Metagenome Family F050217

Overview

Basic Information

• Family ID: F050217
• Family Type: Metagenome
• Number of Sequences: 145
• Average Sequence Length: 39 residues
• Representative Sequence: QHTEADIDKHLAVFEEVAPALAKAQQERGAAFVGAAGH
• Number of Associated Samples: 128
• Number of Associated Scaffolds: 145

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 0.69 %
• % of genes near scaffold ends (potentially truncated): 99.31 %
• % of genes from short scaffolds (< 2000 bps): 88.28 %
• Associated GOLD sequencing projects: 120
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (100.000 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (22.759 % of family members)
• Environment Ontology (ENVO): Unclassified (22.759 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (48.966 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 50.00%
  β-sheet: 0.00%
  Coil/Unstructured: 50.00%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF13520	AA_permease_2	88.28
PF00171	Aldedh	5.52
PF00202	Aminotran_3	4.14

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG0014	Gamma-glutamyl phosphate reductase	Amino acid transport and metabolism [E]	5.52
COG1012	Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase	Lipid transport and metabolism [I]	5.52
COG4230	Delta 1-pyrroline-5-carboxylate dehydrogenase	Amino acid transport and metabolism [E]	5.52

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	100.00 %
Unclassified	root	N/A	0.00 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	100.00 %
Unclassified	root	N/A	0.00 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	100.00 %
Unclassified	root	N/A	0.00 %

Level 4

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	95.86 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.69 %
Unclassified	root	N/A	0.00 %

Level 5

Name	Rank	Taxonomy	Distribution
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	27.59 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.07 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.69 %
Unclassified	root	N/A	0.00 %

Level 6

Name	Rank	Taxonomy	Distribution
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	23.45 %
Candidatus Acidoferrales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales	4.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	0.69 %
Unclassified	root	N/A	0.00 %

Level 7

Name	Rank	Taxonomy	Distribution
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	23.45 %
Candidatus Acidoferrum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum	4.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.69 %
Unclassified	root	N/A	0.00 %

Level 8

Name	Rank	Taxonomy	Distribution
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	20.69 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	4.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.69 %
Unclassified	root	N/A	0.00 %

Level 9

Name	Rank	Taxonomy	Distribution
Candidatus Koribacter versatilis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5.52 %
Candidatus Acidoferrum panamensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	4.14 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
Bradyrhizobium lablabi	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	0.69 %
Unclassified	root	N/A	0.00 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300004080|Ga0062385_10032549	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2103
3300004082|Ga0062384_101468509	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	504
3300004091|Ga0062387_100064632	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1823
3300004091|Ga0062387_100294049	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1042
3300004091|Ga0062387_101185630	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	597
3300004092|Ga0062389_103458991	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	592
3300005167|Ga0066672_10203918	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1261
3300005435|Ga0070714_102309656	All Organisms → cellular organisms → Bacteria → Acidobacteria	523
3300005445|Ga0070708_100087578	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2830
3300005454|Ga0066687_10677892	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	613
3300005468|Ga0070707_101574761	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	624
3300005542|Ga0070732_10237105	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1092
3300005555|Ga0066692_10695411	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	631
3300005576|Ga0066708_10140436	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1475
3300005586|Ga0066691_10619541	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	643
3300005764|Ga0066903_100068268	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	4520
3300005764|Ga0066903_106495035	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	609
3300005921|Ga0070766_10904516	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	604
3300005944|Ga0066788_10098279	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	723
3300005995|Ga0066790_10376941	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	606
3300006028|Ga0070717_11986408	All Organisms → cellular organisms → Bacteria → Acidobacteria	524
3300006041|Ga0075023_100572191	All Organisms → cellular organisms → Bacteria → Acidobacteria	521
3300006804|Ga0079221_11512535	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	539
3300006854|Ga0075425_101807797	All Organisms → cellular organisms → Bacteria → Acidobacteria	686
3300007258|Ga0099793_10263441	All Organisms → cellular organisms → Bacteria → Acidobacteria	834
3300007258|Ga0099793_10450245	All Organisms → cellular organisms → Bacteria	636
3300007258|Ga0099793_10593301	All Organisms → cellular organisms → Bacteria → Acidobacteria	555
3300009088|Ga0099830_10912669	All Organisms → cellular organisms → Bacteria → Acidobacteria	726
3300009089|Ga0099828_10220468	All Organisms → cellular organisms → Bacteria → Acidobacteria	1695
3300009143|Ga0099792_10280090	All Organisms → cellular organisms → Bacteria → Acidobacteria	982
3300009143|Ga0099792_10918093	All Organisms → cellular organisms → Bacteria → Acidobacteria	580
3300009672|Ga0116215_1157432	All Organisms → cellular organisms → Bacteria → Acidobacteria	1008
3300010048|Ga0126373_10320869	All Organisms → cellular organisms → Bacteria → Acidobacteria	1552
3300010339|Ga0074046_10807171	All Organisms → cellular organisms → Bacteria → Acidobacteria	548
3300010341|Ga0074045_10248721	All Organisms → cellular organisms → Bacteria → Acidobacteria	1176
3300010359|Ga0126376_10406697	All Organisms → cellular organisms → Bacteria → Acidobacteria	1228
3300010361|Ga0126378_11401955	All Organisms → cellular organisms → Bacteria → Acidobacteria	791
3300010376|Ga0126381_101038263	All Organisms → cellular organisms → Bacteria → Acidobacteria	1183
3300010376|Ga0126381_102451071	All Organisms → cellular organisms → Bacteria → Acidobacteria	748
3300010376|Ga0126381_102544486	All Organisms → cellular organisms → Bacteria → Acidobacteria	733
3300010398|Ga0126383_10027796	All Organisms → cellular organisms → Bacteria → Acidobacteria	4443
3300011120|Ga0150983_13723793	All Organisms → cellular organisms → Bacteria → Acidobacteria	645
3300011270|Ga0137391_10132633	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2166
3300011271|Ga0137393_11266589	All Organisms → cellular organisms → Bacteria → Acidobacteria	625
3300012200|Ga0137382_11168625	All Organisms → cellular organisms → Bacteria → Acidobacteria	548
3300012203|Ga0137399_10117290	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2086
3300012205|Ga0137362_11619825	All Organisms → cellular organisms → Bacteria → Acidobacteria	534
3300012207|Ga0137381_10202888	All Organisms → cellular organisms → Bacteria → Acidobacteria	1719
3300012210|Ga0137378_10078998	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2996
3300012285|Ga0137370_10550063	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	710
3300012349|Ga0137387_10621433	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	783
3300012361|Ga0137360_10487086	All Organisms → cellular organisms → Bacteria → Acidobacteria	1048
3300012362|Ga0137361_10402656	All Organisms → cellular organisms → Bacteria → Acidobacteria	1257
3300012363|Ga0137390_10141781	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	2385
3300012582|Ga0137358_11054858	All Organisms → cellular organisms → Bacteria → Acidobacteria	522
3300012917|Ga0137395_10292745	All Organisms → cellular organisms → Bacteria → Acidobacteria	1152
3300012923|Ga0137359_10457360	All Organisms → cellular organisms → Bacteria → Acidobacteria	1129
3300012924|Ga0137413_10647666	All Organisms → cellular organisms → Bacteria → Acidobacteria	796
3300012927|Ga0137416_10423650	All Organisms → cellular organisms → Bacteria → Acidobacteria	1132
3300012929|Ga0137404_11351596	All Organisms → cellular organisms → Bacteria → Acidobacteria	657
3300012929|Ga0137404_12333904	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	501
3300014157|Ga0134078_10396570	All Organisms → cellular organisms → Bacteria → Acidobacteria	618
3300014168|Ga0181534_10037851	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2387
3300014169|Ga0181531_10085193	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	1875
3300015195|Ga0167658_1085257	All Organisms → cellular organisms → Bacteria → Acidobacteria	707
3300015241|Ga0137418_10024942	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	5526
3300015242|Ga0137412_10995002	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	601
3300015356|Ga0134073_10246995	All Organisms → cellular organisms → Bacteria → Acidobacteria	614
3300015358|Ga0134089_10059058	All Organisms → cellular organisms → Bacteria → Acidobacteria	1412
3300016319|Ga0182033_10826704	All Organisms → cellular organisms → Bacteria → Acidobacteria	817
3300016387|Ga0182040_11494011	All Organisms → cellular organisms → Bacteria → Acidobacteria	574
3300016404|Ga0182037_11141958	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	683
3300016404|Ga0182037_12143160	All Organisms → cellular organisms → Bacteria → Acidobacteria	503
3300016445|Ga0182038_10123666	All Organisms → cellular organisms → Bacteria	1927
3300016445|Ga0182038_10848489	All Organisms → cellular organisms → Bacteria → Acidobacteria	803
3300016445|Ga0182038_11948672	All Organisms → cellular organisms → Bacteria → Acidobacteria	531
3300017822|Ga0187802_10130776	All Organisms → cellular organisms → Bacteria → Acidobacteria	954
3300017959|Ga0187779_11214451	All Organisms → cellular organisms → Bacteria → Acidobacteria	531
3300017961|Ga0187778_10410065	All Organisms → cellular organisms → Bacteria → Acidobacteria	890
3300017974|Ga0187777_10891914	All Organisms → cellular organisms → Bacteria → Acidobacteria	639
3300017999|Ga0187767_10140038	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	714
3300018006|Ga0187804_10170534	All Organisms → cellular organisms → Bacteria → Acidobacteria	922
3300018026|Ga0187857_10247553	All Organisms → cellular organisms → Bacteria → Acidobacteria	822
3300018482|Ga0066669_12083335	All Organisms → cellular organisms → Bacteria → Acidobacteria	534
3300019789|Ga0137408_1116008	All Organisms → cellular organisms → Bacteria → Acidobacteria	896
3300020150|Ga0187768_1088102	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis	704
3300020199|Ga0179592_10070616	All Organisms → cellular organisms → Bacteria	1598
3300020581|Ga0210399_11103163	All Organisms → cellular organisms → Bacteria → Acidobacteria	635
3300020582|Ga0210395_11102232	All Organisms → cellular organisms → Bacteria → Acidobacteria	586
3300021178|Ga0210408_10313395	All Organisms → cellular organisms → Bacteria → Acidobacteria	1251
3300021180|Ga0210396_10225154	All Organisms → cellular organisms → Bacteria → Acidobacteria	1671
3300021475|Ga0210392_11214875	All Organisms → cellular organisms → Bacteria → Acidobacteria	564
3300021559|Ga0210409_11422930	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	569
3300021560|Ga0126371_11738143	All Organisms → cellular organisms → Bacteria → Acidobacteria	747
3300024251|Ga0247679_1013229	All Organisms → cellular organisms → Bacteria → Acidobacteria	1412
3300025469|Ga0208687_1056305	All Organisms → cellular organisms → Bacteria → Acidobacteria	940
3300025906|Ga0207699_10259242	All Organisms → cellular organisms → Bacteria → Acidobacteria	1201
3300025922|Ga0207646_10433300	All Organisms → cellular organisms → Bacteria → Acidobacteria	1186
3300025929|Ga0207664_11088534	All Organisms → cellular organisms → Bacteria → Acidobacteria	715
3300025935|Ga0207709_10928528	All Organisms → cellular organisms → Bacteria → Acidobacteria	708
3300026281|Ga0209863_10032503	All Organisms → cellular organisms → Bacteria → Acidobacteria	1576
3300026318|Ga0209471_1224049	All Organisms → cellular organisms → Bacteria → Acidobacteria	688
3300026319|Ga0209647_1123707	All Organisms → cellular organisms → Bacteria → Acidobacteria	1176
3300026322|Ga0209687_1210848	All Organisms → cellular organisms → Bacteria → Acidobacteria	599
3300026325|Ga0209152_10410174	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	534
3300026475|Ga0257147_1036352	All Organisms → cellular organisms → Bacteria → Acidobacteria	717
3300026529|Ga0209806_1206006	All Organisms → cellular organisms → Bacteria → Acidobacteria	681
3300026542|Ga0209805_1092038	All Organisms → cellular organisms → Bacteria → Acidobacteria	1454
3300026555|Ga0179593_1060949	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi	4308
3300027003|Ga0207722_1012970	All Organisms → cellular organisms → Bacteria → Acidobacteria	954
3300027109|Ga0208603_1030390	All Organisms → cellular organisms → Bacteria → Acidobacteria	849
3300027655|Ga0209388_1008760	All Organisms → cellular organisms → Bacteria	2689
3300027671|Ga0209588_1198314	All Organisms → cellular organisms → Bacteria → Acidobacteria	626
3300027701|Ga0209447_10003386	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	4792
3300027817|Ga0209112_10335392	All Organisms → cellular organisms → Bacteria → Acidobacteria	538
3300027842|Ga0209580_10093921	All Organisms → cellular organisms → Bacteria → Acidobacteria	1445
3300027857|Ga0209166_10037478	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2907
3300027869|Ga0209579_10369069	All Organisms → cellular organisms → Bacteria → Acidobacteria	777
3300028145|Ga0247663_1033195	All Organisms → cellular organisms → Bacteria → Acidobacteria	825
3300028381|Ga0268264_12163512	All Organisms → cellular organisms → Bacteria → Acidobacteria	564
3300030490|Ga0302184_10313299	All Organisms → cellular organisms → Bacteria → Acidobacteria	627
3300031234|Ga0302325_11440935	All Organisms → cellular organisms → Bacteria → Acidobacteria	892
3300031469|Ga0170819_12496481	All Organisms → cellular organisms → Bacteria → Acidobacteria	1294
3300031546|Ga0318538_10157239	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1203
3300031546|Ga0318538_10369146	All Organisms → cellular organisms → Bacteria → Acidobacteria	775
3300031573|Ga0310915_10354022	All Organisms → cellular organisms → Bacteria → Acidobacteria	1041
3300031573|Ga0310915_11005996	All Organisms → cellular organisms → Bacteria → Acidobacteria	581
3300031720|Ga0307469_10260695	All Organisms → cellular organisms → Bacteria → Acidobacteria	1402
3300031753|Ga0307477_10057252	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2682
3300031754|Ga0307475_10176063	All Organisms → cellular organisms → Bacteria → Acidobacteria	1706
3300031754|Ga0307475_10320826	All Organisms → cellular organisms → Bacteria → Acidobacteria	1244
3300031823|Ga0307478_11122373	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	656
3300031896|Ga0318551_10591747	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	640
3300031910|Ga0306923_10240576	All Organisms → cellular organisms → Bacteria	2070
3300031942|Ga0310916_10272522	All Organisms → cellular organisms → Bacteria → Acidobacteria	1429
3300031945|Ga0310913_10957443	All Organisms → cellular organisms → Bacteria → Acidobacteria	601
3300031962|Ga0307479_10100737	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis	2806
3300031962|Ga0307479_11060108	All Organisms → cellular organisms → Bacteria → Acidobacteria	778
3300031962|Ga0307479_11228018	All Organisms → cellular organisms → Bacteria → Acidobacteria	712
3300032035|Ga0310911_10860025	All Organisms → cellular organisms → Bacteria → Acidobacteria	523
3300032076|Ga0306924_12144977	All Organisms → cellular organisms → Bacteria → Acidobacteria	571
3300032174|Ga0307470_10453454	All Organisms → cellular organisms → Bacteria → Acidobacteria	923
3300032205|Ga0307472_101018268	All Organisms → cellular organisms → Bacteria → Acidobacteria	777
3300032828|Ga0335080_10346671	All Organisms → cellular organisms → Bacteria → Acidobacteria	1603
3300033004|Ga0335084_10496940	All Organisms → cellular organisms → Bacteria → Acidobacteria	1253

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	97.93%
Host-Associated	Host-Associated	2.07%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	88.28%
Aquatic	Environmental → Aquatic	9.66%
Plants	Host-Associated → Plants	2.07%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	86.90%
Freshwater	Environmental → Aquatic → Freshwater	8.97%
Peat	Environmental → Terrestrial → Peat	1.38%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.38%
Sediment	Environmental → Aquatic → Sediment	0.69%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.69%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	68.97%
Loam	Environmental → Terrestrial → Soil → Loam	9.66%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	8.97%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	8.28%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.38%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.69%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.69%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	34.48%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	25.52%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	8.28%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	6.90%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.21%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.83%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.83%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	2.07%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.38%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.38%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.38%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.69%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	0.69%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.69%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	22.76%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	11.72%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	6.90%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	6.90%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.21%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	5.52%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	4.83%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	3.45%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.45%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	2.76%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.07%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.07%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	2.07%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog	1.38%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.38%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.38%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	1.38%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.38%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	1.38%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.38%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	0.69%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	0.69%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.69%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	0.69%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	0.69%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.69%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.69%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.69%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.69%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.69%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.69%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.69%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300004080	Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3	Environmental
3300004082	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3	Environmental
3300004091	Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental
3300004092	Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3	Environmental
3300005167	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121	Environmental
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005921	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6	Environmental
3300005944	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048	Environmental
3300005995	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009672	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010339	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3	Environmental
3300010341	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300011120	Combined assembly of Microbial Forest Soil metaT	Environmental
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental
3300012207	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG	Environmental
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental
3300012349	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012924	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)	Environmental
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300014157	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG	Environmental
3300014168	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG	Environmental
3300014169	Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG	Environmental
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental
3300015358	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG	Environmental
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental
3300017822	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2	Environmental
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300017999	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG	Environmental
3300018006	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4	Environmental
3300018026	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300019789	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)	Environmental
3300020150	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG	Environmental
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300020582	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021180	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O	Environmental
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300024251	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20	Environmental
3300025469	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)	Environmental
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated
3300026281	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)	Environmental
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300026322	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)	Environmental
3300026325	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes)	Environmental
3300026475	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A	Environmental
3300026529	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)	Environmental
3300026542	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)	Environmental
3300026555	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)	Environmental
3300027003	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)	Environmental
3300027109	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes)	Environmental
3300027655	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)	Environmental
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental
3300027701	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)	Environmental
3300027817	Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)	Environmental
3300027842	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)	Environmental
3300027857	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)	Environmental
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental
3300028145	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04	Environmental
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300030490	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3	Environmental
3300031234	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2	Environmental
3300031469	Fir Spring Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031546	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23	Environmental
3300031573	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031753	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515	Environmental
3300031754	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515	Environmental
3300031823	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05	Environmental
3300031896	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19	Environmental
3300031910	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)	Environmental
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental
3300031945	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082	Environmental
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental
3300032035	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170	Environmental
3300032076	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)	Environmental
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0062385_100325493	3300004080	Bog Forest Soil	WTISVQHTEADIDKHLAVFDEVAPTLAKAQLERGALFVGAAGH*
Ga0062384_1014685091	3300004082	Bog Forest Soil	WTISVQHTEADIDKHLAVFDEVAPGLAKAQLERGAHFVGAAGH*
Ga0062387_1000646321	3300004091	Bog Forest Soil	SVQHTEADIDKHLAVFDEVAPTLAKAQLERGALFVGAAGH*
Ga0062387_1002940492	3300004091	Bog Forest Soil	ISVQHTEADIDKHLAVFEEVAPGLAAAQLERGAHFVGAAGH*
Ga0062387_1011856302	3300004091	Bog Forest Soil	TISVQHTEADIDKHLAVFEEIAPALAKAQKARGLAFVGAAGH*
Ga0062389_1034589912	3300004092	Bog Forest Soil	VQHTEADIDKHLAVFEEIAPALAKAQSARGLAFVGAAGH*
Ga0066672_102039182	3300005167	Soil	VQHTEADIDKHLAVFEEVAPALAKAQQQRGAAFVGAAGH*
Ga0070714_1023096561	3300005435	Agricultural Soil	VQHTEADIDKHLAAFEDVAPALALAQQERGAVAIGSAGH*
Ga0070708_1000875781	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	VQHTEADIDKHLAAFEDVAPGLAKAQHERGAAAVSSAGH*
Ga0066687_106778921	3300005454	Soil	ISVQHTEADIDKHLAAFEDVAPGLAKAQHERGAAAVSSAGH*
Ga0070707_1015747611	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	ISVQHTEADIDKHLAVFEEVAPGLAKAQAERGLVTAAAGH*
Ga0070732_102371052	3300005542	Surface Soil	VQHTEADIEKHLATFEEVAPALAKAQQERGTAFFGAAGH*
Ga0066692_106954111	3300005555	Soil	HTEADIDKHLAVFEEVAPALSKAQRERGLAFVGAAGH*
Ga0066708_101404361	3300005576	Soil	QHTEADVDKHLAVFEEVAPALTKAQQERGAAFVGAAGH*
Ga0066691_106195411	3300005586	Soil	QHTEADIDKHLAAFEELAPGLAKAQSERGMVTAAAGH*
Ga0066903_1000682684	3300005764	Tropical Forest Soil	TEADIDKHLAVFEEIAPGLAKAQAERGLVTVAAAH*
Ga0066903_1064950351	3300005764	Tropical Forest Soil	HTEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD*
Ga0070766_109045161	3300005921	Soil	HTEADIDKHLAVFEEVAPGLAKAQLERGAAFVGAAGH*
Ga0066788_100982791	3300005944	Soil	QHSEADIDKHLSVFDEIAPALAKAQQERGAAMVGSAGH*
Ga0066790_103769411	3300005995	Soil	SVQHTEADIDKHLAVFDEVAPALAKAQASRGLAFVGAAGH*
Ga0070717_119864082	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	TISVQHTEADIDKHLAVFEEIAPSLAKAQQQRGAATVGAAGH*
Ga0075023_1005721912	3300006041	Watersheds	SVQHTEADIDKHLAAFEDVAPGLAMAQQERGAAAVSSAGH*
Ga0079221_115125352	3300006804	Agricultural Soil	VQHTEADIDKHLAAFEEVAPALAKAQQERGAAFFGAAGH*
Ga0075425_1018077972	3300006854	Populus Rhizosphere	ISVQHSDADIDKHLAVFEEIAPGLAKAQADRGLVTVAAAH*
Ga0099793_102634411	3300007258	Vadose Zone Soil	EADIDKHLAAFEDVAPGLAKAQHERGAAAVSSAGH*
Ga0099793_104502451	3300007258	Vadose Zone Soil	EADIDRHLAAFEDVALGLAKAQSERGAAAASSAGH*
Ga0099793_105933012	3300007258	Vadose Zone Soil	QHTEADIDKHLAVFEEVAPALAKAQQERGAAFVGAAGH*
Ga0099830_109126691	3300009088	Vadose Zone Soil	EADIDKHLAAFEEVAPALAKAQQERGMAFVGAAGH*
Ga0099828_102204683	3300009089	Vadose Zone Soil	TEADIDKHLAVFEEVAPALAKAQQERGLAFVGAAGH*
Ga0099792_102800901	3300009143	Vadose Zone Soil	HTEADIDKHLAVFEEIAPGLSKAQAERGVVTAAAGH*
Ga0099792_109180931	3300009143	Vadose Zone Soil	QHTEADIDKHLAVFEEIVPALAKAQQERGLAFVGAAGH*
Ga0116215_11574322	3300009672	Peatlands Soil	VSVQHTEADIDKHLAVFDEVAPALAKTQQERGAKFVGAAGD*
Ga0126373_103208691	3300010048	Tropical Forest Soil	TISVQHTEADIARHLAVFEEVAAALAKAQQERGVAEVGAAGH*
Ga0074046_108071712	3300010339	Bog Forest Soil	WTISVQHTEADIDQHLAVFEEVAPGLARAQQERGVAFVGAAGH*
Ga0074045_102487212	3300010341	Bog Forest Soil	VQHTEADIDKHLAVFEEVASGLAKTQQERGAQFVGVAGH*
Ga0126376_104066972	3300010359	Tropical Forest Soil	ISVQHTEADIAKHLAVFEEIAPSLAKAQHERGAAKAGATGH*
Ga0126378_114019552	3300010361	Tropical Forest Soil	EADIDKHLAVFEEVAPGLSKAQAERGLVTAAAGH*
Ga0126381_1010382631	3300010376	Tropical Forest Soil	TISVQHSEADIDKHLAVFEEVAPGLAKTQEERGLKYVGAAGH*
Ga0126381_1024510712	3300010376	Tropical Forest Soil	HSEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASDSSD*
Ga0126381_1025444862	3300010376	Tropical Forest Soil	EADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD*
Ga0126383_100277961	3300010398	Tropical Forest Soil	ISVQHTEADIDRHLAVFEEVAPSLAKAQAERGLVTAAAGH*
Ga0150983_137237932	3300011120	Forest Soil	EADIDKHLAAFEDVAPGLATAQQERGAAAVSSAGH*
Ga0137391_101326331	3300011270	Vadose Zone Soil	ADIDKHLAAFEDVAPGLAKAQQERGAAAVSSAGH*
Ga0137393_112665892	3300011271	Vadose Zone Soil	SVQHTGADIDQHLAVFEEVAPALAKAQQERGLAFVGAAGH*
Ga0137382_111686251	3300012200	Vadose Zone Soil	HTEADIDKHLAVFEEIAPALARAQQQRGAAFVGAAGH*
Ga0137399_101172901	3300012203	Vadose Zone Soil	TEADIDRHLAAFDEVAPGLAKAQQERGAQFVGAAGH*
Ga0137362_116198251	3300012205	Vadose Zone Soil	TESDIDRHLAAFEEVAPGLAKAQAERGMVTAAAGH*
Ga0137381_102028883	3300012207	Vadose Zone Soil	TISVQHTEADIDEHLAVFEEIVPALVKAQQERGMAFVGAAGH*
Ga0137378_100789981	3300012210	Vadose Zone Soil	ISVQHTEADIDEHLAVFEEIVPALVKAQQERGMAFVGAAGH*
Ga0137370_105500632	3300012285	Vadose Zone Soil	EADIDKHLAAFEEVAPALAKAQQERGAAFVGAAGH*
Ga0137387_106214333	3300012349	Vadose Zone Soil	VQHTEADIDEHLAVFEEIVPALVKAQQERGMAFVSAAGH*
Ga0137360_104870861	3300012361	Vadose Zone Soil	SVQHTEADIDKHLAVFEEVAPGLAKAQAERGMVTAAAGH*
Ga0137361_104026561	3300012362	Vadose Zone Soil	VQHTEADIDKHLAAFEDVAPGLARAQQERGAAAVSSAGH*
Ga0137390_101417813	3300012363	Vadose Zone Soil	SVQHTEADIDKHLAVFEEIAPGLAKAQAERGMVTVAAGH*
Ga0137358_110548582	3300012582	Vadose Zone Soil	EADIVKHLAAFEDVAPGLAKTQQERGAAAASSAGR*
Ga0137395_102927451	3300012917	Vadose Zone Soil	QHTEADIDKHLAAFEDVAPGLAKAQHERGAAAVSSAGH*
Ga0137359_104573601	3300012923	Vadose Zone Soil	TEADIDKHLAAFEDVAPGLAKAQHERGAAAVSSAGH*
Ga0137413_106476662	3300012924	Vadose Zone Soil	EADIDKHLAVFEEIAPGLAKAQAERGMVTAAAGH*
Ga0137416_104236501	3300012927	Vadose Zone Soil	EADIDTHLAAFEDVAPGLAKAQHERGAAAVSSAGH*
Ga0137404_113515961	3300012929	Vadose Zone Soil	TEADIDKHLAVFEEIAPGLAKAQAERGMVTAAAGH*
Ga0137404_123339041	3300012929	Vadose Zone Soil	ISVQHTEADIDKHLAVFEEVAPALAKAQQERGAAFVGAAGH*
Ga0134078_103965702	3300014157	Grasslands Soil	SVQHTEADIDKHLAAFEELAPGLAKAQSERGMVTAAAGH*
Ga0181534_100378513	3300014168	Bog	SVQHTEADIDKHLAVFEEIAPVMARVQQERGEPVGAAAH*
Ga0181531_100851933	3300014169	Bog	TISVQHTEADIDKHLAVFEEIAPVMARVQQERGEPVGAAAH*
Ga0167658_10852572	3300015195	Glacier Forefield Soil	KDIDKHLAAFEEVAPGLAKAQQERGVAFVGAAGH*
Ga0137418_100249421	3300015241	Vadose Zone Soil	ADIDKHLAVFEEVAPALAKAQNERGMAFVGAAGH*
Ga0137412_109950021	3300015242	Vadose Zone Soil	VQHTEADIDMHLAVFEEVAPALAKAQQQRGAAFVGAAGH*
Ga0134073_102469952	3300015356	Grasslands Soil	ISVQHTEADVDKHLAVFEEVAPALTKAQQERGAAFVGAAGH*
Ga0134089_100590581	3300015358	Grasslands Soil	HTEADVDKHLAVFEEVAPALTKAQQERGAAFVGAAGH*
Ga0182033_108267042	3300016319	Soil	SVQHTEADIDKHLAVFEEVAPGLAKAQAERGLVTAAAGH
Ga0182040_114940112	3300016387	Soil	QHSEADIDTHLAVFDEIAPALAEAQAERGLVTAAAAH
Ga0182037_111419581	3300016404	Soil	EADIDKHLAVFEEVAPALAKAQQERGMAHVGAAGH
Ga0182037_121431601	3300016404	Soil	ISVQHTEADIDEHLAAFEEVAPALAKAQQERGTAFFGAAGH
Ga0182038_101236661	3300016445	Soil	ISVQHSEADIDKHLAVFEEVAPGLAKTQEERGLKYVGAAGH
Ga0182038_108484891	3300016445	Soil	EAEIDKHLAVFEEVAAGLAKTQKDRGLKFVGVAGH
Ga0182038_119486722	3300016445	Soil	WTISVQHTEADIDKHLAVFEEVAHGLAKTQQERGAAYVGAAGH
Ga0187802_101307761	3300017822	Freshwater Sediment	SVQHTEADIDKHLAVFDEIAPGLARAQKERGAKYVGAAGH
Ga0187779_112144511	3300017959	Tropical Peatland	TICVQHTEAEIGKHLAVFEEVAAGLARTQKERGLKFVGAAGH
Ga0187778_104100652	3300017961	Tropical Peatland	VSVQHTDADIDKHLAAFEDVAPGLAKVQQERRSAFVDAGQ
Ga0187777_108919142	3300017974	Tropical Peatland	TISVQHTEAEIDKHLAVFEEVAAGLAQTQKERGLKYVGAAGH
Ga0187767_101400382	3300017999	Tropical Peatland	TISVQHSEADIDKHLAVFEEVAPALTAAQQDRGVAHVGAVGH
Ga0187804_101705342	3300018006	Freshwater Sediment	EADIDKHLAVFDEVAPGLAKTQQERGVQTVGVAGH
Ga0187857_102475531	3300018026	Peatland	TEADIDKHLSVFDEIAPALAKAQSERGAAMVGSAGH
Ga0066669_120833352	3300018482	Grasslands Soil	ISVQHTEADIDKHLAAFEEVAPGLAKAQSERGMVTAAAGH
Ga0137408_11160081	3300019789	Vadose Zone Soil	EADIDKHLSAFEEVAPALAKAQQERGLAFVGAAGH
Ga0187768_10881022	3300020150	Tropical Peatland	QHSEADIDKHLAVFEEVAPALTAAQQDRGVAHVGAVGH
Ga0179592_100706162	3300020199	Vadose Zone Soil	TEADIDKHLSAFEEVAPALAKAQQERGLAFVGAAGH
Ga0210399_111031631	3300020581	Soil	TEADIDKHLAVFEEIAPALAKAQQERGAAMVGSAGH
Ga0210395_111022321	3300020582	Soil	VQHTEADIDKHLAVFEEIAPSLAKAQQQRGAAKVGATGH
Ga0210408_103133952	3300021178	Soil	TISVQHTEADIDKHLAIFEEVAPALAKAQQERGLAFVGAAGH
Ga0210396_102251541	3300021180	Soil	ISVQHSEADIDQHLAVFEEVAHGLAKAQQQRGAAYVGAAGH
Ga0210392_112148751	3300021475	Soil	SVQHTEADIDKHLAAFEEVAPGLAKAQQERGAQFVGAAGH
Ga0210409_114229302	3300021559	Soil	WTISVQHTEADIDKHLSVFEEVAPALAQAQQQRGAAFVGAAGH
Ga0126371_117381433	3300021560	Tropical Forest Soil	TEADIDKHLAVFEEVAPALAKAQQERGAAFVGAAGH
Ga0247679_10132291	3300024251	Soil	TEADIDKHLAAFEEVAPGLARAQAERGMVTAAAGH
Ga0208687_10563051	3300025469	Peatland	SVQHTEADIDKHLAVFEEVAPGLAKTQQERGAQIVGAAGH
Ga0207699_102592421	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	QHSDADIERHLAVFEEVAPGLAKAQAERGMVTAAAGH
Ga0207646_104333002	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	VQHTEADIDKHLAVFEEIAPGLARAQAERGMVTAAAGH
Ga0207664_110885342	3300025929	Agricultural Soil	QHTEVDIDKHLAAFEEVVPGLAKAQAERGMVTAAAGH
Ga0207709_109285281	3300025935	Miscanthus Rhizosphere	ISVQHTEADIDKHLAVFDEIAPGLAKAQRERGAAVASSAGH
Ga0209863_100325032	3300026281	Prmafrost Soil	QHTEADIDKHLAVFEEVAPGLARAQSERGVAFVGAAGH
Ga0209471_12240492	3300026318	Soil	EADIDKHLAVFEEVAPALRKAQEERGLAFVGAAGH
Ga0209647_11237072	3300026319	Grasslands Soil	VQHTEADIDKHLSAFEEVAPALAKAQQERGLAFVGAAGH
Ga0209687_12108482	3300026322	Soil	TEADIDKHLAAFEDVAPGLAKAQHERGAAAVSSAGH
Ga0209152_104101742	3300026325	Soil	SVQHTEADIDKHLAVFEEVAPALAKAQQQRGAAFVGAAGH
Ga0257147_10363521	3300026475	Soil	HTEADIDKHLAVFEEVASGLAKAQAERGMVTAAAGH
Ga0209806_12060062	3300026529	Soil	TEADIDKHLAAFEEVAPALAKAQRERGGASVGAAGH
Ga0209805_10920382	3300026542	Soil	HTEADIDKHLAVFEEVAPALRKAQEERGLAFVGAAGH
Ga0179593_10609493	3300026555	Vadose Zone Soil	MDDSVQHTEADIDKHLAVFEEVAPGLAKAQAERGMVTAAAGH
Ga0207722_10129702	3300027003	Tropical Forest Soil	VQHTEADIDKHLGVFEEIAPGLAKTQQERGLKFVGAAGH
Ga0208603_10303902	3300027109	Forest Soil	TEADIDKHLAVFEEVAAGLAKAQLERGAAFVGAAGH
Ga0209388_10087604	3300027655	Vadose Zone Soil	VQHTEADIDRHLAAFEDVAPGLAKAQSERGAAAASSAGH
Ga0209588_11983142	3300027671	Vadose Zone Soil	HTEVDIDKHLSVFEEVAPALSKAQQERGLAFVGAAGH
Ga0209447_100033861	3300027701	Bog Forest Soil	TEADIDKHLSVFEEVAPGLARTQKERGLKFVGVAGH
Ga0209112_103353921	3300027817	Forest Soil	HTEADIQKHLAVFEEIAPSLAKAQQERGAAKVGATGH
Ga0209580_100939212	3300027842	Surface Soil	TEADIDKHLAAFEDVAPGLAKAQQERGAAAASSAGH
Ga0209166_100374783	3300027857	Surface Soil	QHTEADIEKHLAVFEEVAPALAKAQQERGAAFVGAAGH
Ga0209579_103690691	3300027869	Surface Soil	ISVAHTDADIEKHLEVFEEVAPGLARAQQDRFATAAR
Ga0247663_10331951	3300028145	Soil	ISVQHTEADIEKHLAVFDEVAPALAKAQQERGVAFVGAAGH
Ga0268264_121635122	3300028381	Switchgrass Rhizosphere	VQHSDADIDRHLAVFEEIAPGLAKGQAERGMVTVAAAH
Ga0302184_103132992	3300030490	Palsa	WTISVQHTEADIAKHLAVFEEVAPALAKAQQARGLAFVGAAGH
Ga0302325_114409351	3300031234	Palsa	WTISVQHTEADIDQHLAVFEEVAPGLAKAQQARGLAFVGAAGH
Ga0170819_124964812	3300031469	Forest Soil	SVQHTEADIDKHLAVFEEIAPGLAHAQQERGVAFVGAAGH
Ga0318538_101572391	3300031546	Soil	QWSISVQHTEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD
Ga0318538_103691461	3300031546	Soil	SVQHSEADIDTHLAVFDEIAPALAEAQAERGLVTAAAAH
Ga0310915_103540221	3300031573	Soil	HTEAEIDKHLAVFEEVAAGLAKTQKDRGLKFVGVAGH
Ga0310915_110059962	3300031573	Soil	QHTEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD
Ga0307469_102606952	3300031720	Hardwood Forest Soil	TISVQHTEADIDEHLAVFDEVAPALAKAQQQRGVAVVGAAGH
Ga0307477_100572521	3300031753	Hardwood Forest Soil	QWTISVQHTEADIDKHLATFDEVAPALSKAQRERGVAHVGAAGH
Ga0307475_101760632	3300031754	Hardwood Forest Soil	VSVQHTEADIDKHLAVFEEVAPGLARTQKERGLKFVGAAGH
Ga0307475_103208261	3300031754	Hardwood Forest Soil	QHTEADIDKHLSAFDEIAPALAKAQQERGAAVASSAGH
Ga0307478_111223731	3300031823	Hardwood Forest Soil	TEADIDKHLSVFEEVAPALAKAQQERGAAVASSAGH
Ga0318551_105917471	3300031896	Soil	WTISVAHTEADIERHLEVFEEVAPLVAAAQKKRGVLAAAH
Ga0306923_102405763	3300031910	Soil	SVQHTEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD
Ga0310916_102725222	3300031942	Soil	ISVQHTEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD
Ga0310913_109574432	3300031945	Soil	EQWTFYVQHTEADIDKHLAVFEEVAHGLTKAQQERGAAYVGAAGH
Ga0307479_101007373	3300031962	Hardwood Forest Soil	ISVQHTEADIDKHLAVFEEVAPSLAEAQAERGVVTAAAGH
Ga0307479_110601081	3300031962	Hardwood Forest Soil	SVQHTGADIDKHLAVFEEVAPALAKAQQERGLAFVGAAGH
Ga0307479_112280181	3300031962	Hardwood Forest Soil	SVQHTDADIDKHLAVFEEVAPALAKAQQERGLAFVGAAGH
Ga0310911_108600251	3300032035	Soil	TISVQHTEADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD
Ga0306924_121449771	3300032076	Soil	EADIDKHLAVFEEVAPGLAKTQQERGLSFVGAASD
Ga0307470_104534542	3300032174	Hardwood Forest Soil	ISVQHTDADIDKHLAVFEEVAPGLAKAQAERGMVTAAAGH
Ga0307472_1010182682	3300032205	Hardwood Forest Soil	WTISVQHTEADIDKHLAVFEEVAHGLAKAQQERGAAYVGAAGH
Ga0335080_103466711	3300032828	Soil	ISVQHSEADIDKHLAVFEEVASGLAKAQQERGAAFVGAAGH
Ga0335084_104969402	3300033004	Soil	QHTEAEIDKHLAVFEEVAAGLAQTQKERGLKYVGAAGH