NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050490

Metagenome / Metatranscriptome Family F050490

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050490
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 62 residues
Representative Sequence MLSSINFWMCFAGLIYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFR
Number of Associated Samples 130
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.00 %
% of genes near scaffold ends (potentially truncated) 98.62 %
% of genes from short scaffolds (< 2000 bps) 88.97 %
Associated GOLD sequencing projects 123
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.552 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(12.414 % of family members)
Environment Ontology (ENVO) Unclassified
(20.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.655 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 56.98%    β-sheet: 0.00%    Coil/Unstructured: 43.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF04397LytTR 4.83
PF00155Aminotran_1_2 4.83
PF03781FGE-sulfatase 2.76
PF13701DDE_Tnp_1_4 2.76
PF07484Collar 2.07
PF02735Ku 2.07
PF08530PepX_C 2.07
PF07582Obsolete Pfam Family 1.38
PF07883Cupin_2 1.38
PF10150RNase_E_G 1.38
PF13906AA_permease_C 1.38
PF03403PAF-AH_p_II 1.38
PF02673BacA 0.69
PF13419HAD_2 0.69
PF00563EAL 0.69
PF01467CTP_transf_like 0.69
PF13460NAD_binding_10 0.69
PF06751EutB 0.69
PF02517Rce1-like 0.69
PF13450NAD_binding_8 0.69
PF13520AA_permease_2 0.69
PF00069Pkinase 0.69
PF01862PvlArgDC 0.69
PF02687FtsX 0.69
PF12893Lumazine_bd_2 0.69
PF00986DNA_gyraseB_C 0.69
PF13231PMT_2 0.69
PF11695DUF3291 0.69
PF00264Tyrosinase 0.69
PF03668ATP_bind_2 0.69
PF00392GntR 0.69
PF07238PilZ 0.69
PF06718DUF1203 0.69
PF04368DUF507 0.69
PF01522Polysacc_deac_1 0.69
PF01738DLH 0.69
PF02424ApbE 0.69
PF00903Glyoxalase 0.69
PF05598DUF772 0.69
PF02239Cytochrom_D1 0.69
PF00583Acetyltransf_1 0.69
PF03551PadR 0.69
PF00092VWA 0.69
PF00873ACR_tran 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.76
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 2.76
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 2.07
COG2936Predicted acyl esteraseGeneral function prediction only [R] 2.07
COG4188Predicted dienelactone hydrolaseGeneral function prediction only [R] 1.38
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.69
COG0187DNA gyrase/topoisomerase IV, subunit BReplication, recombination and repair [L] 0.69
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.69
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.69
COG4303Ethanolamine ammonia-lyase, large subunitAmino acid transport and metabolism [E] 0.69
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.69
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.69
COG1968Undecaprenyl pyrophosphate phosphataseLipid transport and metabolism [I] 0.69
COG1945Pyruvoyl-dependent arginine decarboxylaseAmino acid transport and metabolism [E] 0.69
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 0.69
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.69
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.69
COG1660RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domainSignal transduction mechanisms [T] 0.69
COG1477FAD:protein FMN transferase ApbEPosttranslational modification, protein turnover, chaperones [O] 0.69
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.69
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.55 %
UnclassifiedrootN/A3.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_101593916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1526Open in IMG/M
3300000955|JGI1027J12803_100203624All Organisms → cellular organisms → Bacteria3412Open in IMG/M
3300002245|JGIcombinedJ26739_100283720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1541Open in IMG/M
3300004080|Ga0062385_11295107All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella502Open in IMG/M
3300004092|Ga0062389_103370779All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae599Open in IMG/M
3300004152|Ga0062386_100643946All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae868Open in IMG/M
3300005180|Ga0066685_10460086All Organisms → cellular organisms → Bacteria883Open in IMG/M
3300005468|Ga0070707_100280789All Organisms → cellular organisms → Bacteria1618Open in IMG/M
3300005541|Ga0070733_10979394All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005591|Ga0070761_10428681All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300005591|Ga0070761_11035342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3521Open in IMG/M
3300005712|Ga0070764_10777021All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3594Open in IMG/M
3300006046|Ga0066652_101206657All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3716Open in IMG/M
3300006052|Ga0075029_101298390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis511Open in IMG/M
3300006059|Ga0075017_100031641All Organisms → cellular organisms → Bacteria3489Open in IMG/M
3300006086|Ga0075019_10124832All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300006162|Ga0075030_101434422All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300006176|Ga0070765_102097386All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3528Open in IMG/M
3300006642|Ga0075521_10334247All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300009522|Ga0116218_1252345All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3792Open in IMG/M
3300009645|Ga0116106_1117089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3858Open in IMG/M
3300009824|Ga0116219_10062941All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32186Open in IMG/M
3300011269|Ga0137392_10060908All Organisms → cellular organisms → Bacteria2872Open in IMG/M
3300011269|Ga0137392_11480129All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3538Open in IMG/M
3300012205|Ga0137362_11694288All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3519Open in IMG/M
3300012351|Ga0137386_11100426All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium561Open in IMG/M
3300012356|Ga0137371_10375975All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300012356|Ga0137371_10778634All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300012930|Ga0137407_11861162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300012957|Ga0164303_10401230All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300012985|Ga0164308_11054423All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3726Open in IMG/M
3300012986|Ga0164304_10647775All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter795Open in IMG/M
3300012987|Ga0164307_10425644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae985Open in IMG/M
3300012988|Ga0164306_11137451Not Available651Open in IMG/M
3300014164|Ga0181532_10280418All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa dinghuensis949Open in IMG/M
3300014168|Ga0181534_10510253All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3681Open in IMG/M
3300014199|Ga0181535_10782906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3541Open in IMG/M
3300014495|Ga0182015_10046552All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3201Open in IMG/M
3300014839|Ga0182027_10791344All Organisms → cellular organisms → Bacteria → Acidobacteria993Open in IMG/M
3300014969|Ga0157376_10249344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1657Open in IMG/M
3300015053|Ga0137405_1244963All Organisms → cellular organisms → Bacteria857Open in IMG/M
3300015206|Ga0167644_1105005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae827Open in IMG/M
3300015264|Ga0137403_11256688All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3586Open in IMG/M
3300017938|Ga0187854_10396426All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83579Open in IMG/M
3300017940|Ga0187853_10041527All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2395Open in IMG/M
3300017941|Ga0187850_10543009All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3501Open in IMG/M
3300018004|Ga0187865_1086784All Organisms → cellular organisms → Bacteria → Acidobacteria1169Open in IMG/M
3300018008|Ga0187888_1201183All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300018021|Ga0187882_1059228All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1770Open in IMG/M
3300018023|Ga0187889_10270741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3759Open in IMG/M
3300018028|Ga0184608_10094953All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1239Open in IMG/M
3300018034|Ga0187863_10715468All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3566Open in IMG/M
3300018042|Ga0187871_10070002All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300018043|Ga0187887_10837220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii544Open in IMG/M
3300018044|Ga0187890_10262294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345972Open in IMG/M
3300018044|Ga0187890_10786059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3539Open in IMG/M
3300019082|Ga0187852_1206459All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium809Open in IMG/M
3300019890|Ga0193728_1164440All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3964Open in IMG/M
3300020001|Ga0193731_1019591All Organisms → cellular organisms → Bacteria1765Open in IMG/M
3300020006|Ga0193735_1070660All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31009Open in IMG/M
3300020010|Ga0193749_1008921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1944Open in IMG/M
3300020062|Ga0193724_1077260All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3692Open in IMG/M
3300020581|Ga0210399_10581470All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300021046|Ga0215015_10750737All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola823Open in IMG/M
3300021168|Ga0210406_11035930All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3608Open in IMG/M
3300021405|Ga0210387_11344266All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3616Open in IMG/M
3300021405|Ga0210387_11384972All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3605Open in IMG/M
3300021407|Ga0210383_11250855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3622Open in IMG/M
3300021420|Ga0210394_11019700All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300021432|Ga0210384_10348532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1334Open in IMG/M
3300021432|Ga0210384_10997628All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3739Open in IMG/M
3300021432|Ga0210384_11727218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3531Open in IMG/M
3300021474|Ga0210390_11259566Not Available595Open in IMG/M
3300021478|Ga0210402_11748717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3548Open in IMG/M
3300021479|Ga0210410_10009860All Organisms → cellular organisms → Bacteria8242Open in IMG/M
3300021479|Ga0210410_11786820All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3509Open in IMG/M
3300022557|Ga0212123_10424666All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300023068|Ga0224554_1018874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2161Open in IMG/M
3300023259|Ga0224551_1006138All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2004Open in IMG/M
3300025482|Ga0208715_1035889All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3925Open in IMG/M
3300025922|Ga0207646_10438249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1179Open in IMG/M
3300025928|Ga0207700_10745554All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3875Open in IMG/M
3300025939|Ga0207665_11657341All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300026035|Ga0207703_11859383All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300026088|Ga0207641_12175898All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300026692|Ga0207725_101394Not Available1170Open in IMG/M
3300027104|Ga0208095_1018365All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3506Open in IMG/M
3300027565|Ga0209219_1005036All Organisms → cellular organisms → Bacteria → Acidobacteria2829Open in IMG/M
3300027570|Ga0208043_1078176All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3920Open in IMG/M
3300027576|Ga0209003_1057873All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300027619|Ga0209330_1103812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3645Open in IMG/M
3300027727|Ga0209328_10088717All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300027824|Ga0209040_10448245All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3588Open in IMG/M
3300027825|Ga0209039_10300930All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300027853|Ga0209274_10431978All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3681Open in IMG/M
3300027854|Ga0209517_10086328All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32159Open in IMG/M
3300027855|Ga0209693_10250890All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300028047|Ga0209526_10491498All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300028047|Ga0209526_10491866All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa ligni801Open in IMG/M
3300028087|Ga0255354_1062752All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300028560|Ga0302144_10034701All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1620Open in IMG/M
3300028565|Ga0302145_10025479All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32154Open in IMG/M
3300028565|Ga0302145_10313766All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300028748|Ga0302156_10231637All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella853Open in IMG/M
3300028748|Ga0302156_10345865All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3657Open in IMG/M
3300028762|Ga0302202_10124089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella1432Open in IMG/M
3300028859|Ga0302265_1029874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31992Open in IMG/M
3300028867|Ga0302146_10040491All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA32038Open in IMG/M
3300029636|Ga0222749_10809079All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3512Open in IMG/M
3300029882|Ga0311368_10601899All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300029914|Ga0311359_10040360All Organisms → cellular organisms → Bacteria5131Open in IMG/M
3300029916|Ga0302148_1068025All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1014Open in IMG/M
3300029945|Ga0311330_11001995All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3617Open in IMG/M
3300029951|Ga0311371_11738959All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3678Open in IMG/M
3300029955|Ga0311342_10333257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681357Open in IMG/M
3300029988|Ga0302190_10072248All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31609Open in IMG/M
3300029999|Ga0311339_10615818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB601078Open in IMG/M
3300030002|Ga0311350_10432512Not Available1180Open in IMG/M
3300030007|Ga0311338_10328370All Organisms → cellular organisms → Bacteria1675Open in IMG/M
3300030044|Ga0302281_10122697All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31169Open in IMG/M
3300030051|Ga0302195_10063642All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300030058|Ga0302179_10308175All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60697Open in IMG/M
3300030225|Ga0302196_10063559All Organisms → cellular organisms → Bacteria2313Open in IMG/M
3300030399|Ga0311353_10434035All Organisms → cellular organisms → Bacteria1176Open in IMG/M
3300030506|Ga0302194_10085041All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terracidiphilus → Terracidiphilus gabretensis1440Open in IMG/M
3300030509|Ga0302183_10249088All Organisms → cellular organisms → Bacteria → Acidobacteria690Open in IMG/M
3300030518|Ga0302275_10329283All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068826Open in IMG/M
3300030617|Ga0311356_10321357All Organisms → cellular organisms → Bacteria → Acidobacteria1546Open in IMG/M
3300030646|Ga0302316_10371720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3575Open in IMG/M
3300030862|Ga0265753_1076475All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300031128|Ga0170823_13884133All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3610Open in IMG/M
3300031231|Ga0170824_104100341Not Available661Open in IMG/M
3300031259|Ga0302187_10118897All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31477Open in IMG/M
3300031474|Ga0170818_105266178All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300031474|Ga0170818_110323185All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3605Open in IMG/M
3300031708|Ga0310686_110961250All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300031718|Ga0307474_11389472All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae553Open in IMG/M
3300031718|Ga0307474_11547357All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3521Open in IMG/M
3300031720|Ga0307469_11491126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium647Open in IMG/M
3300032180|Ga0307471_101404502All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300032180|Ga0307471_103533978All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Silvibacterium → Silvibacterium bohemicum553Open in IMG/M
3300032782|Ga0335082_10963908All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3717Open in IMG/M
3300032782|Ga0335082_11027437All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300032892|Ga0335081_12327736All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3559Open in IMG/M
3300033480|Ga0316620_10202234All Organisms → cellular organisms → Bacteria1657Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog12.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.66%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland8.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.21%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.21%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.52%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.14%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.45%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.76%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.76%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.76%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.07%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.07%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.38%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.69%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.69%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.69%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.69%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.69%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.69%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015053Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020062Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300025482Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026692Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes)EnvironmentalOpen in IMG/M
3300027104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027576Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028087Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T50EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028748Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028859Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029916Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_1EnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029988Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030506Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1EnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030518Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030862Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031259Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033480Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_BEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10159391613300000364SoilMLSSTNFLMGFAGLIYLVAGVFIRRKEISAACGWDKLITLGCVFIAVSLAVFAPEHFHGGPTYIQDMAPSWMPARWFWPYFV
JGI1027J12803_10020362413300000955SoilMGLAGLVYLFAGVFILRKDINAARGWDKLIALGCVFIAVSLAVFAPEHFHGGPAYIQNMAPSWMPARWFWPYFVGC
JGIcombinedJ26739_10028372043300002245Forest SoilMSLPQHLREEVLMLSSVNFWMCFAGLIYLVAGVFILRKEVSAARGWDKFITLGCIFIAVPLA
Ga0062385_1129510713300004080Bog Forest SoilMLSSINFWMCFAGLIYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFR
Ga0062389_10337077913300004092Bog Forest SoilMISSINFWMCFAGLVYLVAGVSIQRKEISAARGWDRLIVWGCIFIAVSLAVFAPEHFGGPMRVSDM
Ga0062386_10064394623300004152Bog Forest SoilMCFAGLIYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEH
Ga0066685_1046008623300005180SoilMLSSTNFLMGFAGLIYLVAGVFIRRKEISAIRGWDKLITLGCVFIAVSLAVFAPEHFHGGPTYIQNMAPSWMPARHRCNASAFAS
Ga0070707_10028078913300005468Corn, Switchgrass And Miscanthus RhizosphereMLPLTNFWMGFVGLIYLVAGVFVLRKEISAAQGWDKLITLGCVFFAVPLAVFAPEHFHGGPSYIQDMAPSWMP
Ga0070733_1097939413300005541Surface SoilMLSSANFWMCFAGLIYLVAGVFILRKDFGAARGWDKLISLACVFIAVPLAVFAPEHFRGPEFVQNMVPSWMPG
Ga0070761_1042868113300005591SoilMLSSVNFWKCLAGLVYLVAGVLILRKDIRSARGWDKLIALGYIFIAVPLAVFAPEHFGGPMGVPDMV
Ga0070761_1103534213300005591SoilMLSSINFWMCFAGLIYLLAGVTIQRQEIASAHGWDKLISWGPIFIAVSLAVFAPEHFGGPMRVA
Ga0070764_1077702123300005712SoilMLSSANFWMCLAGLVYLVAGVWILRKEIRAAQGWDKLITLGSVFIAVPLAVFAPEHFRGPEFVQN
Ga0066652_10120665723300006046SoilMCFAGLIYLVAGVFILRREISAARGWDKLIALGCVFFAVPLAAFAPEHFYGGPVPLEESELPF*
Ga0075029_10129839013300006052WatershedsMLSSTNFWMCFAGLIYLVAGVFILQKEIRAARGWDKLITLGCVFIAVPLAVFAPEHFRGPEFV
Ga0075017_10003164113300006059WatershedsMLSATNFWMGFAGLAYLVAGVFILRKEIRAARGWDKLITLGPVFIAVPLAVFAPEHFRGPQFVQNMVPSWMPAHWFWPY
Ga0075019_1012483213300006086WatershedsMVLMLSSTNYWMGLAGLVYLFAGVFILRKEIRAARGWDKLITLGCVFIA
Ga0075030_10143442223300006162WatershedsMLSSTNYWMGFAGLTYLVAGVFILRKEISGTRGWDKLITLGSVFIAVSLAVFAPEHFHG
Ga0070765_10209738613300006176SoilMLSSANFWMCLAGLVYLVAGVWILRKEIGAARGWEKLITLGCIFIAVPLAVFAPEHFR
Ga0075521_1033424723300006642Arctic Peat SoilMLAPTNFWMGFAGLVFLVAGVFVLRKEILGARGWDRFILLGTVFVAASLATFAPEHFRGPEFVQMV
Ga0116218_125234523300009522Peatlands SoilMLSSTNFWMCFAGLIYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFRGPKFIQSMVPSWMPAHWFWP
Ga0116106_111708923300009645PeatlandMLSSINFWMCLAGLIYLVAGVLILRNEIGAARGWDKLIIWGPIFIAVSLAVFAPEHFGGPMRVSDMVP
Ga0116219_1006294133300009824Peatlands SoilMLSSINFWMCFAGLIYLVAGVFILRKEIGAARGWDKLITLGSVFIAV
Ga0137392_1006090853300011269Vadose Zone SoilMLSSTNFWMSFAGLVYLVAGVFILRKEIGVARGWDKLITLGCVFIAVPLAVFAPEHFHGGPEFIQNMAPSWM
Ga0137392_1148012923300011269Vadose Zone SoilMLSSTNFWMCFAGLIYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFRGPEFVQNMVPSWMPGPHWPW
Ga0137362_1169428813300012205Vadose Zone SoilMLSSTNFWMCFAGLIYLGAGVFVLRKEVSAARGWDKLIALGCVFFAAPLAAFAPEHFYGGPEYIQHMAPAWMPVRWF
Ga0137386_1110042613300012351Vadose Zone SoilMTSTNFWMSFAGLIYLVAGIFIFRKEIGAAHAWDKLITLGPVFFAVSLAVFAPEHFHGGPAYIQAMAPWWMPARW
Ga0137371_1037597533300012356Vadose Zone SoilMTSTNFWMGFAGLIYLVAGVFILRKEISPDRGWDKLITLGPVFFAVSLAVFAPE
Ga0137371_1077863423300012356Vadose Zone SoilMCFAGLIYLVAGVFILRREISAARGWYQLITLGPVFFAVALAVFTPEHFHGGPA
Ga0137407_1186116223300012930Vadose Zone SoilMLSSTNFWMCLAGLVYLFAGVFILRKEISAARGWDKLITLGPVFIAVSLAVF
Ga0164303_1040123013300012957SoilMLSSTNYWMGVAGLAYLFAGVFILRKDISAARGWDKLITLGCVFIAVSLAVFAPEHFHGGPTYIQDMAPPWMPVRW
Ga0164308_1105442323300012985SoilMLSSPNFWMSFAGLVYFVAGVFILRKEIGAARGWDKLITLAPVFIAVSLAVFAPEHFRGPQFVQNMVPR
Ga0164304_1064777513300012986SoilMLSSTNFWMGFAGLIYLFAGVVLHRKEIGARDSDRLITLSCIFIAVSLAIFAPEHFGGPDFVRNM
Ga0164307_1042564423300012987SoilMLTSTNFWMGLAGLVYFVAGIFILRKEISAARGWDKLITLGPVFIAVPLAVFAPEHFRGPEFVQSMVPRWMPGPHWFWA
Ga0164306_1113745123300012988SoilMLSSTNFWMGFAWLIYRFARVVLHRKEIGARDSDRLITLSCIFIAVSLAIFAPEHFG
Ga0181532_1028041813300014164BogMCLAGLLVLVPGVVIHRPEIGAAHGWDKLIAMGSLFIAVSLAAFAPEH
Ga0181534_1051025313300014168BogMCLAGLIYLVAGVLVFRKDIASARGWDKLISLGSIFIAVSLAVFAPEHFG
Ga0181535_1078290613300014199BogMLSSINFWMCLAGSIYLFAGIFTFRKEVSAARGWDKLISLDCLFIAVSLAVFAPEHFG
Ga0182015_1004655243300014495PalsaMLSVTNFWIWFAGLIYLAAGVFILRKDLSAARGWDKLIALGCVFIAASLAAFAPEHFHGPEFVQQMVPSWMPAR
Ga0182027_1079134413300014839FenMLSSTNFWMCFAGLIYLVAGVFILRKEVSAVPGWDKLITLGCIFIAVPLAVFAPEHFGGP
Ga0157376_1024934433300014969Miscanthus RhizosphereMLSSTNYWMIFAGLLYLVAGVFVFRKEISAARGWDKFIGLGGVFIAVS
Ga0137405_124496313300015053Vadose Zone SoilMLSSTNFWMGFAGLIYLVAGVFVLRKEISGARGWDKLITLGCVFIAVPLAVFAPEHFRGPEFVQNMVPSWMPA
Ga0167644_110500523300015206Glacier Forefield SoilMGFAGLIYLVAGVLIVRKEIGAARGWDRLIIFGPLFIAVPLAIFAPEHFRGPEFVQAMVPSYMPVRPY
Ga0137403_1125668813300015264Vadose Zone SoilMLSSTNFWMCFAGLIYLVAGVFILRKEISAARGWDKLIALGSVFFAVPLAAFAPE
Ga0187854_1039642613300017938PeatlandMLSSINFWMCLAGLIYLVAGVLILRNEIGAARGWDKLIIWGPIFIAVSLAVFAPEHFGGPMRVSDMVPSWMPAHV
Ga0187853_1004152733300017940PeatlandMLSSTNFWMCFAGLIYLVVGVFILRKEVSAVPGWDKLITLGCIFIAVPLAVFAPEHFGGPMG
Ga0187850_1054300923300017941PeatlandMLSSINFWMCLAGLIYLVAGVLILRNEIGAARGWDKLIIWGPIFIAVSLAVFAPEHFGGPMRVSDMVPSWMPAH
Ga0187865_108678413300018004PeatlandMCLAGLIYLVAGVLILRNEIGAARGWDKLIIWGPIFIAVSLAVFAPEHFGGPMRVSDM
Ga0187888_120118313300018008PeatlandMCFAGLIYLVVGVFILRKEVSAVPGWDKLITLGCIFIAVPLA
Ga0187882_105922813300018021PeatlandMLSSTNFWMCFAGLIYLVVGVFILRKEVSAVPGWDKLITLGCIFIAVPLAV
Ga0187889_1027074113300018023PeatlandMLSSINFWMCLAGLIYLVAGVLILRNEIGAARGWDKLIIWGPIFIAVSLAVFAPEHFGGP
Ga0184608_1009495353300018028Groundwater SedimentMLSSTNFWMCFAGLIYLAAGLFILRKEINAAHGWDKLITLGSVFFAAPLATFA
Ga0187863_1071546813300018034PeatlandMLSSVNFWMCFAGLIYLVAGVLILRTEISAACGWDKLITLGCVFIAVPLAVFAPEHFGGPMGVPDMIPSWMPA
Ga0187871_1007000213300018042PeatlandMLSSVNFWMCFAGLIYFVAGVFTFRQEISAARGWDKLIAMGCMFIAVPLAVFAPEHFGGPMGVPDM
Ga0187887_1083722023300018043PeatlandMLSSINFWMCLAGLVYLVAGVFVFRKEFGVARGWDKLIALGCMFIAVSLAVFAPEHFGGP
Ga0187890_1026229423300018044PeatlandMCFAGLIYLVAGVFIQRQEIGAARGWDRLIALGPIFIAVSLAVFAPEHFGG
Ga0187890_1078605913300018044PeatlandMLSSVNFWMCFAGLISLVAGVFILRKEISAARGWDKLITLGCIFIAVPLAVFAPEHF
Ga0187852_120645913300019082PeatlandMCFAGLIYLVVGVFILRKEVSAVRGWDKLITLGCIFIAVPLAVFAPEHFGSPMGVPDMVPSW
Ga0193728_116444013300019890SoilMLSSVTFWMCFAGLIYLVAGVFILRKEISAAPGWDKLITLGCIFIAVPLAVFAPEHF
Ga0193731_101959113300020001SoilMCFAGLIYLGAGVFVRRKEISAARGWDKLIALGCVFFAAPLAAFAPEHFYGGPEYIQNMAPAW
Ga0193735_107066013300020006SoilMLSSTNFWMCFAGLIYLGAGVFVRRKEISAARGWDKLIALGCVFFAAPLAAFAPEHFYGGPEYIQHMAPAWMPVCSFWP
Ga0193749_100892133300020010SoilMLLSTNFWMCLAGLIYLFAGVFILRKEITAARGWDKLIALGPVFFAVSLA
Ga0193724_107726033300020062SoilMLSSTNFWMCFAGLIYLGAGVFVLRKEISAARGWDKLIALGCVFFAAPLAAFAPEHFYGGPEYIQNMA
Ga0210399_1058147023300020581SoilMLSSTNFWMCFAGLIYLVAGVFILRNEISAARGWDKLITLGCVFIAVPLAVFAPE
Ga0215015_1075073723300021046SoilMLSSTNFWMCFAGLIYLVAGVLLLRKEISVARGWDKLITLGGVFIAVPLLALIHI
Ga0210406_1103593013300021168SoilMLSSTNFLMGFAGLIYLVAGVFIRRKEISTARGWDKLITLGCVFIAVSLAVFAPEHFHGGPTYIQHMAPAWM
Ga0210387_1134426613300021405SoilMLSSANFWMCFAGLVYLVAGVWILRKEIGAARGWEKLITLGCIFIAVPLAVFAPEHFRGPEFVQNMVPSWMPAHL
Ga0210387_1138497213300021405SoilMLSSTNFGMCFAGLLYLVAGVYLLRKELSAARGWEKLIALGSVFIAASLAAFAPEHFHGPEFVRNMVPS
Ga0210383_1125085513300021407SoilMLSSANVWMSVAGLVYLVAGVFILRKEIGAARGFDKLITLASVFIAVPLAVFAPEHFRGPEFVQNMVPSYMPAHVF
Ga0210394_1101970023300021420SoilMLSSVTFWMCLAGLIYLVAGVFILRKEIGAAPGWDKLITLGCIFIAVPLAVFAPEHFGGPMRVPEMV
Ga0210384_1034853213300021432SoilMLSSTNFLMGFAGLIYFVAGVLILRKEISAARGWDKLITLGCVFIAVPLAVFAPQHFHGGPSYIQNMA
Ga0210384_1099762823300021432SoilMPAATNFWMCLAGLIYLFAGVFILGKEISAARGLDKLVTLGSVFIAASLAIFAPEHFGGRGPDYIQTMAPPWMP
Ga0210384_1172721813300021432SoilMLSSTNFWMCFAGLIYLVGGVFILRKEISAARGWDKLITLGCVFFAVPLAVFAIEHFRGARFMQN
Ga0210390_1125956613300021474SoilMLSSTNLWMGLAGLGYFAAGVFVSRKEIAAARGAGMRLDKLIALACTFIAVPLAIFAP
Ga0210402_1174871723300021478SoilMLSSANLWMSSAGLLYLVVGVFLLRKEMSAARGWDKLIILGCVFYAVPLAIFAPEHFRGPEFV
Ga0210410_10009860113300021479SoilMPASTNFWMVLAGLVYLVVGFFILRKQLGTSRGWDKLIVLGALFIGVSLATFAPEHFANRGPAYIQTM
Ga0210410_1178682023300021479SoilMLSSANVWMSVAGLVYLVAGVFILRKEIGAARGFDKLITLASVFIAVPL
Ga0212123_1042466613300022557Iron-Sulfur Acid SpringMLSSTNFWMCFAGLIYLVAGVLILRKVISAARGWDKLITLGGVFIAV
Ga0224554_101887433300023068SoilMSFVGLVYLVAGVFVLRKEIGAARGWDRLIVLGGVFIAVSLAVFAPEHFRGPE
Ga0224551_100613843300023259SoilMLSSVNFWMCFAGLIYLVAGVFILRKEISAARGWDKLITLGCIFIAVPLAVFAPEHFGGPMGVPDMVPSWMPAHLFL
Ga0208715_103588933300025482Arctic Peat SoilMLSSTNFWMCFAGLIYLVAGVFILRKGIAAARGWDKLITLDGVFLAAPLAVFAAEHF
Ga0207646_1043824913300025922Corn, Switchgrass And Miscanthus RhizosphereMLSSTNFWMSFAGLVYLVAGVFILRKEIGVARGWDKLITLGCVFIAVPLAAF
Ga0207700_1074555413300025928Corn, Switchgrass And Miscanthus RhizosphereMLSSPNFWMCFAGLGYFVAGVFILRKELGAARGWDKLITLAPVFIAVSLAVF
Ga0207665_1165734123300025939Corn, Switchgrass And Miscanthus RhizosphereMLSSTNFWMGFAGLIYLFAGVVLHRKEIGARDSDSLITLSCIFIAVSLAIFA
Ga0207703_1185938313300026035Switchgrass RhizosphereMLSSTNFWMGFAGLIYLFAGVVLHRKEIGARDSDRLITLSCIFIAVSLAIFAPEHFGGPDFVRNMVPS
Ga0207641_1217589823300026088Switchgrass RhizosphereMLSSTNFWMGFAGLIYLFAGVVLHRKEIGARDSDRLITLSCIFIAVSLAIFAPEHFGGPDFVRNMVSSYM
Ga0207725_10139413300026692Tropical Forest SoilMSLAGLLYLVAGVFILRKELSAARGWDKLILLASVFIAVPLATFAPEHFR
Ga0208095_101836513300027104Forest SoilVGRTTRRKKVLMLSSTNFWMGVAGLIYLVAGVFILRKEISAARGWDKLITLSPVFIAVSLAVFAPEHFRGPEFVQSMVPR
Ga0209219_100503613300027565Forest SoilVFSSTNFWMCFAGLVYLVAGVVVARKELSAARSWDKLISLGCVFIATSLAMFA
Ga0208043_107817613300027570Peatlands SoilMLSSINFWMCFAGLIYLVAGVFILRKEIGAARGWDKLITLGSVFIAVPLAVFAPEH
Ga0209003_105787323300027576Forest SoilMLSSTNFWMCVAGLVYLAVGIFVLRKEINAVAGWDKLITLGCVFFAVPLAM
Ga0209330_110381223300027619Forest SoilMCFAGVIYLVSGVFILRKDFSAARGWDKLISLGCIFIAVPLAVFATEHFCEARSM
Ga0209328_1008871713300027727Forest SoilMLSSTNFLMGFAGLIYFVAGVFILRKEISAARGWDKLITLGSVFVAIPLAVFGTDHF
Ga0209040_1044824513300027824Bog Forest SoilMLSSTNFWMCFAGLVYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFRGPEF
Ga0209039_1030093023300027825Bog Forest SoilMLSSTNFWMSLAGLIYLVAGVFILRKEISAARGWDKLILLGGVFIAVPLAVFAPEHFHGPEFVQQM
Ga0209274_1043197813300027853SoilMLSSVNFWKCLAGLVYLVAGVLILRKDIRSARGWDKLIALGYIFIAVPLAVFAPEHFGGPMGVPDMVPSWI
Ga0209517_1008632813300027854Peatlands SoilMLSSINFWMCFAGLIYLVAGVFILRKEIGAARGWDKLITLGSVFIAVPLAVFAPEHFGGPMGVPD
Ga0209693_1025089013300027855SoilMLSSTNFWMCLAGLIYLAVGVFVIRKEISAARGWEKLITLGCVFFAVPLAVFAPEHFRRPEFVKN
Ga0209526_1049149823300028047Forest SoilMLSSTNFWMCFVGLIYLVAGVFILRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFRGP
Ga0209526_1049186613300028047Forest SoilMLSSTNFWMCFAGLIYLVAGVFTLRKEISAARGWDKLITLGCVFIAVPLAVFAPEHFRGP
Ga0255354_106275223300028087SoilMLSSPDFWMSFVGLVYLVAGVFVLRKEIGAARGWDRLIVLGGVFIAVSLAVFAPEHFRG
Ga0302144_1003470133300028560BogMLSSANFWMCATGLIYLAAGVFILRKEISAARGWDKLILLDCVFIAVPLAVFATEHFGSA
Ga0302145_1002547923300028565BogMLSSINFWMCFAGLVYLVAGAFIFRKEIVAARGWDRLIALASIFIAVSLAVFAPEHFGGPMHVSEAVPSWPNFRS
Ga0302145_1031376613300028565BogMQPSINFWMCFAGLIYLIFGVFLFRKDIGAARGWDKLIVLNGIWIAVSLAVFAP
Ga0302156_1023163723300028748BogMLSSINFWMCFAGLIYLVAGAFVFRKEIVAARGWDRLIALASIFIAVSLAVFAPEHFGGPMHVSD
Ga0302156_1034586523300028748BogMQPSINFWMCFAGLIYLIFGVFLFRKDIGAARGWDKLIVLNGIWIAVSLAVF
Ga0302202_1012408923300028762BogMLSSINFWMCFAGLIYLVAGALIFRKEIVASRGWDRLIALASIFIAVSLAVFAPEHFGG
Ga0302265_102987413300028859BogMLSSINFWMCFAGLVYLVAGAFIFRKEIVAARGWDRLIALASIFIAVSLAVFAPEHFGGPMHVSEAVPSWPNFRSLDCSVT
Ga0302146_1004049123300028867BogMLSSINFWMCFAGLVYLVAGAFIFRKEIVAARGWDRLIALASIFIAVSLAVFAPEHFGGPMHVSEAVPSWMPAHLFW
Ga0222749_1080907913300029636SoilMLSSTNFWMCFAGLIYLVAGVFILRKETSAARGWDKLITLGCVFIAVPLAVFAIEHFRGARSMQNMVPSWMPAHLFL
Ga0311368_1060189923300029882PalsaMLSSVNFWMCFAGLVYLVAGVFILRKEISAARGWDKLITLGCIFIAV
Ga0311359_1004036013300029914BogMLSSINFWMCLAGLVYLVAGVFVFRKEFGVARGWDKLIALGCMFIAVSLAVFAPEHFGGPMQVADMVP
Ga0302148_106802513300029916BogMCLAGLVYLAAGAFTFRKEIGAARAWDKLITLGPIFMAVSLAAFAPEHFRGPEFVQNMVPSYMPARPYWAYF
Ga0311330_1100199523300029945BogMLSSPDFWMSFVGLVYLVAGVFVLRKEIGAARGWDRLIVLGGVFIAVSLAVFAPEHFRGPEFVQNMVPSFMP
Ga0311371_1173895913300029951PalsaMLSSVNFWMCFAGLVYLVAGVFILRKQISAARGWDKLITLGCIFIAVPLAVFAPEHFGGPMGVPEMVPSWMPAHLFWA
Ga0311342_1033325733300029955BogMLSSTNFWMCFAGLLYLAAGVFILRKEIGTARGWEKLIPLNCVFIAVPLAVF
Ga0302190_1007224813300029988BogMLSSINFWMCFAGLVYLVAGAFIFRKEIVAARGWDRLIALASIFIAVSLAVFAPEHFGGPMHVSEAVPS
Ga0311339_1061581813300029999PalsaMPGTVKETWVPMLSSINFWMCFAGLIYLVAGVFILRKEIGAARGWDRLITLCCIFIAVSLAVFAPEHF
Ga0311350_1043251233300030002FenMCLVGLLYLAAGVFVLRKEISAARGWDKLITFATVFIAVPLAVFAPEHFRGPEFVGSMVP
Ga0311338_1032837013300030007PalsaMGLAGLVYLVAGVLIYRKEIRAARGWDKLIALNCVFIAVSLAVFAPEHFQGPDFVKNMVPSWMPGGAFW
Ga0302281_1012269723300030044FenMLSSANFWMCATGLIYLAAGVFILRKEISAARGWDKLILLDCVFIAVPLAVFA
Ga0302195_1006364213300030051BogMQPSINFWMCFAGLIYLIFGVFLFRKDIGAARGWDKLIVLNGIWIAVSLAVFAPEHFGGPMHVSDIV
Ga0302179_1030817513300030058PalsaMPGTVKETWVPMLSSINFWMCFAGLIYLVAGVFILRKEIGAARGWDRLITLCCIFIAVSLAVFAPE
Ga0302196_1006355943300030225BogMQPSINFWMCFAGLIYLIFGVFLFRKDIGAARGWDKLIVLNGIWIAVSLAVFAPEHFGGPMHVSDI
Ga0311353_1043403513300030399PalsaMLLSTNFWMSFAGLMYLVAGVFILRKEFGAARGWDRLITLGCVFIAVPLAVFAPEHFRGPEFVQGSV
Ga0302194_1008504113300030506BogMCLAGLVYLAAGAFTFRKEIGAARAWDKLITLGPIFMAVSLAAFAP
Ga0302183_1024908813300030509PalsaMLSSVNFWMCFAGLVYLVAGVFILRNEISAARGWDKLIIWGPLFIAVSLAV
Ga0302275_1032928333300030518BogMLSSINFWMCLAGMIYLVAGAFIFRKEVASARGWDRLISLDSIFIAV
Ga0311356_1032135723300030617PalsaMLSSVNFWMCFAGLVYLVAGVFILRKEISAARGWDKLITLGCIFIAVPLA
Ga0302316_1037172023300030646PalsaMLLSTNFWMSFAGLMYLVAGVFILRKEFGAARGWDRLITLGCVFIAVPLAVFAP
Ga0265753_107647523300030862SoilMLSSTNFWMCVAGLIYLAVGVFVIRKEISAARGWEKLITLGCVFFAVPLAVFA
Ga0170823_1388413313300031128Forest SoilMLSSTNFWMGFAGLVYLAAGIFILRKEISAAQGWDKLITLSPVFIAVSLAVFAPEHFRGPEFVQSMVPRWMPG
Ga0170824_10410034123300031231Forest SoilMLTPTNIWMGIAGLVYLVAGVFILRKDIGAARGLDKLITLGPVFIAVSLAT
Ga0302187_1011889713300031259BogMLSSANFWMCATGLIYLAAGVFILRKEISAARGWDKLILLDCVFIAVPLAVFAT
Ga0170818_10526617813300031474Forest SoilMHSSVNFWMCSAGLIYLVVGVFVLRKEISAARGWDKLVTLGCIFIAVPLAVF
Ga0170818_11032318513300031474Forest SoilMLASTNFWMGFAGLIYLAAGIFILRKEISAARGWDKLITLAPVFIAVPL
Ga0310686_11096125023300031708SoilMLSSVNFWMCFAGLIYLVAGVFVLRKQIRAARGWDKLITLGCVFIAVPLA
Ga0307474_1138947223300031718Hardwood Forest SoilMLSATNLWMSFAGLLYLVVGVFLLRKEIGAARGWDKLITLSCLFFAVPLAMFAPEHFQ
Ga0307474_1154735713300031718Hardwood Forest SoilMLSATNLWMGFAGLIYLVAGVFILRKEISAARGWDELITVGNVFIAVSLAVFAPEHFRGPDFIRKMVPRWMPAHQF
Ga0307469_1149112623300031720Hardwood Forest SoilMGFAGLVFLVAGVFVLRKEISAARGWDKLITLGCVFIAVSLAIFAPE
Ga0307471_10140450223300032180Hardwood Forest SoilMGFAGLVYLFAGVFVLRKEISAGHGWDKFITLACVFIAVSLAVFAPEHFHGGP
Ga0307471_10353397813300032180Hardwood Forest SoilMLSPSVNYWMSFVGLIYFVAGVFVLRKEISAARGWERLITLGPIFVAVPLAMF
Ga0335082_1096390823300032782SoilMSFAGLIYLVAGVFILRKEISAARGWDKLITLGCVFVAVPLAVFAPEHFRGPEFVQNMVPSWMPAHWFWPKL
Ga0335082_1102743713300032782SoilMLPSTNFWMCFAGLVVLVAGILVARKDISAVRGWDTLITLGPILIAVS
Ga0335081_1232773623300032892SoilMLSSTNFWMSFAGLIYLAAGVCVLRKQISSARGLDKLITLGAVFIAV
Ga0316620_1020223413300033480SoilMLSATDFWMCCAGLVSLVAGVFVLRKEIGAARGWDKLIALGTVFIAASLAAFAPEHFRGPQYIQDVVPRWMP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.