Basic Information | |
---|---|
Family ID | F051173 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 144 |
Average Sequence Length | 48 residues |
Representative Sequence | MARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE |
Number of Associated Samples | 133 |
Number of Associated Scaffolds | 144 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 10.42 % |
% of genes near scaffold ends (potentially truncated) | 84.03 % |
% of genes from short scaffolds (< 2000 bps) | 91.67 % |
Associated GOLD sequencing projects | 129 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.25 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.500 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.806 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.722 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (46.528 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 2.82% Coil/Unstructured: 97.18% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 144 Family Scaffolds |
---|---|---|
PF04909 | Amidohydro_2 | 8.33 |
PF02780 | Transketolase_C | 4.86 |
PF00248 | Aldo_ket_red | 2.78 |
PF00892 | EamA | 2.78 |
PF13366 | PDDEXK_3 | 2.08 |
PF12680 | SnoaL_2 | 2.08 |
PF13469 | Sulfotransfer_3 | 2.08 |
PF13343 | SBP_bac_6 | 1.39 |
PF09084 | NMT1 | 0.69 |
PF07883 | Cupin_2 | 0.69 |
PF02515 | CoA_transf_3 | 0.69 |
COG ID | Name | Functional Category | % Frequency in 144 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.69 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.69 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.50 % |
Unclassified | root | N/A | 12.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459012|GOYVCMS02GO5B6 | Not Available | 546 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_104191518 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 545 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105458772 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
3300000559|F14TC_103772878 | Not Available | 586 | Open in IMG/M |
3300000837|AP72_2010_repI_A100DRAFT_1043481 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 633 | Open in IMG/M |
3300000890|JGI11643J12802_10953021 | Not Available | 1030 | Open in IMG/M |
3300000890|JGI11643J12802_11374091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 500 | Open in IMG/M |
3300000955|JGI1027J12803_102159963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 865 | Open in IMG/M |
3300004268|Ga0066398_10049893 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005178|Ga0066688_10898064 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 547 | Open in IMG/M |
3300005330|Ga0070690_100695944 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 780 | Open in IMG/M |
3300005331|Ga0070670_101409263 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 639 | Open in IMG/M |
3300005354|Ga0070675_100938703 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 793 | Open in IMG/M |
3300005441|Ga0070700_100971218 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 696 | Open in IMG/M |
3300005455|Ga0070663_101109631 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 692 | Open in IMG/M |
3300005466|Ga0070685_11057201 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 611 | Open in IMG/M |
3300005536|Ga0070697_101785286 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 550 | Open in IMG/M |
3300005544|Ga0070686_100442358 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 997 | Open in IMG/M |
3300005545|Ga0070695_101343250 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 591 | Open in IMG/M |
3300005546|Ga0070696_100163313 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
3300005557|Ga0066704_11056481 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 501 | Open in IMG/M |
3300005563|Ga0068855_100031166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 6369 | Open in IMG/M |
3300005564|Ga0070664_100000638 | All Organisms → cellular organisms → Bacteria | 26843 | Open in IMG/M |
3300005564|Ga0070664_100604064 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1017 | Open in IMG/M |
3300005577|Ga0068857_100959634 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 822 | Open in IMG/M |
3300005617|Ga0068859_100471399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1351 | Open in IMG/M |
3300005764|Ga0066903_106156001 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300005843|Ga0068860_102242648 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 567 | Open in IMG/M |
3300005879|Ga0075295_1030581 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300005983|Ga0081540_1143019 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 957 | Open in IMG/M |
3300006049|Ga0075417_10018372 | All Organisms → cellular organisms → Bacteria | 2749 | Open in IMG/M |
3300006358|Ga0068871_100591733 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1008 | Open in IMG/M |
3300006797|Ga0066659_11331030 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 599 | Open in IMG/M |
3300006844|Ga0075428_102392009 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 542 | Open in IMG/M |
3300006845|Ga0075421_102173870 | Not Available | 586 | Open in IMG/M |
3300006847|Ga0075431_101275403 | Not Available | 696 | Open in IMG/M |
3300006852|Ga0075433_11753831 | Not Available | 534 | Open in IMG/M |
3300006871|Ga0075434_100435955 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
3300006871|Ga0075434_100477720 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1267 | Open in IMG/M |
3300006894|Ga0079215_10090963 | Not Available | 1316 | Open in IMG/M |
3300006894|Ga0079215_10560948 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300006904|Ga0075424_100547273 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
3300006914|Ga0075436_100295563 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300007076|Ga0075435_101538531 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 583 | Open in IMG/M |
3300009078|Ga0105106_11372618 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 501 | Open in IMG/M |
3300009091|Ga0102851_12625787 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 577 | Open in IMG/M |
3300009100|Ga0075418_10070541 | All Organisms → cellular organisms → Bacteria | 3723 | Open in IMG/M |
3300009147|Ga0114129_10784886 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1217 | Open in IMG/M |
3300009156|Ga0111538_10346537 | Not Available | 1880 | Open in IMG/M |
3300009162|Ga0075423_11325210 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 770 | Open in IMG/M |
3300009162|Ga0075423_12838029 | Not Available | 531 | Open in IMG/M |
3300009166|Ga0105100_10284502 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 991 | Open in IMG/M |
3300009811|Ga0105084_1122698 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 503 | Open in IMG/M |
3300009815|Ga0105070_1010806 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
3300010043|Ga0126380_10205060 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
3300010047|Ga0126382_10420396 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
3300010358|Ga0126370_12278470 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 535 | Open in IMG/M |
3300010360|Ga0126372_10815932 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 926 | Open in IMG/M |
3300010361|Ga0126378_12451075 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010362|Ga0126377_10265384 | All Organisms → cellular organisms → Bacteria | 1678 | Open in IMG/M |
3300010366|Ga0126379_10603012 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1184 | Open in IMG/M |
3300010376|Ga0126381_100480937 | All Organisms → cellular organisms → Bacteria | 1748 | Open in IMG/M |
3300010376|Ga0126381_100723300 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
3300010868|Ga0124844_1157122 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 856 | Open in IMG/M |
3300011406|Ga0137454_1052310 | Not Available | 656 | Open in IMG/M |
3300011429|Ga0137455_1022984 | All Organisms → cellular organisms → Bacteria | 1705 | Open in IMG/M |
3300011429|Ga0137455_1253681 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 518 | Open in IMG/M |
3300011439|Ga0137432_1084914 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300012096|Ga0137389_11553591 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 558 | Open in IMG/M |
3300012207|Ga0137381_10751961 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 846 | Open in IMG/M |
3300012209|Ga0137379_10382661 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
3300012210|Ga0137378_11802734 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 516 | Open in IMG/M |
3300012353|Ga0137367_10496504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 860 | Open in IMG/M |
3300012355|Ga0137369_10184218 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1629 | Open in IMG/M |
3300012355|Ga0137369_11069952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300012358|Ga0137368_10665633 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 657 | Open in IMG/M |
3300012469|Ga0150984_104496135 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300012506|Ga0157324_1006018 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300012532|Ga0137373_10398441 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300012582|Ga0137358_10076815 | All Organisms → cellular organisms → Bacteria | 2246 | Open in IMG/M |
3300012900|Ga0157292_10338624 | Not Available | 552 | Open in IMG/M |
3300012927|Ga0137416_10922746 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 777 | Open in IMG/M |
3300012930|Ga0137407_10008096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 7287 | Open in IMG/M |
3300012948|Ga0126375_11062594 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300012971|Ga0126369_10834660 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300012971|Ga0126369_11571354 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 747 | Open in IMG/M |
3300014256|Ga0075318_1133654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
3300014301|Ga0075323_1073150 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 702 | Open in IMG/M |
3300014326|Ga0157380_12435672 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 589 | Open in IMG/M |
3300014876|Ga0180064_1004418 | All Organisms → cellular organisms → Bacteria | 2892 | Open in IMG/M |
3300015053|Ga0137405_1378799 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
3300015374|Ga0132255_101342919 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1079 | Open in IMG/M |
3300015374|Ga0132255_101560563 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1000 | Open in IMG/M |
3300016294|Ga0182041_10817111 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 834 | Open in IMG/M |
3300016445|Ga0182038_11609704 | Not Available | 584 | Open in IMG/M |
3300017656|Ga0134112_10009361 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
3300017927|Ga0187824_10359848 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 526 | Open in IMG/M |
3300017939|Ga0187775_10103759 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 959 | Open in IMG/M |
3300018031|Ga0184634_10523379 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 527 | Open in IMG/M |
3300018072|Ga0184635_10138335 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 971 | Open in IMG/M |
3300018075|Ga0184632_10420132 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 559 | Open in IMG/M |
3300018078|Ga0184612_10006032 | All Organisms → cellular organisms → Bacteria | 6083 | Open in IMG/M |
3300018089|Ga0187774_10871978 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 615 | Open in IMG/M |
3300018422|Ga0190265_13586745 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 517 | Open in IMG/M |
3300018429|Ga0190272_11564856 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 674 | Open in IMG/M |
3300018469|Ga0190270_10874959 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 913 | Open in IMG/M |
3300019263|Ga0184647_1005215 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 533 | Open in IMG/M |
3300019377|Ga0190264_11899320 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 541 | Open in IMG/M |
3300020010|Ga0193749_1046329 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 837 | Open in IMG/M |
3300020060|Ga0193717_1121326 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 802 | Open in IMG/M |
3300021078|Ga0210381_10266734 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300021560|Ga0126371_11712883 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 752 | Open in IMG/M |
3300022309|Ga0224510_10532351 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 697 | Open in IMG/M |
3300022534|Ga0224452_1162950 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 686 | Open in IMG/M |
3300025899|Ga0207642_10568306 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 702 | Open in IMG/M |
3300025911|Ga0207654_10582834 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 797 | Open in IMG/M |
3300025912|Ga0207707_10457735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1091 | Open in IMG/M |
3300025914|Ga0207671_10427223 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1054 | Open in IMG/M |
3300025917|Ga0207660_11046845 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300025923|Ga0207681_10461815 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1034 | Open in IMG/M |
3300025940|Ga0207691_10885892 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 748 | Open in IMG/M |
3300025946|Ga0210126_101947 | Not Available | 1630 | Open in IMG/M |
3300026121|Ga0207683_10768921 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 894 | Open in IMG/M |
3300027006|Ga0209896_1010959 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
3300027646|Ga0209466_1001036 | All Organisms → cellular organisms → Bacteria | 5590 | Open in IMG/M |
3300027665|Ga0209983_1032610 | Not Available | 1113 | Open in IMG/M |
3300027748|Ga0209689_1226923 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 794 | Open in IMG/M |
3300027815|Ga0209726_10162980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1225 | Open in IMG/M |
3300027873|Ga0209814_10039733 | Not Available | 1955 | Open in IMG/M |
3300027886|Ga0209486_11083661 | Not Available | 543 | Open in IMG/M |
3300027909|Ga0209382_11720184 | Not Available | 614 | Open in IMG/M |
3300028536|Ga0137415_10654888 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 862 | Open in IMG/M |
3300030620|Ga0302046_10279339 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1373 | Open in IMG/M |
3300031720|Ga0307469_11458265 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 654 | Open in IMG/M |
3300031945|Ga0310913_10946379 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 605 | Open in IMG/M |
3300031946|Ga0310910_10720451 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 788 | Open in IMG/M |
3300031947|Ga0310909_10282401 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
3300031962|Ga0307479_10164607 | All Organisms → cellular organisms → Bacteria | 2178 | Open in IMG/M |
3300032012|Ga0310902_11330864 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 509 | Open in IMG/M |
3300032075|Ga0310890_11495810 | Not Available | 556 | Open in IMG/M |
3300033412|Ga0310810_10936567 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 753 | Open in IMG/M |
3300033413|Ga0316603_11543076 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 630 | Open in IMG/M |
3300033419|Ga0316601_102042837 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 578 | Open in IMG/M |
3300033434|Ga0316613_10609445 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 746 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.81% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.72% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.25% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.25% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.47% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.78% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.78% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.78% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.08% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.08% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.08% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.08% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.08% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.08% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.39% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.39% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.39% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.39% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.39% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.39% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.39% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.39% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.39% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.39% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.39% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.69% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.69% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.69% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009811 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 | Environmental | Open in IMG/M |
3300009815 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Host-Associated | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014256 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_TuleB_D2 | Environmental | Open in IMG/M |
3300014301 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D1 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300019263 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025946 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N56_07562450 | 2170459012 | Grass Soil | DKADQRINPDGSAIPGRTHEQGAAKPVLIEGAFFE |
INPhiseqgaiiFebDRAFT_1041915182 | 3300000364 | Soil | SGNEPLVMARVGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
INPhiseqgaiiFebDRAFT_1054587723 | 3300000364 | Soil | PDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFE* |
F14TC_1037728782 | 3300000559 | Soil | SGSDSLVMARIGAGSDKADQRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
AP72_2010_repI_A100DRAFT_10434811 | 3300000837 | Forest Soil | CYYQFRNSGETSLVMARIGAGPDKSDMGLNPDATPIPGRAHEQGAAKPF* |
JGI11643J12802_109530213 | 3300000890 | Soil | LVMTRIGAGPDKQDQRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE* |
JGI11643J12802_113740911 | 3300000890 | Soil | PLVMARIGAGSDKADQRLNPDGSAIPGRTHEQGAARPVLIEGAFFQ* |
JGI1027J12803_1021599633 | 3300000955 | Soil | KSDMRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE* |
Ga0066398_100498931 | 3300004268 | Tropical Forest Soil | MARIGAGPDKSDMRLNPDGTPVPGRAHEQGAAKPVLIEGSFFE* |
Ga0066688_108980641 | 3300005178 | Soil | CNSGNTSLVMARIGAGLDKHDMRLNPDGTPIPGRTQEQGAAKPVLIEGAFFE* |
Ga0070690_1006959443 | 3300005330 | Switchgrass Rhizosphere | TDPLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGVFFE* |
Ga0070670_1014092632 | 3300005331 | Switchgrass Rhizosphere | YYQFCNSGDDPLVMARIGAGPDKADQRLNPDGTAVPGRTHEQGAAKPVLIEGAFFE* |
Ga0070675_1009387031 | 3300005354 | Miscanthus Rhizosphere | PAGCYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQNAAKPVLIENAFFE |
Ga0070700_1009712182 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | CYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE* |
Ga0070663_1011096312 | 3300005455 | Corn Rhizosphere | CYYQFCNSGTDPLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGVFFE* |
Ga0070685_110572012 | 3300005466 | Switchgrass Rhizosphere | CNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQNAAKPVLIENAFFE* |
Ga0070697_1017852862 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MARVGAGLDKANQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0070686_1004423583 | 3300005544 | Switchgrass Rhizosphere | SGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE* |
Ga0070695_1013432502 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | IGAGSDKADQRLNPDGSAIPGRAHEQGAAKPVLIEGAFFE* |
Ga0070696_1001633131 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | AGCYYQFCNSGDDPLVMARIGAGPDKADQRLNPDGTAVPGRTHEQGAAKPVLIEGAFFE* |
Ga0066704_110564813 | 3300005557 | Soil | SGDTSLVMARIGAGPDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFE* |
Ga0068855_1000311661 | 3300005563 | Corn Rhizosphere | PAGCYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE |
Ga0070664_10000063824 | 3300005564 | Corn Rhizosphere | GQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE* |
Ga0070664_1006040641 | 3300005564 | Corn Rhizosphere | PLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIGGTFFE* |
Ga0068857_1009596341 | 3300005577 | Corn Rhizosphere | QDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE* |
Ga0068859_1004713991 | 3300005617 | Switchgrass Rhizosphere | GCYYQFCNSGEDPLVMARIGAGPDKADQRLNPDGTAVPGRTHEQGAAKPVLIEGAFFE* |
Ga0066903_1061560013 | 3300005764 | Tropical Forest Soil | VLPAGCYYQFRNSGETSLVTARIGAGPDKSDMRLNPDATPIPGRARARRHETVLIEGALFE* |
Ga0068860_1022426482 | 3300005843 | Switchgrass Rhizosphere | SGDDPLVMARIGAGPDKADQRLNPDGTAVPGRTHEQGAAKPVLIEGAFFE* |
Ga0075295_10305811 | 3300005879 | Rice Paddy Soil | LVMARIGAGSDKADQRLNPDGSAIPGRTHEQRAAKPVLIEGAFFQ* |
Ga0081540_11430192 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MARIGAGPDKSDMRLNPDATPIPGRAHEQGAAKPVLIEGAFFE* |
Ga0075417_100183722 | 3300006049 | Populus Rhizosphere | MTRVGVGPDNADQRINPDSTAIPDRTHEQGAAKPVLIEGAFFE* |
Ga0068871_1005917331 | 3300006358 | Miscanthus Rhizosphere | TDPLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0066659_113310302 | 3300006797 | Soil | SGTEPLVMARIGAGSDKADHRLNPDGSAIPGRTHEQGAAKPVLIEGAFYE* |
Ga0075428_1023920091 | 3300006844 | Populus Rhizosphere | LSVLQFGTEPLVMARVGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075421_1021738701 | 3300006845 | Populus Rhizosphere | DKADQRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075431_1012754031 | 3300006847 | Populus Rhizosphere | NSGDTPLVMTRIGPDPDKHDQRLNPDDTPIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075433_117538312 | 3300006852 | Populus Rhizosphere | MARIGAGSDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075434_1004359553 | 3300006871 | Populus Rhizosphere | AGKNNAIVLPSGCYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075434_1004777203 | 3300006871 | Populus Rhizosphere | VVLPAGCYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE* |
Ga0079215_100909631 | 3300006894 | Agricultural Soil | QFCNSGSDPLVMARIGAGSDKADQRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0079215_105609483 | 3300006894 | Agricultural Soil | MTRIGAGPDKQDQRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075424_1005472732 | 3300006904 | Populus Rhizosphere | MTRVGVGPDNADQRINPDSTAIPDRTHEQGAAKPVLIE |
Ga0075436_1002955633 | 3300006914 | Populus Rhizosphere | QFCNSGETPLVMARIGAGSDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075435_1015385311 | 3300007076 | Populus Rhizosphere | GETPLVMARIGAGSDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0105106_113726182 | 3300009078 | Freshwater Sediment | NSGQTPLVMARIGAGQDKADQRLNPDGSAIPGRVHEQGAAKPKLIEGAFFE* |
Ga0102851_126257871 | 3300009091 | Freshwater Wetlands | TPLVMARIGAGQDKADQRLNPDGSAIPGRASEQGAAKPKLIEGAFFE* |
Ga0075418_100705415 | 3300009100 | Populus Rhizosphere | MARVGAGLDKADQRLNPDGTTIPGRTHEQGAAKPVLIEGAFFE* |
Ga0114129_107848861 | 3300009147 | Populus Rhizosphere | MTRVGVGPDNADQRINPDSTAIPDRTHEEGAAKPVLIEGAFFE* |
Ga0111538_103465371 | 3300009156 | Populus Rhizosphere | RAGKNNAIVLPSGCYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075423_113252101 | 3300009162 | Populus Rhizosphere | AGCYYQFCNSGETPLVMARIGAGSDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075423_128380292 | 3300009162 | Populus Rhizosphere | SGTEPLVMARVGAGPDKADQRLNPDGTAIPGRTHEQNAAKPVLIEGAFFE* |
Ga0105100_102845022 | 3300009166 | Freshwater Sediment | RIGAGSDKADQRLNPDGSAIPGRAHEHGAAKPVLIEGAFFE* |
Ga0105084_11226981 | 3300009811 | Groundwater Sand | GCYYQFCNSGETPLVMARIGAGPDKSDMRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE* |
Ga0105070_10108064 | 3300009815 | Groundwater Sand | YQFCNSGDTPLVMARIGAGPDKSDMRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE* |
Ga0126380_102050602 | 3300010043 | Tropical Forest Soil | VLPAGCYYQFRNSGETSLVMARIGAGPDKSDMRLNPDATPIPGRAHEQGAAKPVLLEGAFFE* |
Ga0126382_104203961 | 3300010047 | Tropical Forest Soil | VLPAGCYYQFRNSGETSLVMARIGAGPDKSDMRLNPDATPIPGRAHEQGAAKPVLIEGAFFE* |
Ga0126370_122784702 | 3300010358 | Tropical Forest Soil | AGCYYQFCNSGDAPLVMARIGAGPDKSDMRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0126372_108159322 | 3300010360 | Tropical Forest Soil | YQFCNSGTEPLVMARIGAGQDKADHRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0126378_124510751 | 3300010361 | Tropical Forest Soil | MARIDAGPDKSDMRLNPDGTPVPGRAHEQGAAKPVLIEGSFFE* |
Ga0126377_102653841 | 3300010362 | Tropical Forest Soil | MARIGAGPDKSDMRLNPDGTSVPGRAHEQGAAKPVLIEGSYFE* |
Ga0126379_106030121 | 3300010366 | Tropical Forest Soil | KANKYNAVVLPAGCYYQFCNSGDTPLVMARIGAGQDKSEMRLNPDGIPIPGRAHEQGAAKPVLIEEAFFE* |
Ga0126381_1004809371 | 3300010376 | Tropical Forest Soil | DKSEMRLNPDGIPIPGRAHEQGAAKPVLIEEAFFE* |
Ga0126381_1007233001 | 3300010376 | Tropical Forest Soil | MARIGAGPDKSDMRLNPDATPIPGRAHEQGAAKPVLLEGAFFE* |
Ga0124844_11571222 | 3300010868 | Tropical Forest Soil | MARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137454_10523102 | 3300011406 | Soil | VMARIGAGPDKADQRLNPDGTAIPGRTQEQGAAQPRLIEGAFFE* |
Ga0137455_10229843 | 3300011429 | Soil | CNSGQTPLVMARIGAGSDKADQRLNPDGSAIPGRAQEHGAAKPVLIEGVFFE* |
Ga0137455_12536812 | 3300011429 | Soil | SGQTPLVMARIGAGQDKADQRLNPDGSAVPGRTSERGAAKPKLIEGAFFA* |
Ga0137432_10849141 | 3300011439 | Soil | STPLVMARIGAGPDKSDMRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137389_115535911 | 3300012096 | Vadose Zone Soil | AGCYYQFCNSGDTSLVMARIGAGPDKNDMRLNPDGTPIPGRTHEQGAAKPVLIENAFFE* |
Ga0137381_107519612 | 3300012207 | Vadose Zone Soil | ARIGAGSDKADHRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137379_103826612 | 3300012209 | Vadose Zone Soil | MARIGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137378_118027342 | 3300012210 | Vadose Zone Soil | RIGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137367_104965041 | 3300012353 | Vadose Zone Soil | TPLVMARIGAGPDKSDMRLNPDGTPIPGRTHEQGAAKPVMIEGAFFE* |
Ga0137369_101842181 | 3300012355 | Vadose Zone Soil | SDPLVMACIGAGLDKADQRLNPDGMAIFGRTYEQGAVKPVLIEKTFFE* |
Ga0137369_110699521 | 3300012355 | Vadose Zone Soil | QFCNSGSEPLVMARIGAGTDKADQRLNPDGTAIPGRTHEQGAARPVLIEGAFFE* |
Ga0137368_106656332 | 3300012358 | Vadose Zone Soil | ARIGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0150984_1044961351 | 3300012469 | Avena Fatua Rhizosphere | PDKADQRLNPDGTAIPGRTHEQGAAKPALIEGAFFE* |
Ga0157324_10060181 | 3300012506 | Arabidopsis Rhizosphere | MARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137373_103984411 | 3300012532 | Vadose Zone Soil | MARIGAGSDKQDMRLNPDGTPIPGRTHEQGAAKAVLIEGAFFE* |
Ga0137358_100768154 | 3300012582 | Vadose Zone Soil | CYYQFCNSGDTSLVMARIGAGPDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFE* |
Ga0157292_103386241 | 3300012900 | Soil | TPLVLTRIGAGPDKQDPRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137416_109227461 | 3300012927 | Vadose Zone Soil | RIGAGSDKADHRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137407_100080969 | 3300012930 | Vadose Zone Soil | MARVGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0126375_110625941 | 3300012948 | Tropical Forest Soil | VLPAGCYYQFRNSGETSLVMARIGAGPDKSDMRLNPDATPIPGRAHEQGAAKPF* |
Ga0126369_108346603 | 3300012971 | Tropical Forest Soil | MARIGAGPDKSDMRLNPDGTPVPGRAHEQGAAKPVLIEGAFFE* |
Ga0126369_115713541 | 3300012971 | Tropical Forest Soil | TEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0075318_11336542 | 3300014256 | Natural And Restored Wetlands | CNSGSDPLVLARIGAGSDKADQRLNPDGSAIPGRTHEQGAARPVLIEGAFFQ* |
Ga0075323_10731502 | 3300014301 | Natural And Restored Wetlands | FCNSGTDSLVMARIGAGSDKVDQRLNPDGSAIPGRAHEQGAAKPVLIEGAFFE* |
Ga0157380_124356721 | 3300014326 | Switchgrass Rhizosphere | VMARIGAGSDKADQRLNPDGSAIPGRAQEHGAAKPVLIEGAFFE* |
Ga0180064_10044184 | 3300014876 | Soil | GSTPLVMTRIGAGPDKSDMRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE* |
Ga0137405_13787991 | 3300015053 | Vadose Zone Soil | QFCNSGDTPLVMARIGAGSDKQDMRLNPDGTPIPGRTHEQGAAKAVLIEGAFFE* |
Ga0132255_1013429192 | 3300015374 | Arabidopsis Rhizosphere | QFCNSGTDPLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFQ* |
Ga0132255_1015605631 | 3300015374 | Arabidopsis Rhizosphere | IGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIGGTFFE* |
Ga0182041_108171113 | 3300016294 | Soil | VMARIDAGPYKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFE |
Ga0182038_116097041 | 3300016445 | Soil | MARIGAGPDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFE |
Ga0134112_100093611 | 3300017656 | Grasslands Soil | NSGDTPLVMARIGAGSDKQDMRLNPDGTPIPGRTHEQGAAKAVLIEGAFFE |
Ga0187824_103598481 | 3300017927 | Freshwater Sediment | TDPLVMARIGAGSDNADQRLNPDGSAIPGRAYEQGAAKPVLIEGAFFE |
Ga0187775_101037592 | 3300017939 | Tropical Peatland | LVMARIGAGSDKADQRLNPDGTAIPGRAHEQTAAKPVLIEGAFYE |
Ga0184634_105233791 | 3300018031 | Groundwater Sediment | DKADQRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE |
Ga0184635_101383351 | 3300018072 | Groundwater Sediment | DKSDMRLNPDGTPVPGRTHEQGAAKPVLIEGAFFE |
Ga0184632_104201322 | 3300018075 | Groundwater Sediment | MARIGAGSDKADQRLNPDGSAIPGRTQEQGAAKPLLMEGAFFE |
Ga0184612_100060328 | 3300018078 | Groundwater Sediment | VMARIGAGSDKADQRLNPDGSSIPGRTHEQSAAKPVLIEGAFFE |
Ga0187774_108719781 | 3300018089 | Tropical Peatland | DKQDMRLNPEGTPIPGRIHEQGAVKPVLIEGAIFE |
Ga0190265_135867451 | 3300018422 | Soil | GPDKADQRLNPDGSAVPGRAHEQGVAKPKLIEGAFFE |
Ga0190272_115648562 | 3300018429 | Soil | YQFCNSGQTPLVMARIGAGQDKADQRLNADGSAIPGRAHEQGAAKAKLIEGAFFA |
Ga0190270_108749591 | 3300018469 | Soil | VMARIGAGSDKADQRLNPDGSAIPGRAQEQGAAKPVLIEGAFFE |
Ga0184647_10052152 | 3300019263 | Groundwater Sediment | FCNSGRTPLVMARIGAGSDKADQRLNPDGSAIPGRAQEHGAAKPVLIEGAFFE |
Ga0190264_118993201 | 3300019377 | Soil | IGAGQDKADQRLNPDGSAIPGRAHEPNAAKPKLIEGAFFA |
Ga0193749_10463291 | 3300020010 | Soil | GTEPLVMARIGAGSDKADHRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE |
Ga0193717_11213261 | 3300020060 | Soil | LVMARIGAGPDKADQRLNPDGTAVPGRTHEQGAAKPVLIEGAFFE |
Ga0210381_102667341 | 3300021078 | Groundwater Sediment | MARIGAGLDKSDMRLNPDGTPVPGRTHEQGAAKPVLIEGAFFE |
Ga0126371_117128831 | 3300021560 | Tropical Forest Soil | QFRNSGETPLVMTRIGAGPDKSDMRLNPDGTPVPGRAHEQGAAKPVLIEGAFFE |
Ga0224510_105323511 | 3300022309 | Sediment | RIGAGEDKADQRLNPDGSAIPGRASEQGATKPKLIEGAYFE |
Ga0224452_11629501 | 3300022534 | Groundwater Sediment | GSDPLVMARIGAGLDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE |
Ga0207642_105683061 | 3300025899 | Miscanthus Rhizosphere | DKADQRLNPDGTAIPGRTHEQNAAKPVLIENAFFE |
Ga0207654_105828341 | 3300025911 | Corn Rhizosphere | DPLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE |
Ga0207707_104577351 | 3300025912 | Corn Rhizosphere | AVVLSAGCYYQFCNSGSDPLVMARIGAGSDKADQRLNPDGSAIPGRAHEQGAAKPVLIEDAFFE |
Ga0207671_104272231 | 3300025914 | Corn Rhizosphere | SGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQNAAKPVLIENAFFE |
Ga0207660_110468451 | 3300025917 | Corn Rhizosphere | SGSAPLVMARIGAGSDKADQRLNPDGSAIPGRAHEQGAAKPILIEGAFFE |
Ga0207681_104618152 | 3300025923 | Switchgrass Rhizosphere | QFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE |
Ga0207691_108858922 | 3300025940 | Miscanthus Rhizosphere | IGAGPDKADQRLNPDGTAVPGRTHEQGAAKPVLIEGAFFE |
Ga0210126_1019471 | 3300025946 | Natural And Restored Wetlands | PLVMARIGAGQDKADQRLNPDGSAIPGRAHEQGAAKPKLIEGAYFE |
Ga0207683_107689211 | 3300026121 | Miscanthus Rhizosphere | EPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE |
Ga0209896_10109592 | 3300027006 | Groundwater Sand | GCYYQFCNSGDTPLVMARIGAGPDKSDMRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE |
Ga0209466_10010368 | 3300027646 | Tropical Forest Soil | MARIGAGPDKSDMRLNPDGTPVPGRAHEQGAAKPVLIEGSFFE |
Ga0209983_10326101 | 3300027665 | Arabidopsis Thaliana Rhizosphere | DKADQRLNPDGSAIPGRTHEQGAARPVLIEGAFFQ |
Ga0209689_12269231 | 3300027748 | Soil | KHQAVVLPAGCYYQFCNSGDTSLVMARIGAGPDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFA |
Ga0209726_101629803 | 3300027815 | Groundwater | IGAGSDKADQRLNPDGSAIPGRTYEQGAAKPVLIEGAFFE |
Ga0209814_100397334 | 3300027873 | Populus Rhizosphere | MTRVGVGPDNADQRINPDSTAIPDRTHEQGAAKPVLIEGAFFE |
Ga0209486_110836612 | 3300027886 | Agricultural Soil | GAGPDKQDQRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE |
Ga0209382_117201842 | 3300027909 | Populus Rhizosphere | RIGAGSDKADQRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE |
Ga0137415_106548881 | 3300028536 | Vadose Zone Soil | LVMTRIGAGSDKADHRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE |
Ga0302046_102793392 | 3300030620 | Soil | DPLVMARIGAGSDKADQRLNPDGSAIPGRTHEQGAAKPVLIEGAFFE |
Ga0307469_114582651 | 3300031720 | Hardwood Forest Soil | CNSGDAPLVMARIGAGPDKSDMRLNPDGTAIPGRTHEQGAAKAVLIEGAFFE |
Ga0310913_109463791 | 3300031945 | Soil | AGCYYQFCNSGTEPLVMARIGAGQDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE |
Ga0310910_107204512 | 3300031946 | Soil | LPAGCYYQFCNSDDTPLVMARIGAGPDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFF |
Ga0310909_102824011 | 3300031947 | Soil | YYQFCNSDDTPLVMARIGAGPDKSDMRLNPDGTAIPGRTQEQGAAKPVLIEGAFFE |
Ga0307479_101646071 | 3300031962 | Hardwood Forest Soil | LVMARIGAGPDKSDMRLNPDGTAIPGRTHEQGAAKPVLIEGAFFE |
Ga0310902_113308642 | 3300032012 | Soil | CYYQFCNSGTDPLVMARIGAGPDKADQRLNPDGTAIPGRTHEQGAAKPVLIEGVFFE |
Ga0310890_114958102 | 3300032075 | Soil | LVMTRIGAGPDKQDQRLNPDGTPIPGRTHEQGAAKPVLIEGAFFE |
Ga0310810_109365671 | 3300033412 | Soil | QDKADQRLNPDGTAIPGRTHEQGAAKPVLIENAFFE |
Ga0316603_115430761 | 3300033413 | Soil | SGQTPLVMARIGAGQDKADQRLNPDGSAIPGRAHEQGAAKPKLIEGAFFE |
Ga0316601_1020428372 | 3300033419 | Soil | QTPLVMARIGAGQDKADQRLNPDGSAIPGRASEQGAAKPKLIEGAFFE |
Ga0316613_106094453 | 3300033434 | Soil | ARIGAGQDKADQRLNPDGSAIPGRAHEQGAAKPKLIAGAFFE |
⦗Top⦘ |