NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050614

Metagenome / Metatranscriptome Family F050614

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050614
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 50 residues
Representative Sequence VSSTSRQALGNLAGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSI
Number of Associated Samples 131
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.34 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.79 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.966 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(11.724 % of family members)
Environment Ontology (ENVO) Unclassified
(28.276 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.586 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 59.49%    β-sheet: 0.00%    Coil/Unstructured: 40.51%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF13458Peripla_BP_6 38.62
PF07883Cupin_2 3.45
PF12604gp37_C 0.69
PF08546ApbA_C 0.69
PF03301Trp_dioxygenase 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.69
COG3483Tryptophan 2,3-dioxygenase (vermilion)Amino acid transport and metabolism [E] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.97 %
UnclassifiedrootN/A31.03 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_11275700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria802Open in IMG/M
3300000550|F24TB_10012918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium813Open in IMG/M
3300000955|JGI1027J12803_104394046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium749Open in IMG/M
3300000956|JGI10216J12902_101510504All Organisms → cellular organisms → Bacteria1243Open in IMG/M
3300000956|JGI10216J12902_110634997All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria521Open in IMG/M
3300000956|JGI10216J12902_110865072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1821Open in IMG/M
3300000956|JGI10216J12902_124790666All Organisms → cellular organisms → Bacteria862Open in IMG/M
3300001431|F14TB_100173459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300002568|C688J35102_120134461All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300002568|C688J35102_120183863All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300002568|C688J35102_120958290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00823125Open in IMG/M
3300003267|soilL1_10082196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1150Open in IMG/M
3300003321|soilH1_10117274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2435Open in IMG/M
3300004081|Ga0063454_100903083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300005093|Ga0062594_101718017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300005178|Ga0066688_10435342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300005187|Ga0066675_11204712Not Available562Open in IMG/M
3300005329|Ga0070683_102352663Not Available511Open in IMG/M
3300005338|Ga0068868_101283810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300005343|Ga0070687_101165224Not Available567Open in IMG/M
3300005343|Ga0070687_101430325Not Available518Open in IMG/M
3300005345|Ga0070692_10141740All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300005366|Ga0070659_101621013Not Available578Open in IMG/M
3300005435|Ga0070714_100734965All Organisms → cellular organisms → Bacteria953Open in IMG/M
3300005439|Ga0070711_101593982All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300005441|Ga0070700_100594785All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300005441|Ga0070700_100896184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium722Open in IMG/M
3300005458|Ga0070681_10863916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300005518|Ga0070699_101477529Not Available623Open in IMG/M
3300005535|Ga0070684_100300586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1473Open in IMG/M
3300005539|Ga0068853_101590834All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005544|Ga0070686_101261621All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300005546|Ga0070696_101634971Not Available554Open in IMG/M
3300005560|Ga0066670_10826074All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005564|Ga0070664_100768601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria900Open in IMG/M
3300005578|Ga0068854_100412713All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300005615|Ga0070702_101751002Not Available518Open in IMG/M
3300005718|Ga0068866_11005266Not Available593Open in IMG/M
3300005888|Ga0075289_1066136Not Available584Open in IMG/M
3300006173|Ga0070716_100130121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1590Open in IMG/M
3300006175|Ga0070712_100868779All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300006581|Ga0074048_13385693All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300006791|Ga0066653_10158292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1111Open in IMG/M
3300006804|Ga0079221_10697836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300006845|Ga0075421_101389627All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300006852|Ga0075433_10462644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1118Open in IMG/M
3300006854|Ga0075425_100468518All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1451Open in IMG/M
3300006871|Ga0075434_102005994Not Available584Open in IMG/M
3300009092|Ga0105250_10162426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria933Open in IMG/M
3300009148|Ga0105243_10241727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1607Open in IMG/M
3300009156|Ga0111538_10420190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1694Open in IMG/M
3300009162|Ga0075423_10653779All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1109Open in IMG/M
3300009162|Ga0075423_12588461Not Available554Open in IMG/M
3300009177|Ga0105248_11563059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium747Open in IMG/M
3300009553|Ga0105249_10340345Not Available1517Open in IMG/M
3300009553|Ga0105249_11758792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300009792|Ga0126374_11868036Not Available504Open in IMG/M
3300010047|Ga0126382_10507387Not Available971Open in IMG/M
3300010093|Ga0127490_1109867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium681Open in IMG/M
3300010108|Ga0127474_1076252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium692Open in IMG/M
3300010132|Ga0127455_1172029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1093Open in IMG/M
3300010147|Ga0126319_1395080All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.2142Open in IMG/M
3300010154|Ga0127503_10817617Not Available1209Open in IMG/M
3300010335|Ga0134063_10745520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300010362|Ga0126377_10010866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00827104Open in IMG/M
3300010371|Ga0134125_12243196Not Available594Open in IMG/M
3300010396|Ga0134126_12704868Not Available538Open in IMG/M
3300010398|Ga0126383_11456493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium775Open in IMG/M
3300010400|Ga0134122_11408344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium711Open in IMG/M
3300010896|Ga0138111_1061346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300012385|Ga0134023_1020199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium696Open in IMG/M
3300012387|Ga0134030_1076125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1215Open in IMG/M
3300012389|Ga0134040_1002661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1484Open in IMG/M
3300012389|Ga0134040_1310234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300012390|Ga0134054_1162918Not Available589Open in IMG/M
3300012392|Ga0134043_1143763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1489Open in IMG/M
3300012401|Ga0134055_1279854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1525Open in IMG/M
3300012406|Ga0134053_1409167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium688Open in IMG/M
3300012409|Ga0134045_1436770All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1144Open in IMG/M
3300012469|Ga0150984_101264368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1191Open in IMG/M
3300012495|Ga0157323_1040548Not Available532Open in IMG/M
3300012496|Ga0157353_1046934Not Available514Open in IMG/M
3300012903|Ga0157289_10121303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium773Open in IMG/M
3300012948|Ga0126375_10103671All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00821692Open in IMG/M
3300012948|Ga0126375_10766754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium760Open in IMG/M
3300012957|Ga0164303_10255613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1007Open in IMG/M
3300012957|Ga0164303_10697807All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300012958|Ga0164299_10158742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1261Open in IMG/M
3300012960|Ga0164301_11624974Not Available537Open in IMG/M
3300012961|Ga0164302_10686531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300012976|Ga0134076_10135226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1000Open in IMG/M
3300012988|Ga0164306_10966431Not Available699Open in IMG/M
3300013102|Ga0157371_10122845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1846Open in IMG/M
3300013102|Ga0157371_11361578Not Available550Open in IMG/M
3300013104|Ga0157370_11323313Not Available649Open in IMG/M
3300013296|Ga0157374_11128119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300013308|Ga0157375_10166409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00822350Open in IMG/M
3300014325|Ga0163163_13033050Not Available524Open in IMG/M
3300014497|Ga0182008_10639730Not Available601Open in IMG/M
3300014969|Ga0157376_11431424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium723Open in IMG/M
3300015374|Ga0132255_100561655All Organisms → cellular organisms → Bacteria1683Open in IMG/M
3300018431|Ga0066655_11269212Not Available526Open in IMG/M
3300018433|Ga0066667_10160136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1602Open in IMG/M
3300019255|Ga0184643_1147857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1695Open in IMG/M
3300021344|Ga0193719_10472473Not Available507Open in IMG/M
3300021445|Ga0182009_10719126Not Available542Open in IMG/M
3300021510|Ga0222621_1014764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1522Open in IMG/M
3300022694|Ga0222623_10341684Not Available572Open in IMG/M
3300022892|Ga0247753_1001189All Organisms → cellular organisms → Bacteria2525Open in IMG/M
3300024187|Ga0247672_1093544Not Available524Open in IMG/M
3300025911|Ga0207654_10123560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1629Open in IMG/M
3300025916|Ga0207663_11222904Not Available605Open in IMG/M
3300025918|Ga0207662_10073897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD00822069Open in IMG/M
3300025924|Ga0207694_10834429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium779Open in IMG/M
3300025928|Ga0207700_11818869Not Available535Open in IMG/M
3300025929|Ga0207664_10192942All Organisms → cellular organisms → Bacteria1754Open in IMG/M
3300025936|Ga0207670_10716776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300025945|Ga0207679_12009812Not Available526Open in IMG/M
3300025993|Ga0208415_1018624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium668Open in IMG/M
3300026023|Ga0207677_11198554Not Available695Open in IMG/M
3300026025|Ga0208778_1032398Not Available529Open in IMG/M
3300026067|Ga0207678_10287516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1412Open in IMG/M
3300026075|Ga0207708_11033688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300026088|Ga0207641_12076129Not Available569Open in IMG/M
3300026750|Ga0207483_104199Not Available603Open in IMG/M
3300027695|Ga0209966_1049699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria890Open in IMG/M
3300027866|Ga0209813_10307455Not Available617Open in IMG/M
3300027991|Ga0247683_1010881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300028145|Ga0247663_1005350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1679Open in IMG/M
3300028713|Ga0307303_10071320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300028719|Ga0307301_10004566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3860Open in IMG/M
3300028744|Ga0307318_10011330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2856Open in IMG/M
3300028755|Ga0307316_10120232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria925Open in IMG/M
3300028778|Ga0307288_10168756All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300028824|Ga0307310_10403118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium679Open in IMG/M
3300028872|Ga0307314_10308087Not Available506Open in IMG/M
3300028875|Ga0307289_10460298Not Available523Open in IMG/M
3300031854|Ga0310904_11203626Not Available546Open in IMG/M
3300031858|Ga0310892_11095049Not Available565Open in IMG/M
3300031908|Ga0310900_10751946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria785Open in IMG/M
3300031996|Ga0308176_11085404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria846Open in IMG/M
3300032013|Ga0310906_10169940Not Available1293Open in IMG/M
3300032180|Ga0307471_101771927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium770Open in IMG/M
3300032180|Ga0307471_102237734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300033412|Ga0310810_10252689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1938Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.72%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil10.34%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.90%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.45%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere3.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.76%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.76%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.07%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.07%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.07%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.38%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.38%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.38%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.38%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.38%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.38%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.69%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.69%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.69%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.69%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005888Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010093Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010108Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010132Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012385Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012387Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012389Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012392Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012401Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012406Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012409Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012495Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610Host-AssociatedOpen in IMG/M
3300012496Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.090610EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5EnvironmentalOpen in IMG/M
3300024187Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK13EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025993Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026025Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026750Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes)EnvironmentalOpen in IMG/M
3300027695Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027991Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK24EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1127570023300000363SoilVTTAPRQRLVNLGGLVVALAVWTLYAVYLSPTHGWTFFFQLTVNGIILGSVYALIALG
F24TB_1001291813300000550SoilVNSAVGQRLGNLTGLAVALVAFMLYAVYLSPSQGWTFFLQL
JGI1027J12803_10439404623300000955SoilVSSTRQVLGNLAGLGVLLAIWVVYAVYFSPAQGWTFFFQLTVNGIILGSIYA
JGI10216J12902_10151050423300000956SoilMSQNLRQQLANLTGLAVILAAWTIYAVYFSPTQGWTFYFQLTVNGIILGSVYALIALG
JGI10216J12902_11063499713300000956SoilVNAALSQQLRNLAGLGLGLVAFMFYAVYFSPTEGWVFFFQLTVNGIILGSVYALIALGYSMV
JGI10216J12902_11086507213300000956SoilVTTARRQRLGNLGGLAVVLAIWVVYAVYFSPTQGWTFFLQLTVNGIIL
JGI10216J12902_12479066613300000956SoilVNSAVGQRLGNLTGLAVALVAFMLYAVYLSPSQGWTFFLQLSVNGIILGSLYALIALG
F14TB_10017345923300001431SoilVDAALRQRLGNLAGLAVGLVAFMFYAVYFSPTQGWTFFFQLSVNGIILGSLYALIALGYT
C688J35102_12013446113300002568SoilVSSTSRQALGNLSGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYALIA
C688J35102_12018386323300002568SoilMELSFRRRLVNLGGLALVLGVWTIYAVHDKGWVFFFQLVVNGVTLGSVYALIALGY
C688J35102_12095829043300002568SoilVNQGLRQRLGNLGGLALALAVWTVYAVYFSPAQGWTFFFQLSVNGIILGSVYAL
soilL1_1008219623300003267Sugarcane Root And Bulk SoilVDSALRQRLANLTGLAVALVAFMLYAVYLSPTHGWTFFFQLSVNGIILGSLYALI
soilH1_1011727443300003321Sugarcane Root And Bulk SoilVSSTPRQVLGNLAGLGVLLVIWVIYAVYFSPTQGWTFFLQLTVGGIILGSIYALIAL
Ga0063454_10090308323300004081SoilVSSTSRQALGNLAGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSI
Ga0062594_10171801713300005093SoilVSPTSRQALGNLSGLGVLLAIWVVYAVYFSPAQGWTFFFQLT
Ga0066688_1043534223300005178SoilVSSTPRQALGNLAGLGVLLAIWVFYAVYFSPTQGWTFFLQLTVDG
Ga0066675_1120471213300005187SoilVSSTPRQALGNLAGLGVLLVIWVVYAVYFSPTQGWTFFLQL
Ga0070683_10235266323300005329Corn RhizosphereVNPALSQQLRNLAGLGVGLVAFMFYAVYFSPTQGWVFFFQLTVNGIILGSIYALIALGYSMVY
Ga0068868_10128381023300005338Miscanthus RhizosphereVASTSRQVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQLTVN
Ga0070687_10116522423300005343Switchgrass RhizosphereVNDDLRQRLGNLGGLGVALLVWTIYAVYFSPTQGWVFLFQLSVNGIILGSVYALIA
Ga0070687_10143032513300005343Switchgrass RhizosphereVASTSRQVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQLTVNGIILGSI
Ga0070692_1014174013300005345Corn, Switchgrass And Miscanthus RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFYFQLTVNGIILGSVYALIALGYT
Ga0070659_10162101313300005366Corn RhizosphereVASTSRQVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQLTVNGIILGSIYALIA
Ga0070714_10073496523300005435Agricultural SoilVNPALSQQLRNLAGLGVGLVAFMLYAVYFSPTQGWVFFFQLTVNGIILGSIYALIALGY
Ga0070711_10159398213300005439Corn, Switchgrass And Miscanthus RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFFLQLTVNGIILGSVYALIALG
Ga0070700_10059478513300005441Corn, Switchgrass And Miscanthus RhizosphereVNSVRGQQLGNLGGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGIILGS
Ga0070700_10089618423300005441Corn, Switchgrass And Miscanthus RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFFLQLTVNG
Ga0070681_1086391623300005458Corn RhizosphereVSPTSRQALGNLSGLGVLLAIWVVYAVYFSPAQGWTFFFQLTINGIIL
Ga0070699_10147752923300005518Corn, Switchgrass And Miscanthus RhizosphereMSQNVRQQVVNLGGLGIILLAWTFYAVYLSPTQGWTFFFQLTVNGIILGSVYALIALGY
Ga0070684_10030058613300005535Corn RhizosphereVNDDLRQRLGNLGGLAIALVAWTFYAVYFSPTHGWVFFFQLTVNGIIL
Ga0068853_10159083413300005539Corn RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFFLQLTVNGIILGSVYALIAL
Ga0070686_10126162123300005544Switchgrass RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFFLQLTVNGIILGSVYALIA
Ga0070696_10163497123300005546Corn, Switchgrass And Miscanthus RhizosphereVNPALSQQLRNLAGLGVGLVAFMFYAVYFSPTEGWVFFFQLTV
Ga0066670_1082607423300005560SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYALIAL
Ga0070664_10076860113300005564Corn RhizosphereVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQLTVNGIILGSIYA
Ga0068854_10041271323300005578Corn RhizosphereMSQNVRQQVVNLGGLGIILLAWTFYAVYLSPTQGWTFFFQLTVNGIILGSVYALIALG
Ga0070702_10175100223300005615Corn, Switchgrass And Miscanthus RhizosphereVNASARQRLGNLGGLALALGLWTLYAVYLSPTQGWTFFLQLTVNGIILGSVYA
Ga0068866_1100526613300005718Miscanthus RhizosphereVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQLTVNGIILGSIYALIALGYSL
Ga0075289_106613613300005888Rice Paddy SoilMTKNLRLQLANLAGLAAILAAWTIYAVYLSPTQGWTFYLQLTVNGIILGSVYALIALGYT
Ga0070716_10013012123300006173Corn, Switchgrass And Miscanthus RhizosphereVGSTSRQVLGNLAGLGVLLAIWVVYAVYFSPAQGWTFFFQLTVNGII
Ga0070712_10086877923300006175Corn, Switchgrass And Miscanthus RhizosphereVNPALSQQLRNLAGLGVGLLAFMLYAVYFSPTQGWVFFFQLTVNGIILGSIYALIALGY
Ga0074048_1338569313300006581SoilVSLATRQQLTSLGGLALLLAVWTVYAVYFSPSTGWTFYFQLTVNGIILGSIYALIALGY
Ga0066653_1015829223300006791SoilVSSTPRQALGNLAGLGVLLVIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYAL
Ga0079221_1069783623300006804Agricultural SoilVNEDLRQRLGNLGGLAIALVAWTFYAVYFSPTHGWVFFFQL
Ga0075421_10138962723300006845Populus RhizosphereVSSERLRTGVSLDLRQRLLNLGGLAVAIVAWTLYAVYLSPTHGWTFFLQLTVNGIILGSVYALIAL
Ga0075433_1046264423300006852Populus RhizosphereVASTSRQVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQL
Ga0075425_10046851813300006854Populus RhizosphereVNPEFRQRLANLSGLAVALILWMFYAVYFSPTQGWTF
Ga0075434_10200599413300006871Populus RhizosphereMSQNLRQQLVNLSGLGIILICWTLYAVYLSPTQGWTFYLQLTVNGIILGSVYALI
Ga0105250_1016242613300009092Switchgrass RhizosphereVNDDLRQRLGNLGGLGVALLVWTIYAVYFSPTQGWVFFFQLSVNGIILGSVYALIA
Ga0105243_1024172713300009148Miscanthus RhizosphereVNAVLRQRLLNLGGLAVAIVAWTLYAVYLSPTQGWTFFLQLTVNGIILGSVYAL
Ga0111538_1042019013300009156Populus RhizosphereVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGIILGSLYAL
Ga0075423_1065377923300009162Populus RhizosphereVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGII
Ga0075423_1258846113300009162Populus RhizosphereVNSVRGQQLGNLGGLALALVAFMFYAVYLSPTQGWTFFFQLTV
Ga0105248_1156305913300009177Switchgrass RhizosphereMSSERLRTGVSDDLRQRLKNLGGLAVALIVWTFYAVYFSPTQGWTFFFQLTVNGIILGSVYALIALGYSMV
Ga0105249_1034034523300009553Switchgrass RhizosphereMSQNVRQQVVNLGGLGIILLAWTFYAVYLSPTQGWTFFFQ
Ga0105249_1175879223300009553Switchgrass RhizosphereVLGNLAGLCVLLAIWVVYAVYFSPAQGWTFFFQLTVNGIILGSI
Ga0126374_1186803613300009792Tropical Forest SoilMSQNLRQQLVNLSGLGIILIAWTLYAVYLSPTQGWTFYFQLTINGIILGSVYALIALG
Ga0126382_1050738723300010047Tropical Forest SoilVDSTLRQRLGNLTGLAVGLVAFMLYAVYLSPTQGWTFFFQLTVNGIILG
Ga0127490_110986723300010093Grasslands SoilVSSTSRQALGNLAGLGVLLAIWVVYAVYFSPAQGW
Ga0127474_107625223300010108Grasslands SoilVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFLQLTV
Ga0127455_117202913300010132Grasslands SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYALIALGYS
Ga0126319_139508033300010147SoilVSSATRQQLTNLWGLALLLAAWTVYAVYFSPTTGWTFFLQLTVNG
Ga0127503_1081761713300010154SoilVSPATRQQLTSLWGLALLLAAWTIYAVYFSPTTGWTFYFQLTVNGIILGSIYA
Ga0134063_1074552023300010335Grasslands SoilVIATRQRLGNFGGLGLALAAWVLYAVYFSPTEGWTFFLQLTVNGIILGSIYALIALGYSM
Ga0126377_1001086613300010362Tropical Forest SoilVNPALGQRLGNLAGLGVALAAWTVYAVFFSPTQGWTFFFQLT
Ga0134125_1224319613300010371Terrestrial SoilMSQNVRQQVVNLGGLGIILLAWTFYAVYLSPTQGWTFFFQLTVNG
Ga0134126_1270486813300010396Terrestrial SoilVIATPKQRLGNLGGVGLALVAWALYAVYFSPTEGWVFFFQLTVNGII
Ga0126383_1145649323300010398Tropical Forest SoilVNATLSQQLRNLAGLGLGLVAFMFYAVYFSPTHGWVFFFQLTVNGIILGSIYALI
Ga0134122_1140834413300010400Terrestrial SoilVLGNLAGLGVLLAIWVVYAVYFSPTQGWTFFFQLTVNGI
Ga0138111_106134613300010896Grasslands SoilVIATRQRLGNFGGLGLALAAWVLYAVYFSPTEGWTFFLQLTVNGIILGSIYA
Ga0134023_102019923300012385Grasslands SoilVSSTPRQALGNLAGLGVLLVIWVVYAVYFSPTQGWTFFLQLTVNGII
Ga0134030_107612533300012387Grasslands SoilVSSTSRQALGNLAGLGVLLAIWVVYAVYFSPAQGWTFFLQLTVN
Ga0134040_100266113300012389Grasslands SoilVLGNLAGLGVLLAIWVFYAVYFSPTQGWTFFLQLTVGGIIL
Ga0134040_131023413300012389Grasslands SoilVIATRQQRLGNFAGLGLVLVAWVLYAVYASPTQGWTFFLQLT
Ga0134054_116291813300012390Grasslands SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSI
Ga0134043_114376313300012392Grasslands SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPAQGWTFFLQLTVNGIIL
Ga0134055_127985423300012401Grasslands SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYALIALGYSLV
Ga0134053_140916723300012406Grasslands SoilVSSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILSS
Ga0134045_143677023300012409Grasslands SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILS
Ga0150984_10126436813300012469Avena Fatua RhizosphereVSSTSRQALGNLAGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYALIA
Ga0157323_104054813300012495Arabidopsis RhizosphereVNPALSQQLRNLAGLGVGLVAFMFYAVYFSPTQGWVFFFQLTVNGII
Ga0157353_104693413300012496Unplanted SoilVGSTSRQVLGNLAGLGVLLAIWVVYAVYFSPAQVWTFFFQLTVNGII
Ga0157289_1012130313300012903SoilVDSALRQRLGNLTGLAVGLVAFMLYAVYLSPTQGWTFFLQLSVNGIILGSLYALIALGYTMVY
Ga0126375_1010367133300012948Tropical Forest SoilVDSTLRQRLGNLTGLAVGLVAFMLYAVYLSPTQGWTFFFQL
Ga0126375_1076675423300012948Tropical Forest SoilVDSTLKQRLGNLTGLAVGLVAFMLYAVYLSPTQGWTFFFQL
Ga0164303_1025561323300012957SoilVASTSRQVLGNLAGLGVLLAIWVVYAVYFSPAQGWTFFFQLTVNGIIL
Ga0164303_1069780723300012957SoilVNDDLRQRLGNLGGLAVALVAWTFYAVYFSPTEGWTFFLQLTVNG
Ga0164299_1015874213300012958SoilVNDDLRQRLGNLGGLGVALLVWTIYAVYFSPTQGWVFFFQLSVNGI
Ga0164301_1162497423300012960SoilVLGNLAGLGVLLAIWVVYAVYFSPAQGWTFFFQLTVNGIILDSIYALIA
Ga0164302_1068653123300012961SoilVLGNLAGLGVLLAIWVVYAVYFSPAQGWTFFFQLTV
Ga0134076_1013522623300012976Grasslands SoilVGSTSRQALGNLGGLGVLLAIWVVYAVYFSPTQGWTFFLQLTVNGIILGSIYALIALG
Ga0164306_1096643123300012988SoilVTTARRQRLGNLGGLAVVLVVWVVYAVYFSPQQGWTFFRQLTVNGI
Ga0157371_1012284513300013102Corn RhizosphereVNEDLRQRLGNLGGLAIALVAWTFYAVYFSPTHGWVFFFQLTVNGIILGSVYALIALGYSMV
Ga0157371_1136157823300013102Corn RhizosphereVNAALSQQLRNLAGLGLGLVAFMFYAVYFSPTEGWVFFFQLTVNGIILG
Ga0157370_1132331313300013104Corn RhizosphereVSPTSRQALGNLSGLGVLLAIWVVYAVYFSPAQGWTFFFQLTINGIILGSIY
Ga0157374_1112811913300013296Miscanthus RhizosphereVNASARQRLGNLGGLVLALGLWTLYAVYLSPTQGWTFFFQLTVNGI
Ga0157375_1016640933300013308Miscanthus RhizosphereVNASARQRLGNLGGLALALGLWTLYAVYLSPTQGWTFFLQLTVSGI
Ga0163163_1303305023300014325Switchgrass RhizosphereMSQNLRQQLVNLTGLGIALLGWTLYAVYLSPTQGWTFYFQLTVNGI
Ga0182008_1063973013300014497RhizosphereVNASARQRLGNLGGLALALGLWTLYSVYLSPTQGWTFFL
Ga0157376_1143142423300014969Miscanthus RhizosphereVNPALSQQLRNLAGLGVGLVAFMFYAVYFSPTQGWVFFFQLTVN
Ga0132255_10056165513300015374Arabidopsis RhizosphereVNPALSQQLRNLAGLGVGLVAFMLYAVYFSPTQGWVF
Ga0066655_1126921213300018431Grasslands SoilVSSTPRQALGNLAGLGVLLAIWVVYAVYFSPTQGWTFFLQLT
Ga0066667_1016013623300018433Grasslands SoilVIATRQRLGNFGGLGLALAAWVLYAVYFSPTEGWTFFLQLTVNGI
Ga0184643_114785733300019255Groundwater SedimentVSTTPRQALGNLAGLGVLLAAWVVYAVYFSPTQGWTFFLQLAVN
Ga0193719_1047247313300021344SoilVNPEFRQRLGNLSGLGVALIAWMFYAVYFSPTQGWTFFFQLSVNGIILGSIYALIALGYSMVY
Ga0182009_1071912613300021445SoilVSLTPRQALGNLAGLGVLLAIWVIYAVYFSPTQGWTFFLQLTVDGIILGSIYAL
Ga0222621_101476413300021510Groundwater SedimentVDAALRQRLGNLTGLAIALVAFMLYAVYLSPTQGWTFFFQLSVNGLILGSLYALIALGY
Ga0222623_1034168413300022694Groundwater SedimentVNAASSQRLGNLAGLGLALVAWMFYAVYFSPTEGWVFFFQLTV
Ga0247753_100118943300022892SoilVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQLTVNG
Ga0247672_109354423300024187SoilVTATSQQRLGNFAGFGVALLAWVFYAVYFSPTQGWTFFLQLTVNGIILGSI
Ga0207654_1012356023300025911Corn RhizosphereVNPALSQQLRNLAGLGVGLVAFMFYAVYFSPTQGWVFFF
Ga0207663_1122290413300025916Corn, Switchgrass And Miscanthus RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFFLQLTVN
Ga0207662_1007389733300025918Switchgrass RhizosphereVNDDLRQRLGNLGGLGVALLVWTIYAVYFSPTQGWTFFFQLTVNGIILGSVY
Ga0207694_1083442913300025924Corn RhizosphereMSQNVRQQVVNLGGLGIILLAWTFYAVYLSPTQGWTFFFQLTVNGIILGS
Ga0207700_1181886913300025928Corn, Switchgrass And Miscanthus RhizosphereMSSERLRTGVSDDLRQRLKNLGGLAVALIVWTFYAVYFSPTQGWTFFFQLTVNGIILGS
Ga0207664_1019294233300025929Agricultural SoilVNPALSQQLRNLAGLGVGLLAFMLYAVYFSPTQGWVFFFQLTVNGIILGSIYALIALGYS
Ga0207670_1071677623300025936Switchgrass RhizosphereVNDDLRQRLGNLGGLGVALLVWTIYAVYFSPTQGWVFFFQLSVNGIILGSVYALIALGYSMV
Ga0207679_1200981213300025945Corn RhizosphereVNASARQRLGNLGGLALALGLWTLYAVYLSPTQGWTFFLQLTVN
Ga0208415_101862413300025993Rice Paddy SoilVNEDLRQRLGNLGGLAIVLVAWMFYAVYFSPTQGWTFFLQLSV
Ga0207677_1119855413300026023Miscanthus RhizosphereVNPEFRQRLVNLSGLAVALILWMFYAVYFSPTQGWTFFLQLTVNGIILGSVYALIALGYS
Ga0208778_103239813300026025Rice Paddy SoilMTKNLRLQLANLAGLAAILAAWTIYAVYLSPTQGWTFYLQLTVNGII
Ga0207678_1028751623300026067Corn RhizosphereVNEDLRQRLGNLGGLAIALVAWTFYAVYFSPTHGWVFFFQLTVNGIILGSVYA
Ga0207708_1103368813300026075Corn, Switchgrass And Miscanthus RhizosphereMSQNVRQQVVNLGGLGIILLAWTFYAVYLSPTQGWTFF
Ga0207641_1207612913300026088Switchgrass RhizosphereVNASARQRLGNLGGLALALAAWTVYAVYFSPTQGWTFFLQLTVNGIILGSVYALIALGYS
Ga0207483_10419913300026750SoilVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQL
Ga0209966_104969913300027695Arabidopsis Thaliana RhizosphereVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGI
Ga0209813_1030745513300027866Populus EndosphereVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGIILGSLY
Ga0247683_101088113300027991SoilVNAALSQQLRNLAGLGLGLVAFMFYAVYFSPTEGWVFFFQLTV
Ga0247663_100535013300028145SoilVNPALSQQLRNLAGLGVGLVAFMFYAVYFSPTQGWVFF
Ga0307303_1007132013300028713SoilVTPALRQRLVNLGGLVVALAVWTLYAVYLSPTHGWTFFFQLS
Ga0307301_1000456613300028719SoilVNAASSQRLGNLAGLALALVAWMFYAVYFSPTEGWVFFFQLTVNGIILGSVYALIALG
Ga0307318_1001133043300028744SoilVNAASSQRLGNLAGLGLALVAWMFYAVYFSPTEGWVFFFQ
Ga0307316_1012023223300028755SoilVSDDFRQRLGNLGGLAIALVAWMLYAVYFSPTQGWTFFLQLSVNGII
Ga0307288_1016875613300028778SoilVNAASSQRLGNLAGLGLALVAWMFYAVYFSPTEGWVFFFQLTVNGIILGSVYA
Ga0307310_1040311813300028824SoilVTPALRQRLVNLGGLVVALAVWTLYAVYLSPTHGWTFFFQLSVNGII
Ga0307314_1030808723300028872SoilVNAASSQRLGNLAGLGLALVAWMFYAVYFSPTEGWVFLFQMT
Ga0307289_1046029823300028875SoilVSSATRQQVTSLWGLALLLAAWTVYAVYFSPTTGWTFFLQLTVNGIILGSIYALIALGYSMV
Ga0310904_1120362623300031854SoilVNPEFRQRLGNLSGLAVALILWMFYAVYFSPTQGWTFFFQLTVNGIILGSVYALIALGYS
Ga0310892_1109504923300031858SoilVNPVLSQQLRNLAGLGLGLVAFMFYAVYFSPTQGWVFFFQLTVNGII
Ga0310900_1075194613300031908SoilVNSVRGQQLGNLGGLALALVAFMFYAVYLSPTQGWTFFF
Ga0308176_1108540413300031996SoilVDAALRQRLGNLTGLAVGLVAFMFYAVYFSPTQGWTFFFQLSVNGIIL
Ga0310906_1016994023300032013SoilVNSVRGQQLGNLGGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGIILGSLYAL
Ga0307471_10177192723300032180Hardwood Forest SoilVSSATRQQLTNLWGLALLLAAWTVYAVYFSPTTGWTFFLQLTVNGIILGSIYALIAL
Ga0307471_10223773413300032180Hardwood Forest SoilVSPTPRQALGNLAGLGVLLVIWVIYAVYFSPSQGL
Ga0310810_1025268913300033412SoilVNSTLGQRLGNLSGLALALVAFMFYAVYLSPTQGWTFFFQLTVNGIILGS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.