NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F051514

Metagenome / Metatranscriptome Family F051514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F051514
Family Type Metagenome / Metatranscriptome
Number of Sequences 144
Average Sequence Length 41 residues
Representative Sequence MVHVRDAKSGDIEVFSGTSQTRLRDKDLAARIARAIG
Number of Associated Samples 122
Number of Associated Scaffolds 144

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 5.59 %
% of genes near scaffold ends (potentially truncated) 89.58 %
% of genes from short scaffolds (< 2000 bps) 90.28 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (59.722 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(47.222 % of family members)
Environment Ontology (ENVO) Unclassified
(34.722 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.444 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 16.92%    β-sheet: 26.15%    Coil/Unstructured: 56.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 144 Family Scaffolds
PF14224DUF4331 91.67
PF10099RskA 2.08
PF00881Nitroreductase 0.69
PF01381HTH_3 0.69
PF01274Malate_synthase 0.69
PF01229Glyco_hydro_39 0.69
PF12802MarR_2 0.69
PF00708Acylphosphatase 0.69
PF04264YceI 0.69
PF01810LysE 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 144 Family Scaffolds
COG2225Malate synthaseEnergy production and conversion [C] 0.69
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 0.69
COG3664Beta-xylosidaseCarbohydrate transport and metabolism [G] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A59.72 %
All OrganismsrootAll Organisms40.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001686|C688J18823_10884586Not Available567Open in IMG/M
3300004091|Ga0062387_101216400All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300004121|Ga0058882_1740564All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300005542|Ga0070732_10074517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1981Open in IMG/M
3300005610|Ga0070763_10526746All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005616|Ga0068852_100158100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2113Open in IMG/M
3300006028|Ga0070717_11334944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300006163|Ga0070715_10191991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1032Open in IMG/M
3300007076|Ga0075435_100930171All Organisms → cellular organisms → Bacteria758Open in IMG/M
3300009090|Ga0099827_10207334All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300009101|Ga0105247_10106343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1800Open in IMG/M
3300009522|Ga0116218_1112195Not Available1241Open in IMG/M
3300009525|Ga0116220_10343981Not Available661Open in IMG/M
3300009628|Ga0116125_1172156Not Available607Open in IMG/M
3300009628|Ga0116125_1209199Not Available557Open in IMG/M
3300010361|Ga0126378_12808103Not Available556Open in IMG/M
3300010364|Ga0134066_10166928All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300010379|Ga0136449_100310647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2865Open in IMG/M
3300010379|Ga0136449_102352179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia770Open in IMG/M
3300010379|Ga0136449_102776425Not Available692Open in IMG/M
3300010880|Ga0126350_10230949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1093Open in IMG/M
3300011120|Ga0150983_16704192Not Available515Open in IMG/M
3300011270|Ga0137391_10004640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria10504Open in IMG/M
3300013764|Ga0120111_1027057Not Available1560Open in IMG/M
3300014169|Ga0181531_10041507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2675Open in IMG/M
3300014493|Ga0182016_10588981Not Available634Open in IMG/M
3300014655|Ga0181516_10428268Not Available677Open in IMG/M
3300017654|Ga0134069_1121407Not Available861Open in IMG/M
3300017822|Ga0187802_10423137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300017924|Ga0187820_1144303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria713Open in IMG/M
3300017973|Ga0187780_10017960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5114Open in IMG/M
3300017975|Ga0187782_11149723All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300018035|Ga0187875_10274497Not Available916Open in IMG/M
3300018043|Ga0187887_10723544All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300018047|Ga0187859_10343925Not Available812Open in IMG/M
3300020580|Ga0210403_11290971Not Available558Open in IMG/M
3300020583|Ga0210401_11082240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria660Open in IMG/M
3300021180|Ga0210396_10420978Not Available1173Open in IMG/M
3300021181|Ga0210388_11131195Not Available667Open in IMG/M
3300021362|Ga0213882_10225063Not Available776Open in IMG/M
3300021401|Ga0210393_11016867All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300021402|Ga0210385_10380833Not Available1057Open in IMG/M
3300021402|Ga0210385_10664184Not Available797Open in IMG/M
3300021402|Ga0210385_11193164Not Available584Open in IMG/M
3300021402|Ga0210385_11282957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300021403|Ga0210397_10970310Not Available659Open in IMG/M
3300021407|Ga0210383_11129061Not Available661Open in IMG/M
3300021475|Ga0210392_10618646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria804Open in IMG/M
3300021478|Ga0210402_11808517Not Available537Open in IMG/M
3300021478|Ga0210402_11837878Not Available532Open in IMG/M
3300022523|Ga0242663_1109828Not Available558Open in IMG/M
3300022528|Ga0242669_1080357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria604Open in IMG/M
3300022557|Ga0212123_10005229All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia23321Open in IMG/M
3300022709|Ga0222756_1038967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300022734|Ga0224571_106254Not Available792Open in IMG/M
3300024176|Ga0224565_1038337Not Available551Open in IMG/M
3300024227|Ga0228598_1042412Not Available899Open in IMG/M
3300024271|Ga0224564_1052390Not Available797Open in IMG/M
3300025633|Ga0208480_1125255Not Available595Open in IMG/M
3300025924|Ga0207694_10120408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2095Open in IMG/M
3300027371|Ga0209418_1009010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1530Open in IMG/M
3300027648|Ga0209420_1103517Not Available807Open in IMG/M
3300027692|Ga0209530_1164474Not Available619Open in IMG/M
3300027768|Ga0209772_10046651Not Available1285Open in IMG/M
3300027853|Ga0209274_10027406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2622Open in IMG/M
3300027855|Ga0209693_10232053Not Available906Open in IMG/M
3300027857|Ga0209166_10464622Not Available653Open in IMG/M
3300027884|Ga0209275_10354613All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300027889|Ga0209380_10261708Not Available1016Open in IMG/M
3300027894|Ga0209068_10809907Not Available552Open in IMG/M
3300027908|Ga0209006_10266236Not Available1471Open in IMG/M
3300027908|Ga0209006_11438322Not Available525Open in IMG/M
3300028801|Ga0302226_10503071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300029910|Ga0311369_10425769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1146Open in IMG/M
3300029951|Ga0311371_10034070All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9044Open in IMG/M
3300030399|Ga0311353_11041742Not Available683Open in IMG/M
3300030520|Ga0311372_10434026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1969Open in IMG/M
3300030617|Ga0311356_10313872Not Available1568Open in IMG/M
3300030617|Ga0311356_10909404Not Available828Open in IMG/M
3300030740|Ga0265460_10020047Not Available1870Open in IMG/M
3300030740|Ga0265460_12950691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae511Open in IMG/M
3300030743|Ga0265461_10549769All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300030743|Ga0265461_12118064Not Available647Open in IMG/M
3300030743|Ga0265461_13616424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300031236|Ga0302324_100558614Not Available1654Open in IMG/M
3300031543|Ga0318516_10174288Not Available1238Open in IMG/M
3300031543|Ga0318516_10561018Not Available653Open in IMG/M
3300031544|Ga0318534_10298262Not Available928Open in IMG/M
3300031544|Ga0318534_10845756Not Available513Open in IMG/M
3300031564|Ga0318573_10626927Not Available578Open in IMG/M
3300031572|Ga0318515_10251749All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300031572|Ga0318515_10450328Not Available688Open in IMG/M
3300031640|Ga0318555_10765032Not Available521Open in IMG/M
3300031668|Ga0318542_10032292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2265Open in IMG/M
3300031668|Ga0318542_10323370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria791Open in IMG/M
3300031680|Ga0318574_10378535Not Available826Open in IMG/M
3300031680|Ga0318574_10551812Not Available675Open in IMG/M
3300031682|Ga0318560_10537189Not Available633Open in IMG/M
3300031713|Ga0318496_10443856Not Available717Open in IMG/M
3300031724|Ga0318500_10065736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1580Open in IMG/M
3300031744|Ga0306918_10927793Not Available678Open in IMG/M
3300031747|Ga0318502_10119961Not Available1476Open in IMG/M
3300031747|Ga0318502_10277733Not Available982Open in IMG/M
3300031748|Ga0318492_10421446Not Available703Open in IMG/M
3300031751|Ga0318494_10257292Not Available1002Open in IMG/M
3300031768|Ga0318509_10294552Not Available908Open in IMG/M
3300031770|Ga0318521_10238969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1058Open in IMG/M
3300031797|Ga0318550_10049259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1888Open in IMG/M
3300031799|Ga0318565_10209066Not Available949Open in IMG/M
3300031831|Ga0318564_10023938All Organisms → cellular organisms → Bacteria → Terrabacteria group2558Open in IMG/M
3300031831|Ga0318564_10042401All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1968Open in IMG/M
3300031845|Ga0318511_10386139Not Available640Open in IMG/M
3300031846|Ga0318512_10121881Not Available1241Open in IMG/M
3300031859|Ga0318527_10169209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria920Open in IMG/M
3300031860|Ga0318495_10539455Not Available507Open in IMG/M
3300031869|Ga0316030_109652Not Available553Open in IMG/M
3300031870|Ga0316029_108900Not Available551Open in IMG/M
3300031880|Ga0318544_10166395Not Available848Open in IMG/M
3300031893|Ga0318536_10525192Not Available594Open in IMG/M
3300031894|Ga0318522_10177643Not Available805Open in IMG/M
3300031897|Ga0318520_10161705Not Available1304Open in IMG/M
3300031897|Ga0318520_10576609Not Available698Open in IMG/M
3300031910|Ga0306923_12037118Not Available581Open in IMG/M
3300031912|Ga0306921_11860056Not Available645Open in IMG/M
3300032008|Ga0318562_10764172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300032035|Ga0310911_10661346Not Available606Open in IMG/M
3300032043|Ga0318556_10132561Not Available1279Open in IMG/M
3300032054|Ga0318570_10522979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria541Open in IMG/M
3300032060|Ga0318505_10289612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300032063|Ga0318504_10614627All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300032065|Ga0318513_10562336Not Available558Open in IMG/M
3300032089|Ga0318525_10246532Not Available918Open in IMG/M
3300032160|Ga0311301_10231574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3089Open in IMG/M
3300032180|Ga0307471_101874524All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300032261|Ga0306920_101005095Not Available1214Open in IMG/M
3300032770|Ga0335085_12552395Not Available506Open in IMG/M
3300032805|Ga0335078_11455930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora769Open in IMG/M
3300032893|Ga0335069_10142877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2973Open in IMG/M
3300033158|Ga0335077_11450928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia659Open in IMG/M
3300033289|Ga0310914_10345940Not Available1344Open in IMG/M
3300033289|Ga0310914_10352756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1330Open in IMG/M
3300033289|Ga0310914_10809310Not Available835Open in IMG/M
3300034124|Ga0370483_0068940Not Available1137Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil47.22%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.56%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.86%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.08%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.39%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.39%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.39%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.39%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.39%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.39%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.39%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.39%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.39%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.39%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.69%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.69%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.69%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.69%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.69%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.69%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.69%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.69%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004121Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF109 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010880Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014493Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021362Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300022523Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022528Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022709Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022734Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU3Host-AssociatedOpen in IMG/M
3300024176Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300024271Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027371Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027692Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030740Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031869Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI2 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031870Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLI1 metaT (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J18823_1088458623300001686SoilAQSQDHHEHAGPIMVHVRDARTGDIEVFSGTSQTQLRDKDLAARIARALA*
Ga0062387_10121640023300004091Bog Forest SoilHVHGEAKTPAGPIMVQVRDAKSGDIEVLSGTSQTRVRDKDLAARIARAIG*
Ga0058882_174056423300004121Forest SoilEPIVVHVRNARTGDIEVFSGTSQTRLRDKDLAARIARAIG*
Ga0070732_1007451713300005542Surface SoilHVRDARSGDIEVFSGTSQIRLRDKDLAARISRAFG*
Ga0070763_1052674623300005610SoilVVHVRNAKSGDIEVFSGTSQTSLRDRDLAARIVRAIG*
Ga0068852_10015810043300005616Corn RhizosphereVVHVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG*
Ga0070717_1133494423300006028Corn, Switchgrass And Miscanthus RhizosphereHVRDARSGDIEVFAGTSQTRLRDQDLAARIARAIG*
Ga0070715_1019199113300006163Corn, Switchgrass And Miscanthus RhizosphereHVRDARSGDIEVFAGTSQTRVRDKDLAARIARAIG*
Ga0075435_10093017123300007076Populus RhizosphereIVVHVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG*
Ga0099827_1020733423300009090Vadose Zone SoilMPAGPIMVHVRDAKAGDIEVFSGTSQTRLRDKDLAARIARAIG*
Ga0105247_1010634313300009101Switchgrass RhizosphereVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG*
Ga0116218_111219523300009522Peatlands SoilMVHVRDARSGDIEVFSGTSQTRLRDADLAARIARAIG*
Ga0116220_1034398113300009525Peatlands SoilIVVHVRDARSGDIEELSGTRETSLRDKDLAARIVREIG*
Ga0116125_117215613300009628PeatlandGHSEPKAVDGPIMVHVRDAKSGDIEVFSGTSKTRLNDKHLAALITRAIG*
Ga0116125_120919913300009628PeatlandAPQVAGSIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG*
Ga0126378_1280810323300010361Tropical Forest SoilHVRDARSGDIEVFSGTSQTRLRDAGLAARIARAIG*
Ga0134066_1016692813300010364Grasslands SoilDTAAGPIMVHVRDTRSGDIEVFAGTGQTRLRDKDLAARIARAIG*
Ga0136449_10031064713300010379Peatlands SoilEDQLPSGAIVLNVRDVKSGDIEVFYGTSQVQLQDKELTARIARAIG*
Ga0136449_10235217913300010379Peatlands SoilVHDHGEASSPAGPIMVHVRDVRSGDIEVFSGTSQTRLRDADLAARLARAIG*
Ga0136449_10277642523300010379Peatlands SoilMVHVRDAKSGDIEVFSGTSQTRLRDKDLAARIARAIG*
Ga0126350_1023094913300010880Boreal Forest SoilGPVVVHVRDAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG*
Ga0150983_1670419213300011120Forest SoilAPAHGDLKAPSGPIVVHVRNAKSGDIEVFSGTSQTRLRDKDLAARIVRAIA*
Ga0137391_1000464093300011270Vadose Zone SoilMPAGPIMVHVRDAKAGDIEVFSGISQTRLRDKDLAARIARAIG*
Ga0120111_102705723300013764PermafrostAPGDLVVHVRDAGSGEMDVFTGTSQIRLRDKDLAARLIRAIG*
Ga0181531_1004150723300014169BogVVHVRNAKSGDIEVFSGTSQTRLQDKDLAARIARAIG*
Ga0182016_1058898113300014493BogMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG*
Ga0181516_1042826813300014655BogAPAPAPDVAGSIMVHVRDARSGDIEVFSGTSKTRLHDKDLAARIARAIG*
Ga0134069_112140713300017654Grasslands SoilHVRDARSGDIEVFAGTSQTRLRDQDLAARIARAIG
Ga0187802_1042313713300017822Freshwater SedimentGHGDAKTPAGPIMVHVRDAGSGDIEVFSGTSQTRLRDADLAARLARAIG
Ga0187820_114430313300017924Freshwater SedimentPIVVHVRDAKSGDIEVFAGTSQTRLRDTDLAARIARVVG
Ga0187780_1001796043300017973Tropical PeatlandVVHVRNAKSGDIEVFSGTSQNRLRDKDLANRIARAIG
Ga0187782_1114972313300017975Tropical PeatlandIVVHVRDARSGDIEVLSGTSQTRLRDKVLAARIARAIG
Ga0187875_1027449723300018035PeatlandGAIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARVIS
Ga0187887_1072354413300018043PeatlandIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0187859_1034392523300018047PeatlandGSAAEGSAAAPAGAIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARVIS
Ga0210403_1129097123300020580SoilQSPGQPHRGAPAEPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0210401_1108224013300020583SoilAGPVVVHVRDAKSGDSEVFSGTSQTSVRDKDLAARIVRAIG
Ga0210396_1042097823300021180SoilMVHVRDAGSGDIEVFSGTSQTRVRDKDLAARIARAVG
Ga0210388_1113119513300021181SoilDQPKLPSGPIVLNVRDAKSGDIEVFYGTSQVQLQDKELTARIARAIG
Ga0213882_1022506323300021362Exposed RockVHVRDARSGDIEVFSGISATRLRDKDLAARIARAIG
Ga0210393_1101686723300021401SoilPQVAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0210385_1038083313300021402SoilHGHGAAKTPAGPIMVHVRDAGSGDIEVFSGTSQTRVRDKDLAARIARAVG
Ga0210385_1066418423300021402SoilVVHVRNARTGDIEVFSGASQTRLRDKDLAARIARAAR
Ga0210385_1119316423300021402SoilPIVVHVRDAKSGDIEVLSGTSETRLRDKDLAARIVRAIG
Ga0210385_1128295723300021402SoilLKAPAGPVVVHVRDAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG
Ga0210397_1097031023300021403SoilVVHVRNAKSGDIEVFSGTSQTRLRDKDLAARIARAIG
Ga0210383_1112906123300021407SoilMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0210392_1061864623300021475SoilQPHGEAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0210402_1180851723300021478SoilVHVRDARSGDIEVFHGTSQSRLRDTDLAARIARAVG
Ga0210402_1183787823300021478SoilHVRDARSGDIEVFAGTSQTRVRDKDLAARITRAIG
Ga0242663_110982823300022523SoilPIVVHVRNAKSGDIEVFSGTSQTSLRDKDLAARIARAIG
Ga0242669_108035713300022528SoilDQPHGHDTAGGPIMVHVRDARTGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0212123_10005229243300022557Iron-Sulfur Acid SpringVVHVRDARSGDIEVFAGTRQTRLRDQDLAARIARATR
Ga0222756_103896713300022709SoilGPVVVHVRDAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG
Ga0224571_10625413300022734RhizosphereAKTPAGPIMVHVRDAGSGDIEVFSGTSQTRVRDRDLAARIARAVG
Ga0224565_103833723300024176Plant LitterDARTGDIEVFSGTSQTRLRDRDLAARIARASQQGR
Ga0228598_104241213300024227RhizosphereAGGEVKAPAGPIVVHVRNAKSGDIEVFSGTGQTRLRDTDLAARIARAIG
Ga0224564_105239023300024271SoilKTPAGPIMVHVRDAGSGDIEVFSGTSQTRVRDKDLAARIARAVG
Ga0208480_112525513300025633Arctic Peat SoilSEAAGPITVHVRDAKTGDIEIFEGTRETRLRDKDLAARIARAIA
Ga0207694_1012040813300025924Corn RhizosphereVVHVRDARSGDIEVFAGTSQSRLRDKDLAARIARAIG
Ga0209418_100901013300027371Forest SoilPPAPDRSSGRTPAGPIMVHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG
Ga0209420_110351723300027648Forest SoilVHVRDAKSGDIEVLSGTSKTRLRDKDLAARIARAIG
Ga0209530_116447423300027692Forest SoilAGSIMVHVRDAKSGDIEVLSGTSKTRLRDKDLAARIARAIG
Ga0209772_1004665113300027768Bog Forest SoilVVVHVRNAKSGDIEVFSGTSQTSLRDKDLAARIVRAIG
Ga0209274_1002740613300027853SoilATPPLEPIVVHVRDAKSGDIEVFHGTSQTRLRDQDLAARIARAIA
Ga0209693_1023205323300027855SoilAPSGPVVVHVRNTTSGDIEVFSGTSQTSLRDKDLAARIVRAIR
Ga0209166_1046462223300027857Surface SoilADGPIVVHVRNAKSGDIEVFSGTGQTRVRDADLAARIVRAIA
Ga0209275_1035461323300027884SoilVVHVRDAKSGDIEVFSGTSQIRLRDRDLAARISRAFG
Ga0209380_1026170813300027889SoilGGDVKAPAGPVVVHVRNAKSGDIEVFSGTSQTRLRDKDLAARIVRAIA
Ga0209068_1080990713300027894WatershedsIMVHVRDARSGDIEVFSGTSQTRVRDKDLAARIARAVG
Ga0209006_1026623613300027908Forest SoilITVHVRDARTGDIEVFSGTSQTRLRDKDLAARIARAIA
Ga0209006_1143832213300027908Forest SoilHVRDARSGDIEVFSGTSQTRLRDKDLAARIARAIG
Ga0302226_1050307113300028801PalsaDGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0311369_1042576923300029910PalsaPPRHGAPQFAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0311371_1003407013300029951PalsaQFAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0311353_1104174213300030399PalsaHVRDAKTGDIEVFSGTSQTRLRDKDLAARIARAIA
Ga0311372_1043402633300030520PalsaAGPITVHVRDAKTGDIEVFAGTSQTRLRDKDLAARIARAIA
Ga0311356_1031387213300030617PalsaHVRDAKTGDIEVFAGTSQTRLRDKDLAARIARAIA
Ga0311356_1090940413300030617PalsaKPATAAGPLVVHVRDAKTGDIEVFHGTSATRLRDKDLAARIAAAIR
Ga0265460_1002004723300030740SoilVVHVRNAKSGDIEGFSGTSQTSLRDKDLAARIARAIG
Ga0265460_1295069123300030740SoilRHSAPQVAGPIMVHVRDAKSGDIEVFSGTSKTRLRDKDLAARIARAIG
Ga0265461_1054976913300030743SoilHSEPIVVHVRNARSGDIEVFSGTSQTRLRDKDLAARIARAAR
Ga0265461_1211806423300030743SoilFSPIVVHVRDARSGDIEVLSGTRGTRLRDKDLAARIARAIG
Ga0265461_1361642413300030743SoilPKDTAGPVVVHVRDAKSGDIEVFSGTSQTRLRDKDLAARIVRAIG
Ga0302324_10055861413300031236PalsaEVAGPITVHVRDAKTGDIEVFAGTSQTRLRDKDLAARIARAIA
Ga0318516_1017428823300031543SoilVHVRDARSGDIEVFAGTSQTRLRDQDLAARIARSIG
Ga0318516_1056101823300031543SoilIMVHVRDARSGDIELFSGTSQTRLRDKDLAARIARAIG
Ga0318534_1029826213300031544SoilIIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0318534_1084575633300031544SoilAAGREVKAPAGPIVLHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG
Ga0318573_1062692723300031564SoilMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318515_1025174923300031572SoilVVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG
Ga0318515_1045032823300031572SoilVHVRDARTGDIEVFSGTSQSRVRDQDLAARIARAIS
Ga0318555_1076503223300031640SoilVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG
Ga0318542_1003229213300031668SoilIVHVRDARSGDIEVFAGTSQTRLRDQDLAARIARSIG
Ga0318542_1032337013300031668SoilPPSQSPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318574_1037853523300031680SoilIVVHVRNAKSGDIEVFSGTDQTRLRDTDLAARIARAIG
Ga0318574_1055181223300031680SoilMVHVRDARSGDIEVFAGTSQARLRDQDLAARIARAIG
Ga0318560_1053718923300031682SoilISVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0318496_1044385613300031713SoilIVVHVRNATSGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0318500_1006573613300031724SoilSPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0306918_1092779323300031744SoilIVVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG
Ga0318502_1011996113300031747SoilVKAPSGPIIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0318502_1027773313300031747SoilSGPIVVHVRNAKSGEIDVFSGTSQTRLRDKDLAARIARTVR
Ga0318492_1042144613300031748SoilIMVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0318494_1025729223300031751SoilVHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG
Ga0318509_1029455213300031768SoilPIVVHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG
Ga0318521_1023896913300031770SoilPIVVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0318550_1004925913300031797SoilVHVRDARSGDIEVFAGTSQTRLRDQDLAARIARALG
Ga0318565_1020906623300031799SoilMVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0318564_1002393843300031831SoilVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0318564_1004240113300031831SoilPIVVHVRDAESGDIEVFSGTSQTRLRDTDLAARITRAIG
Ga0318511_1038613913300031845SoilVVHVRNAKSGEIDVFSGTSQTRLRDKDLAARIARTVR
Ga0318512_1012188113300031846SoilVVHVRNAKSGDIEVFSGTDQTRLRDTDLAARIARAIG
Ga0318527_1016920913300031859SoilGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318495_1053945513300031860SoilPIVVHVRNATSGDIEVFSGTSQTRLRDAGLAALIARAIG
Ga0316030_10965213300031869SoilHVRDLKTGDIEVFSGTKQTRVRDRALAARIASAIS
Ga0316029_10890023300031870SoilVHVRDLKTGDIEVFSGTKQTRVRDRALAARIASAIS
Ga0318544_1016639523300031880SoilEVKAPSGPIIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0318536_1052519213300031893SoilVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0318522_1017764313300031894SoilHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318520_1016170513300031897SoilVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318520_1057660913300031897SoilVHVRNATSGDIEVFSGTSQTRLRDAGLAALIARAIG
Ga0306923_1203711823300031910SoilGREVKAPAGPIVLHVRDAGSGDIEVFSGTSQTRLRDTDLAARITRVIG
Ga0306921_1186005623300031912SoilMVHVRDARSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0310913_1036696113300031945SoilQSPRQSPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318562_1076417223300032008SoilPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDTDLAARIARAIG
Ga0310911_1066134613300032035SoilPIVVHVRNAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0318556_1013256113300032043SoilIMVHVRDARSGDIEVFAGTSQTRLRDQDLAARIARSIG
Ga0318570_1052297913300032054SoilPAGPIMVHVRDTRSGDIEVFAGTSQARLRDQDLAARIARAIG
Ga0318505_1028961213300032060SoilARAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318504_1061462723300032063SoilIRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0318513_1056233623300032065SoilIVVHVRDAKSGDIEVFSGTSQTRLRDTDLAARITRAIG
Ga0318525_1024653223300032089SoilIVHVRNAASGDIEVFSGTSQTRLRDAGLAARIARAIG
Ga0311301_1023157413300032160Peatlands SoilVLNVRDVKSGDIEVFYGTSQVQLQDKELTARIARAIG
Ga0307471_10187452413300032180Hardwood Forest SoilSPGQPHRGAPAEPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLATRIARAAG
Ga0306920_10100509523300032261SoilVVHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0335085_1255239523300032770SoilAHARLPGREPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDPDLAALIARAIG
Ga0335078_1145593013300032805SoilHRGAAAEPIMVHVRDTRSGDIEVFAGTSQTRLRDQDLAARITRAIG
Ga0335069_1014287713300032893SoilMLHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG
Ga0335077_1145092813300033158SoilSSGRSPAGPIMVHVRDTRSGDIEVFAGTSQARLRDKDLAARIARAIG
Ga0310914_1034594023300033289SoilVVHVRDAESGDIEVFSGTSQTRLRDTDLAARITRAIG
Ga0310914_1035275623300033289SoilSPSQPPGRAPAGPIMVHVRDTRSGDIEVFAGTSQTRLRDKDLAARIARAIG
Ga0310914_1080931013300033289SoilHVRDAKSGDIEVFSGTSQTRLRDTDLAARIARAIG
Ga0370483_0068940_16_1293300034124Untreated Peat SoilVVHVRNAKSGDIEVFSGTSQTRLQDKDLAARIARAIG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.