQSFWGVVKRTIEGAYEDNLPFLASALSFDVILTAIPFLV |
Ga0153915_134762481 | 3300012931 | Freshwater Wetlands | MTARGARGWHQSVWGVVKRTLEGAYEDNLPFLASALSFDVILTSIPFL |
Ga0134076_102848963 | 3300012976 | Grasslands Soil | VNPEGGWHRTVTGVVRRTLEAAYEDNIPFLASAVAFDVLLTAIPFVGLV |
Ga0164304_117024232 | 3300012986 | Soil | VKRDGGWHRSPLGVIRRTLEAAFEDNMPFLASALSFDLLLTALPFV |
Ga0134081_102115253 | 3300014150 | Grasslands Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFVAVLLAMVGYLV |
Ga0134075_103925333 | 3300014154 | Grasslands Soil | VNREGGWHRTVTGVVRRTLEAAYEDNIPFLASAVAFDILLTAIPF |
Ga0134078_106284523 | 3300014157 | Grasslands Soil | VKAQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDLLLT |
Ga0075354_10141983 | 3300014308 | Natural And Restored Wetlands | VIRDAGWHRSVGGVVRRTFDAAVEDNVPFLASALSFDLLLTIPPFALLVLGVLG |
Ga0180084_10145594 | 3300014874 | Soil | VTTDGGWHSSITGVGRRTLEAAYEDNLPFLAGALAFDLLLTSIPLIAVLLAVASYLVH |
Ga0137418_102252021 | 3300015241 | Vadose Zone Soil | VKAERGWHRSVTGIGRRTFEAAFEDNIPFLASALSFDLLLTIIPFVA |
Ga0137418_102252071 | 3300015241 | Vadose Zone Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVA |
Ga0137418_103687733 | 3300015241 | Vadose Zone Soil | VNPEGGWHRSPWGIVRRTLEAAFEDNIPFLASALSFDLLLTAIPFLVL |
Ga0134085_102050751 | 3300015359 | Grasslands Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASGLSFD |
Ga0134069_12773801 | 3300017654 | Grasslands Soil | VKADAGWHRSVAGIARRTFEAAFEDNIPFLASALSFDLLLTMIP |
Ga0134074_11771461 | 3300017657 | Grasslands Soil | VRPEGGWHRSVTGVARRTVEAAFEDNIPFLASALSFDLLLTLIPFVALLLAAV |
Ga0184633_105905073 | 3300018077 | Groundwater Sediment | VNREGGWHRTVTGVIRRTLEAAYEDNIPFLAGALSFDILLTA |
Ga0184639_103986211 | 3300018082 | Groundwater Sediment | VSANGGWHRSVPGVIRRTYEAALEDNISFLASAIAFDLLLTAIPFVVLLLGFVGYL |
Ga0066655_111806911 | 3300018431 | Grasslands Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFD |
Ga0066667_106996533 | 3300018433 | Grasslands Soil | VKADGGWHRSLTGIVRRTVEAAYEDNIPFLASALSFDLL |
Ga0137408_14042473 | 3300019789 | Vadose Zone Soil | VKAERGWHRSVTGIARRTLEAAFEDNIPFLASALSFDLLLTIIP |
Ga0193734_10677481 | 3300020015 | Soil | VTLEGGWHRSVTGVIRRTIEAAYEDNIPFLSSALAFDFLLTVIPFVAVLLATVGY |
Ga0210378_103793882 | 3300021073 | Groundwater Sediment | VTLEGGWHRSVTGVIRRTIEAAYEDNVPFLASALAFDILLTAIPFV |
Ga0179596_103445511 | 3300021086 | Vadose Zone Soil | VNGEGGWHRTVTGVVRRTIEAAYEDNIPFLAGALSFDIL |
Ga0210408_106911693 | 3300021178 | Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFV |
Ga0137417_13626853 | 3300024330 | Vadose Zone Soil | VKAEGGWHRSVIGVVRRTLEAAYEDNIPFLASALSFD |
Ga0209027_11555021 | 3300026300 | Grasslands Soil | VNGEGGWHRTVTGIIRRTLEAAYEDNIPFLAGALSFDILLTAIPFVG |
Ga0209027_12871821 | 3300026300 | Grasslands Soil | VNGEGGWHRTATGVARRTLEAAYEDNIPFLASAVSFDILLTAIPFVGLVL |
Ga0209469_10410641 | 3300026307 | Soil | VNGGGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGAL |
Ga0209472_12654983 | 3300026323 | Soil | VKAQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALS |
Ga0209470_11110481 | 3300026324 | Soil | VKAERGWHRSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAM |
Ga0209375_10342221 | 3300026329 | Soil | VKAERGWHQSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVAMLLATV |
Ga0209377_11596303 | 3300026334 | Soil | VRHAAGWHQSVRGVVRRTLEAAFEDNIPFLASALAFDLLLTAI |
Ga0209804_12804911 | 3300026335 | Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFVAVLLAMVGYLVE |
Ga0209808_100345610 | 3300026523 | Soil | VKAERGWHQSVTGVARRTFEAAFEDNIPFLASALSFDLLLTIIPFV |
Ga0209808_11411723 | 3300026523 | Soil | VKAQGGWHRSATGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFV |
Ga0209059_13448622 | 3300026527 | Soil | VNGAGGGEGGWHRTVTGVVRRTLEAAYEDNIPFLASAV |
Ga0209806_10015931 | 3300026529 | Soil | VRAEAGWHRSVTGVVRRTLEAAYEDNIPFLASALSFDLLLTVIP |
Ga0209806_10028931 | 3300026529 | Soil | VKGDGGWHRSVIGVVRRTLEAAYEDNIPFLASALSFDLLLTVIP |
Ga0209807_11264523 | 3300026530 | Soil | VRAEAGWHRSVTGVVRRTLEAAYEDNIPFLASALSFD |
Ga0209376_12773933 | 3300026540 | Soil | VKAERGWHRSVTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVALL |
Ga0209161_102825493 | 3300026548 | Soil | VKTQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDLLLTIIP |
Ga0209474_100224726 | 3300026550 | Soil | VKAQGGWHRSPTGVVRRTLEAAYEDNIPFLAGALSFDLLLTIIPFVAVL |
Ga0209577_105044833 | 3300026552 | Soil | VNGAGGGEGGWHRTVTGVVRRTLEAAYEDNIPFLASAVS |
Ga0209886_10132541 | 3300027273 | Groundwater Sand | VRVDGGWHRSVAGVVRRTFEAAVEDNIPFLASAVSFDLLLATIPFA |
Ga0209106_10959541 | 3300027616 | Forest Soil | VKVERGWHRSITGIARRTFEAAFEDNIPFLASALSFDLLL |
Ga0209073_103010233 | 3300027765 | Agricultural Soil | VKAEGGWHQSLTGIARRTFEAAYEDNIPFLASALSF |
Ga0209177_102845221 | 3300027775 | Agricultural Soil | VKAEGGWHQSLTGIARRTFEAAYEDNIPFLASALSFDLLLTIIP |
Ga0209180_107972692 | 3300027846 | Vadose Zone Soil | VNRDAGWHRTPLGVIRRTLEAAVEDNIPFLASALSFDLLLTA |
Ga0247675_10237981 | 3300028072 | Soil | MRTKLVEGWHQSAWGVIKRTLELAYEDNIPFLASALSF |
Ga0268264_118728693 | 3300028381 | Switchgrass Rhizosphere | VNRDGGWHDSITGIGRRTLQAAYEDNIPFLAGALSFDLLLTT |
Ga0302046_112648981 | 3300030620 | Soil | VNGEGGWHRTVTGVIRRTVEAAYEDNIPFLAGALSFDILLTAIPFVGLVLAVV |
Ga0307498_104929602 | 3300031170 | Soil | VISEGGWHRTVTGVVRRTLEAAYEDNVPFLASAVSFDILLTAIPFVGLVLAVVG |
Ga0307497_100106184 | 3300031226 | Soil | VNGEGGWHRTVTGVVRRTLEAAYEDNIPFLAGALSFDILLTAIP |
Ga0307469_111429361 | 3300031720 | Hardwood Forest Soil | VKPEGGWHQSLTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPFVALLLAT |
Ga0307469_118310331 | 3300031720 | Hardwood Forest Soil | VKNGIDRVNRDRGWDDSIAGIGRRTLEAAYEDNIPFLAGGLSFDLLLTTI |
Ga0307477_103344311 | 3300031753 | Hardwood Forest Soil | VKAERGWHQSVTGIARRTFEAAFEDNIPFLASALSF |
Ga0307479_101950631 | 3300031962 | Hardwood Forest Soil | VKAQGGWHRSPTGVVRRTLEAAFEDNIPFLAGALSFDLLLTIIPFVAVLLAA |
Ga0307470_103106221 | 3300032174 | Hardwood Forest Soil | VKPEGGWHQSLTGIARRTFEAAFEDNIPFLASALSFDLLLTIIPF |
Ga0307471_1042407292 | 3300032180 | Hardwood Forest Soil | VNGEGGWHRTVTGVIRRTLEAAYEDNIPFLASAVSFDILLTAIPFVGLVLAVVG |
⦗Top⦘ |