Metagenome Family F050703

Basic Information
Family ID	F050703
Family Type	Metagenome
Number of Sequences	145
Average Sequence Length	37 residues
Representative Sequence	MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH
Number of Associated Samples	121
Number of Associated Scaffolds	145

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	80.69 %
% of genes near scaffold ends (potentially truncated)	24.83 %
% of genes from short scaffolds (< 2000 bps)	63.45 %
Associated GOLD sequencing projects	116
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.59

Most Common Taxonomy
Group	Bacteria (81.379 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (8.276 % of family members)
Environment Ontology (ENVO)	Unclassified (33.103 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (37.931 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.56% β-sheet: 0.00% Coil/Unstructured: 48.44%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF00856	SET	40.69
PF00892	EamA	4.14
PF07883	Cupin_2	4.14
PF14497	GST_C_3	3.45
PF05681	Fumerase	2.07
PF05683	Fumerase_C	2.07
PF02566	OsmC	2.07
PF08734	GYD	2.07
PF07732	Cu-oxidase_3	0.69
PF03466	LysR_substrate	0.69
PF13505	OMP_b-brl	0.69
PF00990	GGDEF	0.69
PF03588	Leu_Phe_trans	0.69
PF13467	RHH_4	0.69
PF06808	DctM	0.69
PF04280	Tim44	0.69
PF07378	FlbT	0.69
PF00221	Lyase_aromatic	0.69
PF13354	Beta-lactamase2	0.69
PF13545	HTH_Crp_2	0.69
PF12680	SnoaL_2	0.69
PF13458	Peripla_BP_6	0.69
PF01541	GIY-YIG	0.69
PF07729	FCD	0.69

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG1764	Organic hydroperoxide reductase OsmC/OhrA	Defense mechanisms [V]	2.07
COG1765	Uncharacterized OsmC-related protein	General function prediction only [R]	2.07
COG1838	Tartrate dehydratase beta subunit/Fumarate hydratase class I, C-terminal domain	Energy production and conversion [C]	2.07
COG1951	Tartrate dehydratase alpha subunit/Fumarate hydratase class I, N-terminal domain	Energy production and conversion [C]	2.07
COG4274	Uncharacterized conserved protein, contains GYD domain	Function unknown [S]	2.07
COG1802	DNA-binding transcriptional regulator, GntR family	Transcription [K]	0.69
COG2132	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)	Cell cycle control, cell division, chromosome partitioning [D]	0.69
COG2186	DNA-binding transcriptional regulator, FadR family	Transcription [K]	0.69
COG2360	Leu/Phe-tRNA-protein transferase	Posttranslational modification, protein turnover, chaperones [O]	0.69
COG2986	Histidine ammonia-lyase	Amino acid transport and metabolism [E]	0.69
COG4395	Predicted lipid-binding transport protein, Tim44 family	Lipid transport and metabolism [I]	0.69
COG5443	Flagellar biosynthesis regulator FlbT	Cell motility [N]	0.69

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	81.38 %
Unclassified	root	N/A	18.62 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	81.38 %
Unclassified	root	N/A	18.62 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	81.38 %
Unclassified	root	N/A	18.62 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	81.38 %
Unclassified	root	N/A	18.62 %

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	76.55 %
Unclassified	root	N/A	18.62 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2.76 %

Name	Rank	Taxonomy	Distribution
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	66.90 %
Unclassified	root	N/A	18.62 %
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	2.76 %
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	1.38 %

Name	Rank	Taxonomy	Distribution
Xanthobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae	20.69 %
Unclassified	root	N/A	18.62 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	5.52 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.76 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %

Name	Rank	Taxonomy	Distribution
Pseudolabrys	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	20.69 %
Unclassified	root	N/A	18.62 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.76 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.07 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.62 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.76 %
unclassified Pseudolabrys	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys	2.07 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.07 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	18.62 %
Betaproteobacteria bacterium SCGC AG-212-J23	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2.76 %
Pseudolabrys sp. Root1462	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	2.07 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	2.07 %
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1.38 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090015\|GPICI_9029450	All Organisms → cellular organisms → Bacteria → Proteobacteria	2137	Open in IMG/M
2199352025\|deepsgr__Contig_23443	Not Available	559	Open in IMG/M
2228664021\|ICCgaii200_c0832451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1431	Open in IMG/M
3300000041\|ARcpr5oldR_c000138	All Organisms → cellular organisms → Bacteria → Proteobacteria	12428	Open in IMG/M
3300000156\|NODE_c0684193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	3172	Open in IMG/M
3300000550\|F24TB_10815614	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	4415	Open in IMG/M
3300000953\|JGI11615J12901_10798171	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1721	Open in IMG/M
3300004479\|Ga0062595_101309707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	653	Open in IMG/M
3300004480\|Ga0062592_100206175	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1393	Open in IMG/M
3300005163\|Ga0066823_10012265	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1230	Open in IMG/M
3300005290\|Ga0065712_10117018	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1726	Open in IMG/M
3300005529\|Ga0070741_10011414	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	16416	Open in IMG/M
3300005543\|Ga0070672_100000433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	24368	Open in IMG/M
3300005548\|Ga0070665_100427940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1333	Open in IMG/M
3300005564\|Ga0070664_100046775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3656	Open in IMG/M
3300005713\|Ga0066905_100033371	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2952	Open in IMG/M
3300005713\|Ga0066905_100172383	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1586	Open in IMG/M
3300005713\|Ga0066905_100374311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1146	Open in IMG/M
3300005764\|Ga0066903_100002666	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14124	Open in IMG/M
3300005764\|Ga0066903_104177411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	773	Open in IMG/M
3300005841\|Ga0068863_102291639	Not Available	550	Open in IMG/M
3300005842\|Ga0068858_100049404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3896	Open in IMG/M
3300005843\|Ga0068860_100329387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1500	Open in IMG/M
3300005937\|Ga0081455_10003308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18643	Open in IMG/M
3300006028\|Ga0070717_10000575	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	23445	Open in IMG/M
3300006047\|Ga0075024_100862788	Not Available	512	Open in IMG/M
3300006163\|Ga0070715_10676058	Not Available	614	Open in IMG/M
3300006172\|Ga0075018_10008671	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3708	Open in IMG/M
3300006173\|Ga0070716_100083669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	1911	Open in IMG/M
3300006178\|Ga0075367_10482318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	786	Open in IMG/M
3300006804\|Ga0079221_10426294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	832	Open in IMG/M
3300006852\|Ga0075433_10421851	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1177	Open in IMG/M
3300006854\|Ga0075425_101008934	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	949	Open in IMG/M
3300006854\|Ga0075425_102819597	Not Available	534	Open in IMG/M
3300006871\|Ga0075434_100079741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3270	Open in IMG/M
3300006881\|Ga0068865_100274123	Not Available	1340	Open in IMG/M
3300006903\|Ga0075426_10430498	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	976	Open in IMG/M
3300006903\|Ga0075426_10682309	Not Available	770	Open in IMG/M
3300006914\|Ga0075436_100508646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	882	Open in IMG/M
3300006954\|Ga0079219_10083607	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1509	Open in IMG/M
3300009093\|Ga0105240_10622364	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1186	Open in IMG/M
3300009093\|Ga0105240_11579944	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	687	Open in IMG/M
3300009156\|Ga0111538_10014995	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	10200	Open in IMG/M
3300009162\|Ga0075423_10000467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	32790	Open in IMG/M
3300009166\|Ga0105100_10987844	Not Available	527	Open in IMG/M
3300009174\|Ga0105241_10868473	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	835	Open in IMG/M
3300009545\|Ga0105237_10393557	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1390	Open in IMG/M
3300010046\|Ga0126384_11867207	Not Available	572	Open in IMG/M
3300010047\|Ga0126382_10004116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6378	Open in IMG/M
3300010047\|Ga0126382_10045004	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2542	Open in IMG/M
3300010358\|Ga0126370_11075836	Not Available	740	Open in IMG/M
3300010359\|Ga0126376_13106531	Not Available	514	Open in IMG/M
3300010362\|Ga0126377_10039444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	4051	Open in IMG/M
3300010362\|Ga0126377_12152363	Not Available	634	Open in IMG/M
3300010371\|Ga0134125_10291353	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1813	Open in IMG/M
3300010371\|Ga0134125_10560358	Not Available	1264	Open in IMG/M
3300010375\|Ga0105239_11079656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	924	Open in IMG/M
3300010375\|Ga0105239_12429279	Not Available	610	Open in IMG/M
3300010399\|Ga0134127_10152145	Not Available	2102	Open in IMG/M
3300010399\|Ga0134127_10688863	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1061	Open in IMG/M
3300011269\|Ga0137392_10399423	Not Available	1141	Open in IMG/M
3300012357\|Ga0137384_10135352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2063	Open in IMG/M
3300012897\|Ga0157285_10001588	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3762	Open in IMG/M
3300012958\|Ga0164299_10137348	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1333	Open in IMG/M
3300012958\|Ga0164299_11551932	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	519	Open in IMG/M
3300012960\|Ga0164301_10067380	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1924	Open in IMG/M
3300012961\|Ga0164302_10407613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	930	Open in IMG/M
3300012971\|Ga0126369_10576621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1192	Open in IMG/M
3300012971\|Ga0126369_12525871	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	599	Open in IMG/M
3300012987\|Ga0164307_10084615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1938	Open in IMG/M
3300013307\|Ga0157372_10668641	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1209	Open in IMG/M
3300014318\|Ga0075351_1009459	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1361	Open in IMG/M
3300014326\|Ga0157380_12808131	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	554	Open in IMG/M
3300015371\|Ga0132258_10011404	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	18602	Open in IMG/M
3300015371\|Ga0132258_11189547	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1927	Open in IMG/M
3300015371\|Ga0132258_11401046	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1766	Open in IMG/M
3300015373\|Ga0132257_100043373	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4972	Open in IMG/M
3300015373\|Ga0132257_100425271	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1618	Open in IMG/M
3300015373\|Ga0132257_102839390	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	631	Open in IMG/M
3300015374\|Ga0132255_100980566	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1267	Open in IMG/M
3300017936\|Ga0187821_10161803	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	849	Open in IMG/M
3300017944\|Ga0187786_10014406	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1991	Open in IMG/M
3300017947\|Ga0187785_10000517	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14425	Open in IMG/M
3300017959\|Ga0187779_10028998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3177	Open in IMG/M
3300017966\|Ga0187776_10000909	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	14459	Open in IMG/M
3300017966\|Ga0187776_10342825	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	984	Open in IMG/M
3300017973\|Ga0187780_10195787	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1408	Open in IMG/M
3300017974\|Ga0187777_10589032	Not Available	783	Open in IMG/M
3300017993\|Ga0187823_10231819	Not Available	618	Open in IMG/M
3300017994\|Ga0187822_10156049	Not Available	736	Open in IMG/M
3300018028\|Ga0184608_10024065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	2238	Open in IMG/M
3300018060\|Ga0187765_10015817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	3500	Open in IMG/M
3300018060\|Ga0187765_10018613	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3266	Open in IMG/M
3300018072\|Ga0184635_10019140	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2493	Open in IMG/M
3300019356\|Ga0173481_10001451	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	5722	Open in IMG/M
3300019361\|Ga0173482_10000071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	13866	Open in IMG/M
3300019362\|Ga0173479_10000285	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9473	Open in IMG/M
3300021560\|Ga0126371_11719363	Not Available	751	Open in IMG/M
3300023168\|Ga0247748_1008354	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1341	Open in IMG/M
3300025711\|Ga0207696_1163191	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	592	Open in IMG/M
3300025711\|Ga0207696_1181475	Not Available	556	Open in IMG/M
3300025900\|Ga0207710_10007780	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	4537	Open in IMG/M
3300025912\|Ga0207707_10288245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462	1421	Open in IMG/M
3300025914\|Ga0207671_10523294	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	946	Open in IMG/M
3300025916\|Ga0207663_10035748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2983	Open in IMG/M
3300025917\|Ga0207660_10250519	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1398	Open in IMG/M
3300025919\|Ga0207657_10072415	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2915	Open in IMG/M
3300025920\|Ga0207649_10198574	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1415	Open in IMG/M
3300025921\|Ga0207652_10256954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1576	Open in IMG/M
3300025925\|Ga0207650_10150898	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1834	Open in IMG/M
3300025926\|Ga0207659_11092902	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	686	Open in IMG/M
3300025933\|Ga0207706_10043857	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3963	Open in IMG/M
3300025965\|Ga0210090_1028187	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	767	Open in IMG/M
3300026088\|Ga0207641_10824717	Not Available	918	Open in IMG/M
3300026116\|Ga0207674_10089234	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3075	Open in IMG/M
3300026319\|Ga0209647_1025839	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3529	Open in IMG/M
3300026725\|Ga0207474_101324	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	730	Open in IMG/M
3300027787\|Ga0209074_10009384	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2375	Open in IMG/M
3300027894\|Ga0209068_10001621	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	11172	Open in IMG/M
3300027910\|Ga0209583_10199189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	854	Open in IMG/M
3300027915\|Ga0209069_10832485	Not Available	554	Open in IMG/M
3300028592\|Ga0247822_10177172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1584	Open in IMG/M
3300028802\|Ga0307503_10162763	Not Available	1024	Open in IMG/M
3300031170\|Ga0307498_10004392	Not Available	2427	Open in IMG/M
3300031231\|Ga0170824_114990514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	4190	Open in IMG/M
3300031241\|Ga0265325_10000093	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	63498	Open in IMG/M
3300031562\|Ga0310886_10099850	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1443	Open in IMG/M
3300031716\|Ga0310813_10184923	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium SCGC AG-212-J23	1699	Open in IMG/M
3300031740\|Ga0307468_100020578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2902	Open in IMG/M
3300031942\|Ga0310916_10700434	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	857	Open in IMG/M
3300031944\|Ga0310884_10100144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	1417	Open in IMG/M
3300032180\|Ga0307471_101968003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	732	Open in IMG/M
3300032211\|Ga0310896_10000994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	6801	Open in IMG/M
3300032770\|Ga0335085_10148314	All Organisms → cellular organisms → Bacteria → Proteobacteria	2947	Open in IMG/M
3300032770\|Ga0335085_11724162	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	644	Open in IMG/M
3300032782\|Ga0335082_10013431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	8879	Open in IMG/M
3300032782\|Ga0335082_10062463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3801	Open in IMG/M
3300032828\|Ga0335080_10370553	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1542	Open in IMG/M
3300032828\|Ga0335080_11211244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	758	Open in IMG/M
3300032893\|Ga0335069_10391306	Not Available	1633	Open in IMG/M
3300032893\|Ga0335069_11647066	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys	686	Open in IMG/M
3300032897\|Ga0335071_11043896	Not Available	763	Open in IMG/M
3300033004\|Ga0335084_10134442	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2572	Open in IMG/M
3300033433\|Ga0326726_10047024	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3772	Open in IMG/M
3300033486\|Ga0316624_10000032	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	37493	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	66.90%
Host-Associated	Host-Associated	32.41%
Engineered	Engineered	0.69%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	58.62%
Plants	Host-Associated → Plants	32.41%
Aquatic	Environmental → Aquatic	8.28%
Solid Waste	Engineered → Solid Waste	0.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	57.93%
Rhizosphere	Host-Associated → Plants → Rhizosphere	20.69%
Rhizoplane	Host-Associated → Plants → Rhizoplane	11.03%
Sediment	Environmental → Aquatic → Sediment	4.83%
Freshwater	Environmental → Aquatic → Freshwater	2.76%
Marine	Environmental → Aquatic → Marine	0.69%
Peat	Environmental → Terrestrial → Peat	0.69%
Roots	Host-Associated → Plants → Roots	0.69%
Grass	Engineered → Solid Waste → Grass	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	34.48%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	14.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.48%
Loam	Environmental → Terrestrial → Soil → Loam	8.97%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.21%
Soil	Host-Associated → Plants → Rhizosphere → Soil	6.21%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	4.83%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	4.83%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.07%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.69%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.69%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.69%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.69%
Composting	Engineered → Solid Waste → Grass → Composting	0.69%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.38%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	14.48%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.48%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	6.21%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	4.83%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.83%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	4.83%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.45%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.76%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.76%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.76%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	2.07%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.69%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.69%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.69%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.69%
Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor	0.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	8.28%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	7.59%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	6.90%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	6.21%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	6.21%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	5.52%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.83%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	3.45%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.45%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	2.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.76%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.76%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	2.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	2.07%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.07%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	2.07%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.07%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	2.07%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.38%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.38%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.38%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	1.38%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	1.38%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.69%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.69%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.69%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.69%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.69%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.69%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.69%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.69%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	0.69%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.69%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.69%
Sugar Cane Bagasse Incubating Bioreactor	Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental	Open in IMG/M
2228664021	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Host-Associated	Open in IMG/M
3300000156	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic	Engineered	Open in IMG/M
3300000550	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly	Environmental	Open in IMG/M
3300000953	Soil microbial communities from Great Prairies - Kansas Corn soil	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300005163	Soil and rhizosphere microbial communities from Laval, Canada - mgHMB	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental	Open in IMG/M
3300006172	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006178	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Host-Associated	Open in IMG/M
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental	Open in IMG/M
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009166	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015	Environmental	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated	Open in IMG/M
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012897	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1	Environmental	Open in IMG/M
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental	Open in IMG/M
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014318	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017944	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG	Environmental	Open in IMG/M
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental	Open in IMG/M
3300017993	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3	Environmental	Open in IMG/M
3300017994	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018072	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300023168	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5	Environmental	Open in IMG/M
3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025965	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2 (SPAdes)	Environmental	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental	Open in IMG/M
3300026725	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A5-12 (SPAdes)	Environmental	Open in IMG/M
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental	Open in IMG/M
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental	Open in IMG/M
3300028592	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30	Environmental	Open in IMG/M
3300028802	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental	Open in IMG/M
3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Host-Associated	Open in IMG/M
3300031562	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031740	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300032782	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1	Environmental	Open in IMG/M
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300032897	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.59
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.59
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F050703

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPICI_01870360	2088090015	Soil	MRDLMFMLAPVALVLYFVVYPDQFSYFLGWAGRLLH
deepsgr_03412920	2199352025	Soil	MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH
ICCgaii200_08324512	2228664021	Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR
ARcpr5oldR_00013813	3300000041	Arabidopsis Rhizosphere	MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH*
NODE_06841937	3300000156	Sugar Cane Bagasse Incubating Bioreactor	MRDAVFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH*
F24TB_108156147	3300000550	Soil	MRDLMFMLAPVALVLYFVVYPDQFSYFLGWAGRLLH*
JGI11615J12901_107981712	3300000953	Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGRFLH*
Ga0062595_1013097071	3300004479	Soil	SRCQLGNRPMRDLMFMLFPVALVIYFVIYPDQFSAFVDWAGQLFH*
Ga0062592_1002061751	3300004480	Soil	MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFL
Ga0066823_100122653	3300005163	Soil	NVSARGIPMRDLMFMLAPVALVLYFVVYPDQFSLFVGWAGSLLR*
Ga0065712_101170181	3300005290	Miscanthus Rhizosphere	MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH*
Ga0070741_1001141417	3300005529	Surface Soil	MRDLMFMLAPVALVIYFVVYPDQFSAFLSWAGRFLH*
Ga0070672_10000043315	3300005543	Miscanthus Rhizosphere	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH*
Ga0070665_1004279404	3300005548	Switchgrass Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH*
Ga0070664_1000467756	3300005564	Corn Rhizosphere	MRDLVFMLAPVALIIYFVVFPDQFSALLGWAGHYVH*
Ga0066905_1000333711	3300005713	Tropical Forest Soil	MRDLMFMLAPVALVLYFVVYPDQFSSFLGWAGRFLH*
Ga0066905_1001723831	3300005713	Tropical Forest Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFVR*
Ga0066905_1003743112	3300005713	Tropical Forest Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFIR*
Ga0066903_10000266618	3300005764	Tropical Forest Soil	MRDLIFMLAPVALILYFVVFPDQFSAFLGWAGQYVH*
Ga0066903_1041774112	3300005764	Tropical Forest Soil	MRDAIFMLAPVALVVYFVAYPDQFSAFLNWAGQFIR*
Ga0068863_1022916392	3300005841	Switchgrass Rhizosphere	MRDVIFMLAPVALVIYFVVYPDQFSAFLNWAGQFL
Ga0068858_1000494044	3300005842	Switchgrass Rhizosphere	MRDVIFMLAPVALVIYFVVYPDQFSAFLNWAGQFLH*
Ga0068860_1003293872	3300005843	Switchgrass Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFGALLGWASHYVH*
Ga0081455_1000330814	3300005937	Tabebuia Heterophylla Rhizosphere	MRDLMFMLAPVALVLYFVVYPDQFSSFLGWAGRLLH*
Ga0070717_100005754	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MRDLMFMLAPVALVLYFVVYPDQFSLFVGWAGSLLR*
Ga0075024_1008627882	3300006047	Watersheds	MRDLMFMLAPVALILYFLVYPGQFSALLSWAGQFVH*
Ga0070715_106760581	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MRDSMFMLAPVGLIIYFLIYPDQFHAFLAWAGQYLR*
Ga0075018_100086716	3300006172	Watersheds	MRDLMFMLAPVGLIIYFVVYPDQFSALVSWAGQYVH*
Ga0070716_1000836692	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MRDFMFMLAPVALIIYFLLYPDQFNAFLAWAGQYLH*
Ga0075367_104823183	3300006178	Populus Endosphere	MRDAIFMLAPVALVIYFVAYPDQFSAFLSWAGQFIH*
Ga0079221_104262942	3300006804	Agricultural Soil	MRDLFFMLAPIGLIIYFVIYPDQFSALLNWAGQFMH*
Ga0075433_104218513	3300006852	Populus Rhizosphere	DLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH*
Ga0075425_1010089341	3300006854	Populus Rhizosphere	DLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLL*
Ga0075425_1028195972	3300006854	Populus Rhizosphere	MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLL
Ga0075434_1000797412	3300006871	Populus Rhizosphere	MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH*
Ga0068865_1002741232	3300006881	Miscanthus Rhizosphere	MRDLMFMLAPVALVLYFVVYPDQFSSFVGWAGSLLH*
Ga0075426_104304982	3300006903	Populus Rhizosphere	MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGQLLY*
Ga0075426_106823092	3300006903	Populus Rhizosphere	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFL
Ga0075436_1005086461	3300006914	Populus Rhizosphere	PMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGQLLY*
Ga0079219_100836073	3300006954	Agricultural Soil	MRDLIFMLAPVALIIYFVVYPDQFNALLGWAGQYVH*
Ga0105240_106223641	3300009093	Corn Rhizosphere	RPMRDLVFMLAPVALIIYFVVFPDQFSALLGWAGHYVH*
Ga0105240_115799441	3300009093	Corn Rhizosphere	MRDLMFMLFPVALVIYFVIYPDQFSAFVDWAGQLFH*
Ga0111538_1001499510	3300009156	Populus Rhizosphere	MRDLMFMMAPVALILYFVVYPDQFSSFVGWAGSLLH*
Ga0075423_1000046730	3300009162	Populus Rhizosphere	MRDLMFMLAPVALLYFVVYPDQFSYFLGWAGRLLH*
Ga0105100_109878441	3300009166	Freshwater Sediment	MRDVIFMVAPVAIAIYFLVYPDEFHALVAWAMQFIR*
Ga0105241_108684731	3300009174	Corn Rhizosphere	DAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH*
Ga0105237_103935572	3300009545	Corn Rhizosphere	MRDLVFMLAPVALIIYFVVFPDQFSALLGWASHYVH*
Ga0126384_118672072	3300010046	Tropical Forest Soil	MRDAIFMLAPVALVVYFVAYPDQFSAFLNWAGQFLH*
Ga0126382_100041161	3300010047	Tropical Forest Soil	MRDLMFMLAPVALIFYFVVYPDQFSSFLGWAGRLLH*
Ga0126382_100450043	3300010047	Tropical Forest Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLSWAGQFIR*
Ga0126370_110758361	3300010358	Tropical Forest Soil	MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGQLLH
Ga0126376_131065311	3300010359	Tropical Forest Soil	MRDLFFMLAPIGLIIYFVVYPDQFTAFLNWAGQFMH*
Ga0126377_100394444	3300010362	Tropical Forest Soil	MRDLMFMLAPVALIIYFVVYPDQFSSFLGWAGRFIH*
Ga0126377_121523632	3300010362	Tropical Forest Soil	MRDAIFMLAPVALIIYFVAYPDQFSAFLYWAGQFIR*
Ga0134125_102913532	3300010371	Terrestrial Soil	MRDAIFILAPVALIIYFVAYPDQFSAFLNWAGQFLH*
Ga0134125_105603582	3300010371	Terrestrial Soil	MRDLIFMLAPVVLVIYFVVYPDQFNALLGWAGQYVH*
Ga0105239_110796561	3300010375	Corn Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGQYVR*
Ga0105239_124292791	3300010375	Corn Rhizosphere	MRDAIFMLAPVALIIYFVAYPDQFTAFLNWAGQFLH*
Ga0134127_101521453	3300010399	Terrestrial Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLYWAGQFLR*
Ga0134127_106888633	3300010399	Terrestrial Soil	ERPMRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH*
Ga0137392_103994232	3300011269	Vadose Zone Soil	MRDLLFMLAPVGLIIYFVIYPDQFNALLTWAGHYIR*
Ga0137384_101353522	3300012357	Vadose Zone Soil	MRDLLFMLAPVGLIIYFVFYPDQFNALLTWAGQYIR*
Ga0157285_100015883	3300012897	Soil	MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFTAFLNWAGQFLH*
Ga0164299_101373481	3300012958	Soil	PMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH*
Ga0164299_115519322	3300012958	Soil	KNPMRDLIFMLAPVAFIIYFVVYPEQFNAFVGWISHLLH*
Ga0164301_100673803	3300012960	Soil	MRDLIFMLAPVAFIIYFVVYPEQFNAFVGWISHLLH*
Ga0164302_104076133	3300012961	Soil	MRDLVFMFAQVALIIYFVVFPDQFGALLGWAGHYVH*
Ga0126369_105766211	3300012971	Tropical Forest Soil	MRDVVFMLAPVALILYFVVYPDQFSSFVGWAGQLLH*
Ga0126369_125258711	3300012971	Tropical Forest Soil	SVRDLMFMLAPVALVLYFVVFPDQFSAFLGWAGQYLH*
Ga0164307_100846153	3300012987	Soil	MRDLIFMLAPVVLVIYFLVYPDQFNALLGWAGQYVH*
Ga0157372_106686412	3300013307	Corn Rhizosphere	MRDLVFMLAPVALIIYFVVFPDQFSALLGWAGQYVH*
Ga0075351_10094593	3300014318	Natural And Restored Wetlands	CRVNPMRDAIFMLAPVALIIYFVAYPDQFTAFPNWAGQFLH*
Ga0157380_128081311	3300014326	Switchgrass Rhizosphere	MRDAIFMLAPVALIIYFVAYPDQFTAFLNWAGQFLH
Ga0132258_100114045	3300015371	Arabidopsis Rhizosphere	MRDVIFMVAPVALIVYFVVYPDQFSAFVNWAGRLLH*
Ga0132258_111895473	3300015371	Arabidopsis Rhizosphere	MRDLIFMLAPVALIVYFVVFPDQFGALLGWAGHYVH*
Ga0132258_114010462	3300015371	Arabidopsis Rhizosphere	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR*
Ga0132257_1000433732	3300015373	Arabidopsis Rhizosphere	MRDAIFMLAPVALIIYFVANPDQFSAFLNWAGQFLH*
Ga0132257_1004252713	3300015373	Arabidopsis Rhizosphere	GTTMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLL*
Ga0132257_1028393901	3300015373	Arabidopsis Rhizosphere	MRDIVFMVAPVALIVYFVVYPDQFSAFVNWAGRLLH*
Ga0132255_1009805662	3300015374	Arabidopsis Rhizosphere	MRDTIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR*
Ga0187821_101618031	3300017936	Freshwater Sediment	MRDLMFMLAPVALIIYFVINPDQFSALVNWAGQVFH
Ga0187786_100144062	3300017944	Tropical Peatland	MRDLLFMLSPVALIIYFLIYPDQFNAFLAWARQLLH
Ga0187785_1000051711	3300017947	Tropical Peatland	MRDLMFMLAPVALIFYFVVYPDQFSALLSWAGQYVR
Ga0187779_100289983	3300017959	Tropical Peatland	MRDVIFMVAPVGLIVYFVMYPDQFNAFLAWAGRFLH
Ga0187776_100009096	3300017966	Tropical Peatland	MRDLIFMVAPVALVIYFVVFPDQFSAFVNWAGQFLH
Ga0187776_103428251	3300017966	Tropical Peatland	GKPMRDLMFMLAPVALIIYFVVYPDQFSALLSWAGQYVH
Ga0187780_101957871	3300017973	Tropical Peatland	MRDFMFMLAPVALIIYFLLYPDQFNAFLAWAGQYLH
Ga0187777_105890321	3300017974	Tropical Peatland	MRDFLFMLAPVGLVIYFLLYPDQFNAFLVWAGQYLH
Ga0187823_102318191	3300017993	Freshwater Sediment	MRDLMFMLAPVALIIYFVIYPDQFSAFVNWAGQLLH
Ga0187822_101560491	3300017994	Freshwater Sediment	MRDLFFMLAPIGLIIYFVIYPDQFSALLNWAGQFMH
Ga0184608_100240652	3300018028	Groundwater Sediment	MRDFMFMLAPVALIIYFVVYPDKFSSFLGWAGQLLH
Ga0187765_100158173	3300018060	Tropical Peatland	MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSFLR
Ga0187765_100186134	3300018060	Tropical Peatland	MRDLIFMLAPVALIIYFVIFPDQFSAFLGWAGQYVH
Ga0184635_100191404	3300018072	Groundwater Sediment	MRDWMFMLAPVVLIMYFVVYPDQFYSFVGWAGQFLR
Ga0173481_100014513	3300019356	Soil	MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH
Ga0173482_100000717	3300019361	Soil	MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0173479_1000028510	3300019362	Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0126371_117193632	3300021560	Tropical Forest Soil	MRDVVFMLAPVALILYFVVYPDQFSSFVGWAGQLLH
Ga0247748_10083541	3300023168	Soil	RINMSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0207696_11631911	3300025711	Switchgrass Rhizosphere	PMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0207696_11814752	3300025711	Switchgrass Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFSALLGWAGHYVH
Ga0207710_100077807	3300025900	Switchgrass Rhizosphere	MRDLMFMLAPVALVLYFVVYPDQFSSFVGWAGSLLH
Ga0207707_102882451	3300025912	Corn Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYV
Ga0207671_105232943	3300025914	Corn Rhizosphere	PMRDLVFMLAPVALIIYFVVFPDQFSALLGWAGHYVH
Ga0207663_100357485	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH
Ga0207660_102505191	3300025917	Corn Rhizosphere	MRDAIFMLAPVALVIYFVAYPDQFSAFLYWAGQFLR
Ga0207657_100724151	3300025919	Corn Rhizosphere	MRDLMFMLAPVALVLYFVVYPDQFSLFVGWAGSLLH
Ga0207649_101985741	3300025920	Corn Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFGALLGWAGQYVH
Ga0207652_102569541	3300025921	Corn Rhizosphere	RDAVFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0207650_101508983	3300025925	Switchgrass Rhizosphere	MRDVIFMLAPVALVIYFVVYPDQFSAFLNWAGQFLH
Ga0207659_110929021	3300025926	Miscanthus Rhizosphere	PMRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH
Ga0207706_100438575	3300025933	Corn Rhizosphere	MRDLIFMLAPVALIIYFVVFPDQFGALLGWASHYVH
Ga0210090_10281872	3300025965	Natural And Restored Wetlands	MRDAIFMLAPVALIIYFVAYPDQFTAFPNWAGQFLH
Ga0207641_108247171	3300026088	Switchgrass Rhizosphere	MRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFIH
Ga0207674_100892343	3300026116	Corn Rhizosphere	MRDAIFMLAPVALIIYFVAYPDQFRAFLNWAGQFLH
Ga0209647_10258394	3300026319	Grasslands Soil	MRDLLFMLAPVGLIIYFVIYPDQFNALLTWAGHYIR
Ga0207474_1013242	3300026725	Soil	STCRCRVTPMRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH
Ga0209074_100093841	3300027787	Agricultural Soil	MRDAVFMLAPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0209068_100016214	3300027894	Watersheds	MRDLMFMLAPVGLIIYFVVYPDQFSALVSWAGQYVH
Ga0209583_101991892	3300027910	Watersheds	MRDLMFMLAPVALIIYFVVYPGQFSALLSWAGQFVH
Ga0209069_108324851	3300027915	Watersheds	MRDLMFMLAPVALILYFLVYPGQFSALLSWAGQFVH
Ga0247822_101771721	3300028592	Soil	MSVQGNPMRDAIFMLAPVALIIYFVAYPDQFSAFLNWAGQFLH
Ga0307503_101627633	3300028802	Soil	MRDIIFMLAPIGLIIYFVVYPDQFNAFLSWAGQYVH
Ga0307498_100043922	3300031170	Soil	MSARGYPMRDLMFMLAPVALIVYFVVYPDQFSSFVGWAGRLLH
Ga0170824_1149905146	3300031231	Forest Soil	MSARGCPMQDLMFMLAPVALVVYFLVSPDQFSSFVGWAGRLLH
Ga0265325_1000009325	3300031241	Rhizosphere	MRDSMFMLAPVALIIYFLIYPDQFNAFLAWAGQYLR
Ga0310886_100998503	3300031562	Soil	CQRGGLPMRDLMFMLAPVALILYFVVYPDQFSSFVGWAGSLLH
Ga0310813_101849231	3300031716	Soil	MRDLIFMLAPVAFIIYFVVYPEQFNAFVGWISHLLH
Ga0307468_1000205781	3300031740	Hardwood Forest Soil	MRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFIR
Ga0310916_107004341	3300031942	Soil	VRGEEPVRDLMFMLAPVALVLYFVVFPDQFSAFLGWAGQYLH
Ga0310884_101001443	3300031944	Soil	MSVQGNPMRDAIFMLGPVALVIYFVAYPDQFSAFLNWAGQFLH
Ga0307471_1019680032	3300032180	Hardwood Forest Soil	NISARERPMRDLIFMLAPVALIIYFVVFPDQFGALLGWAGHYVH
Ga0310896_100009941	3300032211	Soil	MSVQGNPMRDAIFMLAPVALVIYFVAYPDQFSAFLNWAGQFLR
Ga0335085_101483144	3300032770	Soil	MRDLIFMVAPIGAAIYFLFYPDQFHAFLDWLMNLVG
Ga0335085_117241621	3300032770	Soil	RDSMLMLVPVALIIYFLVYPDQFHALLAWAGQYLH
Ga0335082_1001343110	3300032782	Soil	MRDSMLMLVPVALIIYFLVYPDQFHALLAWAGQYLH
Ga0335082_100624632	3300032782	Soil	MRDLMFMLAPVALIIYFVVYPDQLSALISWASQYVH
Ga0335080_103705533	3300032828	Soil	MRDIMFMLAPVAFVVYFLLYPDQFNAFLTWAGQYLH
Ga0335080_112112441	3300032828	Soil	REGKPMRDLMFMLAPVALIIYFVVYPDQFSALLSWAGQYVH
Ga0335069_103913063	3300032893	Soil	MRDLLFMLAPVALIIYFLIYPDQFSVFLAWARQLLH
Ga0335069_116470661	3300032893	Soil	TARRLMRDLLFMLAPVALIIYFLIYPDQFSVFLAWARQLLH
Ga0335071_110438961	3300032897	Soil	MRDLIMLLAPIALVFYFVVYPDQFSAFVYWASHLIG
Ga0335084_101344422	3300033004	Soil	MRDAIFMLAPVALIVYFVAYPDQFSAFLNWAGKFLH
Ga0326726_100470244	3300033433	Peat Soil	MRDLMFMLAPVALIIYFVVYPDQLSALISWAGQYVH
Ga0316624_1000003218	3300033486	Soil	MRDWVLPVAPIALVVYFIVFPDQFSALLGWAADLMH

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign