Basic Information | |
---|---|
Family ID | F051760 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 143 |
Average Sequence Length | 40 residues |
Representative Sequence | MVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Number of Associated Samples | 74 |
Number of Associated Scaffolds | 143 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 48.94 % |
% of genes near scaffold ends (potentially truncated) | 53.15 % |
% of genes from short scaffolds (< 2000 bps) | 86.01 % |
Associated GOLD sequencing projects | 61 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.31 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (53.147 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (58.042 % of family members) |
Environment Ontology (ENVO) | Unclassified (74.126 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (73.427 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 143 Family Scaffolds |
---|---|---|
PF02589 | LUD_dom | 3.50 |
PF13267 | DUF4058 | 1.40 |
PF12728 | HTH_17 | 1.40 |
PF01757 | Acyl_transf_3 | 0.70 |
PF00226 | DnaJ | 0.70 |
PF00809 | Pterin_bind | 0.70 |
PF08402 | TOBE_2 | 0.70 |
PF11848 | DUF3368 | 0.70 |
PF01613 | Flavin_Reduct | 0.70 |
PF12760 | Zn_Tnp_IS1595 | 0.70 |
PF07638 | Sigma70_ECF | 0.70 |
PF00069 | Pkinase | 0.70 |
PF05626 | DUF790 | 0.70 |
PF13340 | DUF4096 | 0.70 |
PF01797 | Y1_Tnp | 0.70 |
PF13924 | Lipocalin_5 | 0.70 |
PF13185 | GAF_2 | 0.70 |
PF13490 | zf-HC2 | 0.70 |
PF13546 | DDE_5 | 0.70 |
PF13175 | AAA_15 | 0.70 |
PF00654 | Voltage_CLC | 0.70 |
PF04389 | Peptidase_M28 | 0.70 |
PF02350 | Epimerase_2 | 0.70 |
PF10070 | DabA | 0.70 |
PF13701 | DDE_Tnp_1_4 | 0.70 |
PF13586 | DDE_Tnp_1_2 | 0.70 |
PF03099 | BPL_LplA_LipB | 0.70 |
PF00571 | CBS | 0.70 |
PF08281 | Sigma70_r4_2 | 0.70 |
PF04851 | ResIII | 0.70 |
PF07618 | DUF1580 | 0.70 |
PF00795 | CN_hydrolase | 0.70 |
PF00072 | Response_reg | 0.70 |
COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.80 |
COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 0.70 |
COG0095 | Lipoate-protein ligase A | Coenzyme transport and metabolism [H] | 0.70 |
COG0321 | Lipoate-protein ligase B | Coenzyme transport and metabolism [H] | 0.70 |
COG0340 | Biotin-protein ligase | Coenzyme transport and metabolism [H] | 0.70 |
COG0381 | UDP-N-acetylglucosamine 2-epimerase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
COG0707 | UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase | Cell wall/membrane/envelope biogenesis [M] | 0.70 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.70 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.70 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.70 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 53.15 % |
Unclassified | root | N/A | 46.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10103652 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 1229 | Open in IMG/M |
3300003219|JGI26341J46601_10022694 | All Organisms → cellular organisms → Bacteria | 2054 | Open in IMG/M |
3300004295|Ga0068932_1357322 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 950 | Open in IMG/M |
3300004477|Ga0068971_1561740 | Not Available | 778 | Open in IMG/M |
3300004971|Ga0072324_1319446 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1195 | Open in IMG/M |
3300006102|Ga0075015_100988102 | Not Available | 514 | Open in IMG/M |
3300006860|Ga0063829_1003441 | Not Available | 692 | Open in IMG/M |
3300006861|Ga0063777_1522120 | Not Available | 624 | Open in IMG/M |
3300009518|Ga0116128_1172006 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 614 | Open in IMG/M |
3300009519|Ga0116108_1132027 | Not Available | 745 | Open in IMG/M |
3300009520|Ga0116214_1022323 | All Organisms → cellular organisms → Bacteria | 2260 | Open in IMG/M |
3300009520|Ga0116214_1059389 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1390 | Open in IMG/M |
3300009520|Ga0116214_1158707 | Not Available | 844 | Open in IMG/M |
3300009520|Ga0116214_1234274 | Not Available | 695 | Open in IMG/M |
3300009521|Ga0116222_1237311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 786 | Open in IMG/M |
3300009521|Ga0116222_1556736 | Not Available | 503 | Open in IMG/M |
3300009522|Ga0116218_1419074 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 597 | Open in IMG/M |
3300009522|Ga0116218_1476200 | Not Available | 557 | Open in IMG/M |
3300009522|Ga0116218_1547989 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Tautonia | 515 | Open in IMG/M |
3300009523|Ga0116221_1082990 | All Organisms → cellular organisms → Bacteria | 1432 | Open in IMG/M |
3300009523|Ga0116221_1327075 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300009524|Ga0116225_1006845 | Not Available | 6580 | Open in IMG/M |
3300009524|Ga0116225_1010863 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 4955 | Open in IMG/M |
3300009524|Ga0116225_1136483 | Not Available | 1123 | Open in IMG/M |
3300009524|Ga0116225_1157949 | Not Available | 1033 | Open in IMG/M |
3300009524|Ga0116225_1306658 | Not Available | 708 | Open in IMG/M |
3300009524|Ga0116225_1343994 | Not Available | 664 | Open in IMG/M |
3300009525|Ga0116220_10157808 | Not Available | 975 | Open in IMG/M |
3300009525|Ga0116220_10408510 | Not Available | 608 | Open in IMG/M |
3300009525|Ga0116220_10476566 | Not Available | 564 | Open in IMG/M |
3300009641|Ga0116120_1277490 | Not Available | 523 | Open in IMG/M |
3300009672|Ga0116215_1360243 | Not Available | 630 | Open in IMG/M |
3300009700|Ga0116217_10966135 | Not Available | 522 | Open in IMG/M |
3300009824|Ga0116219_10421731 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 743 | Open in IMG/M |
3300009839|Ga0116223_10050165 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 2728 | Open in IMG/M |
3300009839|Ga0116223_10098510 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Gemmata → unclassified Gemmata → Gemmata sp. SH-PL17 | 1850 | Open in IMG/M |
3300010339|Ga0074046_10098903 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1885 | Open in IMG/M |
3300010339|Ga0074046_10414663 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 812 | Open in IMG/M |
3300010339|Ga0074046_10462654 | Not Available | 760 | Open in IMG/M |
3300010341|Ga0074045_10237703 | Not Available | 1208 | Open in IMG/M |
3300010341|Ga0074045_10292130 | Not Available | 1070 | Open in IMG/M |
3300010341|Ga0074045_10698555 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 644 | Open in IMG/M |
3300010341|Ga0074045_10807963 | Not Available | 593 | Open in IMG/M |
3300010343|Ga0074044_10359468 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 955 | Open in IMG/M |
3300010343|Ga0074044_10997334 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium SCN 63-9 | 549 | Open in IMG/M |
3300010379|Ga0136449_100306081 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
3300010379|Ga0136449_100587450 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 1903 | Open in IMG/M |
3300010379|Ga0136449_101602852 | Not Available | 988 | Open in IMG/M |
3300010379|Ga0136449_101963452 | Not Available | 866 | Open in IMG/M |
3300010379|Ga0136449_103251418 | Not Available | 626 | Open in IMG/M |
3300010379|Ga0136449_103295009 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 621 | Open in IMG/M |
3300010379|Ga0136449_103422083 | Not Available | 606 | Open in IMG/M |
3300010379|Ga0136449_104067561 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 545 | Open in IMG/M |
3300010379|Ga0136449_104609447 | Not Available | 505 | Open in IMG/M |
3300011051|Ga0138540_176157 | Not Available | 769 | Open in IMG/M |
3300011062|Ga0138582_1061404 | Not Available | 533 | Open in IMG/M |
3300011063|Ga0138537_1126998 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Stieleria → Stieleria varia | 660 | Open in IMG/M |
3300011085|Ga0138581_1092163 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 604 | Open in IMG/M |
3300011090|Ga0138579_1122708 | Not Available | 520 | Open in IMG/M |
3300011110|Ga0138578_1146303 | Not Available | 902 | Open in IMG/M |
3300014156|Ga0181518_10250717 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera soli | 899 | Open in IMG/M |
3300014156|Ga0181518_10472999 | Not Available | 596 | Open in IMG/M |
3300014158|Ga0181521_10220141 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera soli | 1023 | Open in IMG/M |
3300014158|Ga0181521_10479589 | Not Available | 599 | Open in IMG/M |
3300014159|Ga0181530_10217057 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera soli | 1043 | Open in IMG/M |
3300014159|Ga0181530_10281728 | Not Available | 878 | Open in IMG/M |
3300014159|Ga0181530_10286246 | Not Available | 869 | Open in IMG/M |
3300014164|Ga0181532_10143277 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300014638|Ga0181536_10197311 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Paludisphaera → Paludisphaera soli | 1006 | Open in IMG/M |
3300016750|Ga0181505_10458123 | Not Available | 561 | Open in IMG/M |
3300016750|Ga0181505_10936874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Thiodictyon → Candidatus Thiodictyon syntrophicum | 963 | Open in IMG/M |
3300017823|Ga0187818_10152741 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1005 | Open in IMG/M |
3300017932|Ga0187814_10259063 | Not Available | 660 | Open in IMG/M |
3300017939|Ga0187775_10017737 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 1912 | Open in IMG/M |
3300017961|Ga0187778_10555009 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 767 | Open in IMG/M |
3300017973|Ga0187780_10906350 | Not Available | 640 | Open in IMG/M |
3300017994|Ga0187822_10113475 | Not Available | 839 | Open in IMG/M |
3300017999|Ga0187767_10048194 | Not Available | 1046 | Open in IMG/M |
3300018002|Ga0187868_1041353 | Not Available | 2030 | Open in IMG/M |
3300018004|Ga0187865_1145673 | Not Available | 834 | Open in IMG/M |
3300018007|Ga0187805_10304203 | Not Available | 733 | Open in IMG/M |
3300018008|Ga0187888_1014905 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera | 4325 | Open in IMG/M |
3300018017|Ga0187872_10311045 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis | 686 | Open in IMG/M |
3300018021|Ga0187882_1210182 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 764 | Open in IMG/M |
3300018022|Ga0187864_10077535 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1779 | Open in IMG/M |
3300018037|Ga0187883_10063155 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 1950 | Open in IMG/M |
3300018037|Ga0187883_10182222 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1078 | Open in IMG/M |
3300018037|Ga0187883_10191939 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
3300018037|Ga0187883_10550806 | Not Available | 596 | Open in IMG/M |
3300018085|Ga0187772_10105363 | Not Available | 1821 | Open in IMG/M |
3300018086|Ga0187769_10597406 | Not Available | 834 | Open in IMG/M |
3300018086|Ga0187769_10728142 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 750 | Open in IMG/M |
3300021439|Ga0213879_10262456 | Not Available | 524 | Open in IMG/M |
3300025576|Ga0208820_1091097 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Fimbriiglobus → Fimbriiglobus ruber | 762 | Open in IMG/M |
3300027039|Ga0207855_1059195 | Not Available | 517 | Open in IMG/M |
3300027497|Ga0208199_1031007 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300027570|Ga0208043_1000920 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 11838 | Open in IMG/M |
3300027604|Ga0208324_1086159 | Not Available | 887 | Open in IMG/M |
3300027625|Ga0208044_1110624 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 792 | Open in IMG/M |
3300027625|Ga0208044_1127969 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 719 | Open in IMG/M |
3300027662|Ga0208565_1001626 | All Organisms → cellular organisms → Bacteria | 12914 | Open in IMG/M |
3300027662|Ga0208565_1009444 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 4014 | Open in IMG/M |
3300027662|Ga0208565_1031019 | Not Available | 1821 | Open in IMG/M |
3300027662|Ga0208565_1040792 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1531 | Open in IMG/M |
3300027662|Ga0208565_1053587 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
3300027662|Ga0208565_1144578 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 696 | Open in IMG/M |
3300027824|Ga0209040_10028971 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales | 3524 | Open in IMG/M |
3300027824|Ga0209040_10076163 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae | 1952 | Open in IMG/M |
3300027825|Ga0209039_10168982 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300027825|Ga0209039_10358120 | Not Available | 565 | Open in IMG/M |
3300027854|Ga0209517_10026846 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 5001 | Open in IMG/M |
3300027854|Ga0209517_10098377 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → unclassified Planctomycetales → Planctomycetales bacterium 71-10 | 1979 | Open in IMG/M |
3300027854|Ga0209517_10434834 | Not Available | 729 | Open in IMG/M |
3300027854|Ga0209517_10591286 | Not Available | 589 | Open in IMG/M |
3300030494|Ga0310037_10092117 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1410 | Open in IMG/M |
3300030494|Ga0310037_10286909 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 704 | Open in IMG/M |
3300030659|Ga0316363_10058833 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
3300030659|Ga0316363_10099279 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Stieleria → Stieleria varia | 1295 | Open in IMG/M |
3300030659|Ga0316363_10160506 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 958 | Open in IMG/M |
3300030659|Ga0316363_10369825 | Not Available | 561 | Open in IMG/M |
3300030706|Ga0310039_10011530 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Schlesneria → Schlesneria paludicola | 4629 | Open in IMG/M |
3300030706|Ga0310039_10024852 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Novipirellula → Novipirellula artificiosorum | 2842 | Open in IMG/M |
3300030706|Ga0310039_10070842 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1501 | Open in IMG/M |
3300030706|Ga0310039_10293289 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 617 | Open in IMG/M |
3300030707|Ga0310038_10036747 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
3300030707|Ga0310038_10154255 | Not Available | 1138 | Open in IMG/M |
3300030707|Ga0310038_10162803 | Not Available | 1097 | Open in IMG/M |
3300030707|Ga0310038_10344485 | Not Available | 660 | Open in IMG/M |
3300032160|Ga0311301_10022047 | All Organisms → cellular organisms → Bacteria | 17742 | Open in IMG/M |
3300032160|Ga0311301_10842086 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1249 | Open in IMG/M |
3300032160|Ga0311301_10848797 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1242 | Open in IMG/M |
3300032160|Ga0311301_10918099 | Not Available | 1175 | Open in IMG/M |
3300032160|Ga0311301_11377770 | Not Available | 882 | Open in IMG/M |
3300032160|Ga0311301_12039150 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Aquisphaera → unclassified Aquisphaera → Aquisphaera sp. JC669 | 667 | Open in IMG/M |
3300033402|Ga0326728_10145326 | All Organisms → cellular organisms → Bacteria | 2598 | Open in IMG/M |
3300033402|Ga0326728_10494822 | Not Available | 996 | Open in IMG/M |
3300033402|Ga0326728_10749828 | Not Available | 722 | Open in IMG/M |
3300033405|Ga0326727_10527666 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1015 | Open in IMG/M |
3300033755|Ga0371489_0102726 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 1665 | Open in IMG/M |
3300033755|Ga0371489_0364200 | Not Available | 675 | Open in IMG/M |
3300033982|Ga0371487_0371551 | Not Available | 625 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 58.04% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 8.39% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.29% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 6.29% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.90% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.90% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.50% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.80% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.80% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.70% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.70% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.70% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004295 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004971 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 41 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006861 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011051 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 21 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011062 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 72 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011063 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 15 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011085 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 71 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_101036522 | 3300000567 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
JGI26341J46601_100226941 | 3300003219 | Bog Forest Soil | MARPRKNIDPEQVRKLAGLGLTQYDIASLVGCSQSLISLGF* |
Ga0068932_13573222 | 3300004295 | Peatlands Soil | AESMVPNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0068971_15617401 | 3300004477 | Peatlands Soil | STSEMIQEDRKNIDPEQVRKLAGWGLTENDIASFVGCSQSLISLGF* |
Ga0072324_13194464 | 3300004971 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQKDMASFVGFSQSLISPRF* |
Ga0075015_1009881021 | 3300006102 | Watersheds | MIQEDRKNIDPEQVRKLAGWGLTENDIASFVGWSQSLISLGF* |
Ga0063829_10034412 | 3300006860 | Peatlands Soil | EQVRKLAGWGLTQNDIASFDGWSPLPSLWAQSLISLGF* |
Ga0063777_15221201 | 3300006861 | Peatlands Soil | PNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0116128_11720061 | 3300009518 | Peatland | SMVPNIDPEQVRMLAGWGLTQNDIVSFVGWSQSLISLGF* |
Ga0116108_11320271 | 3300009519 | Peatland | VPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0116214_10223232 | 3300009520 | Peatlands Soil | MARPRKNIDPELVRRLAGLGLTQNDIASLVGCSQSLVSLGF* |
Ga0116214_10593893 | 3300009520 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF* |
Ga0116214_11587071 | 3300009520 | Peatlands Soil | VPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISRGFS* |
Ga0116214_12342741 | 3300009520 | Peatlands Soil | MVPNIDPGQVRKLAGWGLAQNDRASFVGWSQSLISPRF* |
Ga0116222_12373111 | 3300009521 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQNDIASLVGCSQSLISLGF* |
Ga0116222_15567361 | 3300009521 | Peatlands Soil | RFFGSTDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0116218_14190742 | 3300009522 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQQDIASFVGWSQSLISLGF* |
Ga0116218_14762002 | 3300009522 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGFS* |
Ga0116218_15479891 | 3300009522 | Peatlands Soil | MGPNIEPEQVRKLAGWGLTQKELASFVGWGQSPISLGFYCFTPFW |
Ga0116221_10829901 | 3300009523 | Peatlands Soil | IDPEQVRKLAGWGLTQNDIASFVGWSQSLIRPRF* |
Ga0116221_13270752 | 3300009523 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGC* |
Ga0116225_10068452 | 3300009524 | Peatlands Soil | MVPNIDPGQVRKLAGWGLTQKDIASFVGWSQSLISVGF* |
Ga0116225_101086311 | 3300009524 | Peatlands Soil | DEAESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISRGFS* |
Ga0116225_11364832 | 3300009524 | Peatlands Soil | MDPEQVRKLAGWGLAQNDRASFGGWSQSLVSLGFSSISP* |
Ga0116225_11579491 | 3300009524 | Peatlands Soil | MARPRKNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0116225_13066581 | 3300009524 | Peatlands Soil | IDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0116225_13439942 | 3300009524 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQKDIASFVGCSQSLISLRFS |
Ga0116220_101578081 | 3300009525 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQQDIASFVGWSQSLISL |
Ga0116220_104085101 | 3300009525 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISL |
Ga0116220_104765662 | 3300009525 | Peatlands Soil | EAESMVPNIDPGQVRKLAGWGLAQNDRASFVGWSQSLISPRF* |
Ga0116120_12774901 | 3300009641 | Peatland | RDEAESMVPNIDPEQVRKLAGWGLTENDRASFVGWSQSLISLGF* |
Ga0116215_13602431 | 3300009672 | Peatlands Soil | EAEGMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGFS* |
Ga0116217_109661352 | 3300009700 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0116219_103853531 | 3300009824 | Peatlands Soil | MARPRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLVSLRFSSFD |
Ga0116219_104217313 | 3300009824 | Peatlands Soil | DQAESMVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0116223_100501651 | 3300009839 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISRGFS* |
Ga0116223_100985103 | 3300009839 | Peatlands Soil | DEAESMVPNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0074046_100989033 | 3300010339 | Bog Forest Soil | MIPNIDPEQVRKLAGWGLTQKDIASFVGWSQSLISLGF* |
Ga0074046_104146631 | 3300010339 | Bog Forest Soil | MVPNIDPEQFRKLAGWGLTQRDIASLVGWSQSLISLRF* |
Ga0074046_104626542 | 3300010339 | Bog Forest Soil | VVPNIDPEQVRKFAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0074045_102377031 | 3300010341 | Bog Forest Soil | MARPRKNVDPEQVRPPRRGLTQNDIASFVGCSQFLVSLGF* |
Ga0074045_102921302 | 3300010341 | Bog Forest Soil | MAPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLRFSSY* |
Ga0074045_106985552 | 3300010341 | Bog Forest Soil | MVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0074045_108079633 | 3300010341 | Bog Forest Soil | MVPNIDPEQFRKLAGWGLTQKDIASLVGWSQSLISLRF* |
Ga0074044_103594681 | 3300010343 | Bog Forest Soil | MVNVVAESMVPNIGPEQVRKLAGWGLTQNDRASFVGWSQSRISLGF |
Ga0074044_109973341 | 3300010343 | Bog Forest Soil | MIQEDRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSPISLGF* |
Ga0136449_1003060814 | 3300010379 | Peatlands Soil | MVPNIDPEEVRKLAGWGLTQNDRASVVGNSQSLISRGFA* |
Ga0136449_1005874502 | 3300010379 | Peatlands Soil | MVPNINPELVRKLAGWGLTQSDIASLVGCSQSLISLGF* |
Ga0136449_1016028522 | 3300010379 | Peatlands Soil | MVPSIDPEQVRKLAGLGLTQNDIASFVGCSQSLISLGF* |
Ga0136449_1019634522 | 3300010379 | Peatlands Soil | LLRDEAESMVPNIDPGQVRKLAGWGLTQKDIASFVGWSQSLISVGF* |
Ga0136449_1025510181 | 3300010379 | Peatlands Soil | MARPRKNIDPEQVRKLARLGLSQRDIAGFVGCCQRLISLRFSST |
Ga0136449_1032514181 | 3300010379 | Peatlands Soil | KVPNIDPEQVRKLAGFGLTRKDIASFVGWSQSLISLGY* |
Ga0136449_1032950091 | 3300010379 | Peatlands Soil | QAESMVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISMGF* |
Ga0136449_1034220831 | 3300010379 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLRFSS |
Ga0136449_1040675611 | 3300010379 | Peatlands Soil | QAESMVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLAF* |
Ga0136449_1046094471 | 3300010379 | Peatlands Soil | MVPSIDPEQARKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0138540_1761571 | 3300011051 | Peatlands Soil | PNIDPEQVRKLAGWGLTQNDMASFVGCGQSLISLGF* |
Ga0138582_10614042 | 3300011062 | Peatlands Soil | NIDPEQVRKLAGWGLTQNDRASFVGWSQSLLSLRF* |
Ga0138537_11269981 | 3300011063 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLIS |
Ga0138581_10921631 | 3300011085 | Peatlands Soil | QAESMVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0138579_11227081 | 3300011090 | Peatlands Soil | SMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLLSLRF* |
Ga0138578_11463031 | 3300011110 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTENDIASFVGCSQSLISLGF* |
Ga0181518_102507173 | 3300014156 | Bog | ESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF* |
Ga0181518_104729991 | 3300014156 | Bog | SMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLLSLGF* |
Ga0181521_102201411 | 3300014158 | Bog | IDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF* |
Ga0181521_104795891 | 3300014158 | Bog | RKNIDPEQVRKLAGLGLTQNDIASLVGCSQSLVSLGF* |
Ga0181530_102170573 | 3300014159 | Bog | AESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF* |
Ga0181530_102817281 | 3300014159 | Bog | SMVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF* |
Ga0181530_102862461 | 3300014159 | Bog | MVPNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF* |
Ga0181532_101432771 | 3300014164 | Bog | MARPRKNIDPELVRKLAGLGLTQNDIASLVGCSQSLISLGF* |
Ga0181536_101973111 | 3300014638 | Bog | SMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF* |
Ga0181505_104581231 | 3300016750 | Peatland | ESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF |
Ga0181505_109368742 | 3300016750 | Peatland | DEAESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISPRF |
Ga0187818_101527411 | 3300017823 | Freshwater Sediment | MVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF |
Ga0187814_102590631 | 3300017932 | Freshwater Sediment | MIQEDRKNIDPEQVRKLAGWGLTENDIASFVGWSQSLISLGF |
Ga0187775_100177371 | 3300017939 | Tropical Peatland | MARPRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0187778_105550091 | 3300017961 | Tropical Peatland | MARPRKNIDPEQVLKLAGWVLTQNYIASFVGCSQSLISLGF |
Ga0187780_109063502 | 3300017973 | Tropical Peatland | MIQEDRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLRF |
Ga0187822_101134752 | 3300017994 | Freshwater Sediment | MIQEDRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0187767_100481942 | 3300017999 | Tropical Peatland | MIQEDKKNIDPEQVRKLAGWGLTQNDRASFVGWSQSLLSLRF |
Ga0187868_10413531 | 3300018002 | Peatland | EAESMVPNIDPEQVRKLAGWGLTQKEIASFVGWSQSLISLGF |
Ga0187865_11456732 | 3300018004 | Peatland | MVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0187805_103042031 | 3300018007 | Freshwater Sediment | MVPNIDPEQVRKLTGWGLKQNDIASFVGWSQSLISLGF |
Ga0187888_10149051 | 3300018008 | Peatland | MVPNIDPEQVRKLAGRGLTQNDIASFVGWSQSLISLGF |
Ga0187872_103110452 | 3300018017 | Peatland | MARPRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSL |
Ga0187882_12101821 | 3300018021 | Peatland | AESMVPNTDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGY |
Ga0187864_100775353 | 3300018022 | Peatland | MARPRKNIDPEQVRKLAGLGLTQKDIASFVGCSQSLISLRF |
Ga0187883_100631553 | 3300018037 | Peatland | MVPNIDPAQVRKLAGWGLTQNDRASFVGWSQSLISLGS |
Ga0187883_101822222 | 3300018037 | Peatland | MVPNIDPEQVRKLAGWGLTQNDRASFVGWSPQLRLWAQSLISLGFSSSYDLGVRQ |
Ga0187883_101919391 | 3300018037 | Peatland | MARPRKNIDPEQVRKLAGLGLTQKDIASFVGCSQSLISL |
Ga0187883_105508061 | 3300018037 | Peatland | KNIDPELVRKLAGLGLTQNDIASLVGCSQSLVSPGF |
Ga0187772_101053631 | 3300018085 | Tropical Peatland | GRPRKKVNPEEVRKLAKLGLTQKDIAIYVGCGQATISRRF |
Ga0187769_105974061 | 3300018086 | Tropical Peatland | MARPRKNIEPELVRKLAGLGLTQNDIASLVGCSQSLIRLGF |
Ga0187769_107281422 | 3300018086 | Tropical Peatland | MVPNIDPEQVRKLAGWALTQNDIASFVGCSQSLVSLGF |
Ga0213879_102624561 | 3300021439 | Bulk Soil | MGRPRKKINPEEVRKLAKLGLTQKDIAIYVGCGQATI |
Ga0208820_10910974 | 3300025576 | Peatland | NIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0207855_10591951 | 3300027039 | Tropical Forest Soil | QEDRKNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0208199_10310072 | 3300027497 | Peatlands Soil | MARPRKNIDPELVRRLAGLGLTQNDIASLVGCSQSLVSLGF |
Ga0208043_10009208 | 3300027570 | Peatlands Soil | MVPNIDPGQVRKLAGWGLTQKDIASFVGWSQSLISVGF |
Ga0208324_10861591 | 3300027604 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQNDIASLVGCSQSLISLGF |
Ga0208044_11106242 | 3300027625 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF |
Ga0208044_11279691 | 3300027625 | Peatlands Soil | MVPNIDPEQVRMLAGWGLTQNDIVSFVGWSQSLISLG |
Ga0208565_100162617 | 3300027662 | Peatlands Soil | VPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISRGFS |
Ga0208565_10094441 | 3300027662 | Peatlands Soil | EAESMVPNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF |
Ga0208565_10310192 | 3300027662 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQQDIASFVGWSQSLISLGF |
Ga0208565_10407922 | 3300027662 | Peatlands Soil | MDPEQVRKLAGWGLAQNDRASFGGWSQSLVSLGFSSISP |
Ga0208565_10535872 | 3300027662 | Peatlands Soil | MVPNIDPGQVRKLAGWGLAQNDRASFVGWSQSLISPRF |
Ga0208565_11445783 | 3300027662 | Peatlands Soil | ESMVPSIDPERVRKLAGWGLTQNDIASFVGCSQSLISLGF |
Ga0209040_100289714 | 3300027824 | Bog Forest Soil | MARPRKNIDPEQVRKLAGLGLTQYDIASLVGCSQSLISLGF |
Ga0209040_100761631 | 3300027824 | Bog Forest Soil | EAESMVPNIDPEQVRKLAGWGLTQNDRASFVGCSQSLISLGF |
Ga0209039_101689821 | 3300027825 | Bog Forest Soil | MVSNIDPEQVRKLAGWGLTQNDIASYVGWSQSLISLGF |
Ga0209039_103581201 | 3300027825 | Bog Forest Soil | MVPGIDPEQVRKLAGWGLTQNDIASFVGCSQSLISP |
Ga0209517_100268461 | 3300027854 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF |
Ga0209517_100983771 | 3300027854 | Peatlands Soil | LRDEAESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISRGFS |
Ga0209517_104348342 | 3300027854 | Peatlands Soil | MGRPRKNIDPEQVRKLAGLGLTQKDIASFVGCSQS |
Ga0209517_105912862 | 3300027854 | Peatlands Soil | EAESMVPNGDPEQVRKIAGGGLTQNDRASFVGWSQSLISRGF |
Ga0310037_100921171 | 3300030494 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQKDIASFVGCSQSLI |
Ga0310037_102869091 | 3300030494 | Peatlands Soil | EEAESMVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0316363_100588331 | 3300030659 | Peatlands Soil | PNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF |
Ga0316363_100992791 | 3300030659 | Peatlands Soil | MVPNIDPQQVRKLAGWGLTQNDIASFVGWSQSPISLGF |
Ga0316363_101605061 | 3300030659 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISL |
Ga0316363_103698251 | 3300030659 | Peatlands Soil | MVSNIDPEQVRKLAGWGLTQKDIASFVGCSQSLIS |
Ga0310039_100115302 | 3300030706 | Peatlands Soil | MVPNIDPEQARKLAGWGLTQNDKASFVGCSQSLISLGF |
Ga0310039_100248526 | 3300030706 | Peatlands Soil | EAESMVPNIDPEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0310039_100708423 | 3300030706 | Peatlands Soil | MIQEDRKNIDPEQVRKLAGWGLTENDRASFVGWSQSLISLGF |
Ga0310039_102932891 | 3300030706 | Peatlands Soil | ESTVPNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF |
Ga0310038_100367474 | 3300030707 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLGF |
Ga0310038_101542551 | 3300030707 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLRF |
Ga0310038_101628032 | 3300030707 | Peatlands Soil | MARPRKNIDPEQVRKLAGWGLTQNDRASFVGCSQSLISLGF |
Ga0310038_103444851 | 3300030707 | Peatlands Soil | MARPRKNIDPEQVRKLAGLGLTQRDIASFVGCSQSLISQRFS |
Ga0311301_1002204719 | 3300032160 | Peatlands Soil | QAESMVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISPRF |
Ga0311301_108420862 | 3300032160 | Peatlands Soil | EAESMVPNIDPEQVRKLAGWGLTQNDRASFVGWSQSLISLGF |
Ga0311301_108487972 | 3300032160 | Peatlands Soil | MVPNIDPEQVRKLAGWGLTQNDIASFVGCIQSLISLGF |
Ga0311301_109180993 | 3300032160 | Peatlands Soil | MARPRKNIDPELVRKLAGLGLTQNDIASLVGCSQSLISLGF |
Ga0311301_113777701 | 3300032160 | Peatlands Soil | MVPNIDPEEVRKLAGWGLTQNDRASVVGNSQSLISRGFA |
Ga0311301_120391501 | 3300032160 | Peatlands Soil | DQAESMVPSIDPEQVRKLAGWGLTQNDIASFVGCSQSLISLAF |
Ga0326728_101453264 | 3300033402 | Peat Soil | MVPNIDPEQVRKLAGWGLTQNDIACIVGWSQSLISLGF |
Ga0326728_104948221 | 3300033402 | Peat Soil | MARPRKNIDPELVRKLAGLGLMQRDIASFVGCSQSLVSLGF |
Ga0326728_107498282 | 3300033402 | Peat Soil | MVAHIDAEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
Ga0326727_105276661 | 3300033405 | Peat Soil | MVPNIDPEQVRKLADWGLTQNDRASLVGWSQSLISLG |
Ga0371489_0102726_1374_1490 | 3300033755 | Peat Soil | MVPNIDPEQVRKLAGWGLTQNDRANFVGWSQSLISLGF |
Ga0371489_0364200_3_116 | 3300033755 | Peat Soil | MGRPRKKINPEEVRKLAKLGLTQKDIAIYVGCGQATIS |
Ga0371487_0371551_500_616 | 3300033982 | Peat Soil | MVPNIDAEQVRKLAGWGLTQNDIASFVGWSQSLISLGF |
⦗Top⦘ |