Basic Information | |
---|---|
Family ID | F049902 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 43 residues |
Representative Sequence | MPLFVKARSFLRNLFLSRRVDADLDQEVRAHLEMLIAENIRAG |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 92.47 % |
% of genes near scaffold ends (potentially truncated) | 94.52 % |
% of genes from short scaffolds (< 2000 bps) | 89.73 % |
Associated GOLD sequencing projects | 118 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (98.630 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.233 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.288 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.110 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF03551 | PadR | 63.01 |
PF02687 | FtsX | 14.38 |
PF12704 | MacB_PCD | 2.05 |
PF07969 | Amidohydro_3 | 1.37 |
PF01590 | GAF | 1.37 |
PF00291 | PALP | 1.37 |
PF03466 | LysR_substrate | 0.68 |
PF12867 | DinB_2 | 0.68 |
PF00069 | Pkinase | 0.68 |
PF14329 | DUF4386 | 0.68 |
PF01479 | S4 | 0.68 |
PF01135 | PCMT | 0.68 |
PF13377 | Peripla_BP_3 | 0.68 |
PF13360 | PQQ_2 | 0.68 |
PF01243 | Putative_PNPOx | 0.68 |
PF00107 | ADH_zinc_N | 0.68 |
PF00175 | NAD_binding_1 | 0.68 |
PF08239 | SH3_3 | 0.68 |
PF13847 | Methyltransf_31 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 63.01 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 63.01 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 63.01 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.74 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.68 |
COG2518 | Protein-L-isoaspartate O-methyltransferase | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
COG2519 | tRNA A58 N-methylase Trm61 | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG4122 | tRNA 5-hydroxyU34 O-methylase TrmR/YrrM | Translation, ribosomal structure and biogenesis [J] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 98.63 % |
Unclassified | root | N/A | 1.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090014|GPIPI_16962930 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
3300004080|Ga0062385_10064856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1641 | Open in IMG/M |
3300004082|Ga0062384_101169363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 558 | Open in IMG/M |
3300005172|Ga0066683_10740397 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300005180|Ga0066685_11034703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
3300005184|Ga0066671_11068782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
3300005434|Ga0070709_11668900 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005445|Ga0070708_102073474 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 526 | Open in IMG/M |
3300005471|Ga0070698_101140829 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300005537|Ga0070730_10205645 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
3300005537|Ga0070730_10284935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1084 | Open in IMG/M |
3300005545|Ga0070695_100385505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
3300005554|Ga0066661_10827597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 541 | Open in IMG/M |
3300005554|Ga0066661_10877883 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300005560|Ga0066670_10239129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1099 | Open in IMG/M |
3300005560|Ga0066670_10409582 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300005576|Ga0066708_10273248 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300005576|Ga0066708_10933211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 540 | Open in IMG/M |
3300005921|Ga0070766_10350181 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300006028|Ga0070717_11364435 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 644 | Open in IMG/M |
3300006172|Ga0075018_10429655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 677 | Open in IMG/M |
3300006175|Ga0070712_100110210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2053 | Open in IMG/M |
3300006176|Ga0070765_102184268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 516 | Open in IMG/M |
3300006797|Ga0066659_11567272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 553 | Open in IMG/M |
3300006893|Ga0073928_10785943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 659 | Open in IMG/M |
3300007788|Ga0099795_10474707 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300009012|Ga0066710_104471953 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300009038|Ga0099829_11271987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
3300009089|Ga0099828_11774231 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300009137|Ga0066709_100219723 | All Organisms → cellular organisms → Bacteria | 2515 | Open in IMG/M |
3300009143|Ga0099792_11051381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
3300010048|Ga0126373_10987769 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300010159|Ga0099796_10567820 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300010343|Ga0074044_10432122 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
3300010359|Ga0126376_13223525 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300011269|Ga0137392_10713585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
3300011269|Ga0137392_11631185 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300012096|Ga0137389_10562558 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
3300012200|Ga0137382_10143902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1611 | Open in IMG/M |
3300012202|Ga0137363_10048534 | All Organisms → cellular organisms → Bacteria | 3031 | Open in IMG/M |
3300012202|Ga0137363_10712524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
3300012203|Ga0137399_11245672 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300012205|Ga0137362_11325330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
3300012208|Ga0137376_10184230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1803 | Open in IMG/M |
3300012208|Ga0137376_11070334 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300012209|Ga0137379_10339787 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300012349|Ga0137387_10419682 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300012361|Ga0137360_10381513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1185 | Open in IMG/M |
3300012918|Ga0137396_10637467 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300012922|Ga0137394_10277790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1432 | Open in IMG/M |
3300012924|Ga0137413_10341579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1059 | Open in IMG/M |
3300012925|Ga0137419_11282417 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300012929|Ga0137404_10110655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2230 | Open in IMG/M |
3300012929|Ga0137404_11162190 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300012930|Ga0137407_10275665 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300012930|Ga0137407_10701183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 953 | Open in IMG/M |
3300012930|Ga0137407_12346899 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300012958|Ga0164299_10799152 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300014168|Ga0181534_10065935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1786 | Open in IMG/M |
3300015053|Ga0137405_1094948 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300015241|Ga0137418_10508710 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 962 | Open in IMG/M |
3300016422|Ga0182039_10446157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1108 | Open in IMG/M |
3300016445|Ga0182038_11207695 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
3300017959|Ga0187779_10396302 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300017995|Ga0187816_10531259 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300018022|Ga0187864_10016490 | All Organisms → cellular organisms → Bacteria | 4707 | Open in IMG/M |
3300018033|Ga0187867_10101009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1681 | Open in IMG/M |
3300018035|Ga0187875_10368691 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
3300018433|Ga0066667_11747608 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300020199|Ga0179592_10017498 | All Organisms → cellular organisms → Bacteria | 3158 | Open in IMG/M |
3300020579|Ga0210407_10139818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1861 | Open in IMG/M |
3300020580|Ga0210403_10512416 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300020580|Ga0210403_11360835 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300020582|Ga0210395_11371174 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300020583|Ga0210401_10543588 | All Organisms → cellular organisms → Bacteria | 1024 | Open in IMG/M |
3300021088|Ga0210404_10788944 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300021170|Ga0210400_10947117 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300021171|Ga0210405_11318294 | Not Available | 529 | Open in IMG/M |
3300021402|Ga0210385_10576159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 857 | Open in IMG/M |
3300021402|Ga0210385_11473959 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300021405|Ga0210387_10018556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5404 | Open in IMG/M |
3300021405|Ga0210387_10079170 | All Organisms → cellular organisms → Bacteria | 2707 | Open in IMG/M |
3300021405|Ga0210387_10770130 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
3300021405|Ga0210387_11525524 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300021406|Ga0210386_11556473 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300021479|Ga0210410_10542685 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300024056|Ga0124853_1515077 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
3300024290|Ga0247667_1054287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 743 | Open in IMG/M |
3300025538|Ga0210132_1004209 | All Organisms → cellular organisms → Bacteria | 1833 | Open in IMG/M |
3300025905|Ga0207685_10015388 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
3300025906|Ga0207699_10930212 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
3300025915|Ga0207693_10096298 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2320 | Open in IMG/M |
3300025939|Ga0207665_10291297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
3300026317|Ga0209154_1083944 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300026323|Ga0209472_1019335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3276 | Open in IMG/M |
3300026326|Ga0209801_1116106 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300026335|Ga0209804_1176372 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300026489|Ga0257160_1099352 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300026490|Ga0257153_1068367 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300026514|Ga0257168_1093843 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300026528|Ga0209378_1212584 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300026530|Ga0209807_1217288 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
3300026547|Ga0209156_10383774 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300026548|Ga0209161_10440640 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300026550|Ga0209474_10382351 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300026551|Ga0209648_10426861 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300026557|Ga0179587_11087949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
3300027069|Ga0208859_1035825 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300027432|Ga0209421_1084832 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300027545|Ga0209008_1087146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
3300027629|Ga0209422_1057092 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300027684|Ga0209626_1168699 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300027737|Ga0209038_10228365 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
3300027748|Ga0209689_1391927 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300027765|Ga0209073_10425493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300027768|Ga0209772_10052558 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300027826|Ga0209060_10062624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → unclassified Caulobacter → Caulobacter sp. 17J65-9 | 1773 | Open in IMG/M |
3300027857|Ga0209166_10021159 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4057 | Open in IMG/M |
3300027857|Ga0209166_10193870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300027889|Ga0209380_10291649 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300027889|Ga0209380_10309339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 928 | Open in IMG/M |
3300028020|Ga0265351_1025647 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300028047|Ga0209526_10231656 | All Organisms → cellular organisms → Bacteria | 1270 | Open in IMG/M |
3300028072|Ga0247675_1067773 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300031017|Ga0265744_115677 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300031231|Ga0170824_128162991 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300031549|Ga0318571_10282816 | Not Available | 619 | Open in IMG/M |
3300031708|Ga0310686_116787993 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
3300031715|Ga0307476_10485314 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300031720|Ga0307469_11864743 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300031740|Ga0307468_102109048 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300031753|Ga0307477_10430045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 902 | Open in IMG/M |
3300031753|Ga0307477_10554536 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
3300031833|Ga0310917_10912844 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300031845|Ga0318511_10589784 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300031912|Ga0306921_12621799 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031947|Ga0310909_10482687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1039 | Open in IMG/M |
3300032001|Ga0306922_10065646 | All Organisms → cellular organisms → Bacteria | 3782 | Open in IMG/M |
3300032063|Ga0318504_10448724 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300032076|Ga0306924_12020018 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300032174|Ga0307470_11676868 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300032180|Ga0307471_100656555 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300032180|Ga0307471_101447070 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300032261|Ga0306920_101811059 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300032954|Ga0335083_10146577 | All Organisms → cellular organisms → Bacteria | 2237 | Open in IMG/M |
3300033486|Ga0316624_10605896 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.23% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.85% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.48% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.11% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.11% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.74% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.74% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.74% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.68% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.68% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.68% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300024056 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027069 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF002 (SPAdes) | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
3300031017 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_03440940 | 2088090014 | Soil | MPLIVKLRSLLRNLFLSRRVEADLDQEVHSCLEMLMEENMRAGMS |
Ga0062385_100648561 | 3300004080 | Bog Forest Soil | MPVLAKVRSFLRNLFLSPRVEADLDQEVHSHLELLAEENIRAGM |
Ga0062384_1011693631 | 3300004082 | Bog Forest Soil | MPLLVKARSFLRNLFFTRRVDADLDQEVLAHLELLIEEKMRAGMPAAEARRAAR |
Ga0066683_107403971 | 3300005172 | Soil | MPLFVKTRSLLRNLFLSRRVDADLDHEVHSHLAMLIEENIR |
Ga0066685_110347031 | 3300005180 | Soil | MPLFVKARSFVRNLFSTRRLEEDLDQEVRSHLAMLADENVRA |
Ga0066671_110687821 | 3300005184 | Soil | MPLFVKAKSFLRNLFRSNRVEIDLDHEVHSHLAMLVDENIRAGMS |
Ga0070709_116689002 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLAKTRSFLRNLFRYRHVDVDLHQEMESHLQLLAEENIRAGMQPKD |
Ga0070708_1020734741 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLFVKARSFLRNLFLPHRVDSDLDQEVRSHLELLVEENLRAGMLAKEAQRAA |
Ga0070698_1011408293 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPVRVKVRSFLRNLFLSWRVDADLDREVHAHLEMLIAENIRAG |
Ga0070730_102056452 | 3300005537 | Surface Soil | MVEVFTTPLVVKARSFLRNLFLSRRVDIHLDQEVHSHLELLIEENIQAGMPLREA* |
Ga0070730_102849352 | 3300005537 | Surface Soil | MVEGFTTPLVLKARSFLRNLFLSRRVDIHFDQEVHSHLELLIEENMQAGMPLKEA* |
Ga0070695_1003855051 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MVEVFTTPLVLKARSFLRNLFLSRRVDIHFDQKVHSHLELLIEENIQDGIALKEA* |
Ga0066661_108275972 | 3300005554 | Soil | MPLFVKVRSFLGNLFSLRRVDVDLDQEVHAHLELLIAENIRAGMPP |
Ga0066661_108778831 | 3300005554 | Soil | MPLYLKVRSFLGNLFSPRRVDADLDQEVHAHLELLIAENI |
Ga0066670_102391291 | 3300005560 | Soil | MPLILKVRSFVGNLFSQRRVDADLDQEVHAHLELLIA |
Ga0066670_104095821 | 3300005560 | Soil | VPLFVKVRSFLRNLISTRGVEADLDQEVHSHLEMLIEE |
Ga0066708_102732483 | 3300005576 | Soil | MPLFVKARSFLRNLFLSRHVETDLDQEVHSHLEMLIEE |
Ga0066708_109332111 | 3300005576 | Soil | MPLFVKVRSFLGNLFSLRRVDVDLDQEVHAHLELLIAENIRAGMP |
Ga0070766_103501812 | 3300005921 | Soil | MPLFARARSFLQNLFSSRRVEADLDHEVRSHFEMLKEEKIRDGMSADE |
Ga0070717_113644352 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLFVKARSFLRNLFLPHRVDSDLDQEVRSHLELLVEENL |
Ga0075018_104296551 | 3300006172 | Watersheds | MPVLVKVQSFLRNLLSRRRVDADLDQEVRSHLELLIAEKLRAGM |
Ga0070712_1001102104 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLFVKARSFLRNFFLSRRVDADLDQEVRAHLEMLIAENIRAGMPP |
Ga0070765_1021842682 | 3300006176 | Soil | VFNMPLLVKAQSFLRNLFSSRRADVDLDQEVRSHLE* |
Ga0066659_115672721 | 3300006797 | Soil | MPLFVKTRSLLRNLFLSRRVDADLDHEVHSHLAMLIEENIRAGLPPEEAQRAAQ |
Ga0073928_107859433 | 3300006893 | Iron-Sulfur Acid Spring | MPLFMKARSFLRNLFTSRRVEVDLDQEVHSHLELLTEENIRAGMPPHE |
Ga0099795_104747072 | 3300007788 | Vadose Zone Soil | MPLFAKFQGFLRNLFLSRRVDADLDREVHAHLELLITENIRAGMPPHE |
Ga0066710_1044719531 | 3300009012 | Grasslands Soil | MPLFVKARSFVRNLFSTRRLEEDLDQEVRSHLAMLADENVRAGMPP |
Ga0099829_112719871 | 3300009038 | Vadose Zone Soil | LVSGRSIVEVFTMPLLVKARSFLRNLFLSRRVEVDLDQEVHSHLDMLIAENVRARMPPHDAQRAA |
Ga0099828_117742312 | 3300009089 | Vadose Zone Soil | MPLRVKVRSFLRNLFSSRRVEVDLDQEVHAHLELLI |
Ga0066709_1002197231 | 3300009137 | Grasslands Soil | MPLLVKARSFLRNLLLSRRVEADLDQEVRSHLELLTEENIRAGMPPKEAQR |
Ga0099792_110513811 | 3300009143 | Vadose Zone Soil | MPLLVKARSFLRNLFSSHRVDVDLDQEVQAHLEMM |
Ga0126373_109877693 | 3300010048 | Tropical Forest Soil | MPLFVKAASFLRNLFSFRLVEKDLDEEVHAHLEML |
Ga0099796_105678202 | 3300010159 | Vadose Zone Soil | MPLFAKVQSFLRNFFSSRHVDIDLDQEVHAHLELLT |
Ga0074044_104321222 | 3300010343 | Bog Forest Soil | MPLLAKAQSFFRNLLFTRRMDADLDQEVHSHLEMLI |
Ga0126376_132235251 | 3300010359 | Tropical Forest Soil | MPLLVKARSFLRNLFSSGRRDGDLDQEIRVHLEMLI |
Ga0137392_107135852 | 3300011269 | Vadose Zone Soil | VPLFAKARSFLRNLFLSRRVEVDLDQEVHSHLEMLI |
Ga0137392_116311851 | 3300011269 | Vadose Zone Soil | MPLLVKARSFLRNLFLSRRVDLDLDQEIHSHLDMLIEEKMRAGMPPREAQRA |
Ga0137389_105625581 | 3300012096 | Vadose Zone Soil | MKVRSFLRNLIATRRAEADLDQELHSYIELLTQENI |
Ga0137382_101439021 | 3300012200 | Vadose Zone Soil | MPLFVKARSFLRNLLLSRRVEVDLDQEVHAHLEML |
Ga0137363_100485341 | 3300012202 | Vadose Zone Soil | VFIMPLFVKARRFLRNLFLSRRMDVDLDEEVRAHLELLIAENIR |
Ga0137363_107125242 | 3300012202 | Vadose Zone Soil | MQLFVKVRSLLRNLFSSLGVEVDLDEEVHAHFEMLTEENIRAGMPPSE |
Ga0137399_112456721 | 3300012203 | Vadose Zone Soil | MPLFAKVQSFLRNFFSSRHVDIDLEQEIHAHLELLIAENIRAGMPPH |
Ga0137362_113253301 | 3300012205 | Vadose Zone Soil | MPLFVKARSFLRNLFLSRRVDADLDQEVRSHLELLVAENIRAGMPP |
Ga0137376_101842303 | 3300012208 | Vadose Zone Soil | MPLFLKVRSFLGNLFLSRRVDVDLDQEVHAHLELLVAENIRTGMPP |
Ga0137376_110703342 | 3300012208 | Vadose Zone Soil | MPLFVKARSFLRNLLLTDRVDTDLDQEVHSHLAMLIEENIRAGMPPEE |
Ga0137379_103397873 | 3300012209 | Vadose Zone Soil | MLTFVKARSFLRNLIFSQRVEVDIDQEVHSHLEMLVS |
Ga0137387_104196821 | 3300012349 | Vadose Zone Soil | VNIMALIVKVGSFLRNLFSSRRVEIDLDQEVHSHLEML |
Ga0137360_103815133 | 3300012361 | Vadose Zone Soil | MPLFVKVGSFLRNHFLSRRVDADLDQEVHSHLELLIAENIRAGMPPEEAQ |
Ga0137396_106374673 | 3300012918 | Vadose Zone Soil | MPLRVKARSFLRNLFLFRRVEADLDQEVHAHLEML |
Ga0137394_102777905 | 3300012922 | Vadose Zone Soil | MPLFAKVQSFLRNFFSSRHVDIDLDQEVHAHLELLTA |
Ga0137413_103415793 | 3300012924 | Vadose Zone Soil | MPAFAKLQSFFRNLLSSRRVDADLDREVHAHLELLIAENIRA |
Ga0137419_112824172 | 3300012925 | Vadose Zone Soil | MPLLVKAQRLLRNLFSSRRVEVDLDEEVHAHLELLTEENIRGGMAAEQAR |
Ga0137404_101106552 | 3300012929 | Vadose Zone Soil | MPLFEKARSLLRNLFLSRRVEADLDHEVHSHLAMLIEENIRAGMPPHEAQR |
Ga0137404_111621901 | 3300012929 | Vadose Zone Soil | MSLFVKARSLLRNLFLSRRVEADLDHEVHSHLAMLIEENIRA |
Ga0137407_102756651 | 3300012930 | Vadose Zone Soil | MSLFVKARSLLRNLFLSRRVEADLDHEVHSHLAMLIEENIRAGMP |
Ga0137407_107011832 | 3300012930 | Vadose Zone Soil | MPLFEKARSLLRNLFLSRRVEADLDHEVHSHLAMLIEENIRAGMP |
Ga0137407_123468991 | 3300012930 | Vadose Zone Soil | MPLFAKFQGFLRNLFLSRRVDADLDREVHAHLELLIAENIRAG |
Ga0164299_107991521 | 3300012958 | Soil | EIFSVPLFVKVRSFLRNLFLSRRVEVDLDEEVHSHLEKLIK* |
Ga0181534_100659354 | 3300014168 | Bog | MSLLLKVRSFFRNLFLSPRVESDLEQELHCHLQMLTEENIRAGLSP |
Ga0137405_10949482 | 3300015053 | Vadose Zone Soil | MPLLVKVGSFLRNYFFSRRVDADLDQEVHSHLELLVAENIRAGMAPE |
Ga0137418_105087103 | 3300015241 | Vadose Zone Soil | MPLLVKARIFRRNFFLSRRVDEALAQGFLSHLEMVMAE |
Ga0182039_104461573 | 3300016422 | Soil | MPLFAKARSFLRNLIFVGRAEEDLDQEIRSHLQMLIDE |
Ga0182038_112076953 | 3300016445 | Soil | VPLFMKVRSFLRNIFLFRRVETDLDQELRSHLGMLTDDNI |
Ga0187779_103963022 | 3300017959 | Tropical Peatland | MPLFPKARSFLRNLFSARRVDTDLNQEVRSHLELLIDENIQAGMSPSEAQR |
Ga0187816_105312592 | 3300017995 | Freshwater Sediment | MRLVAKVRSFFRNLFFFRRLESDLDQEVRAHLEML |
Ga0187864_100164901 | 3300018022 | Peatland | MLFLVKARSFLRNLFLSRRVEVDLDAEVHSHLEML |
Ga0187867_101010093 | 3300018033 | Peatland | MPLLVKARSFLRNLFFTRRVDADLDQEVHAHLELLIEEKVRGGIGMAEA |
Ga0187875_103686911 | 3300018035 | Peatland | MSLLIKLRSFLRNLFKVRSVEADLDNELHSHLELLIEENLRAGM |
Ga0066667_117476082 | 3300018433 | Grasslands Soil | MPLFVKVRSFLGNLFSLRRVDVDLDQEVHAHLELLIAENIRAGMPPAEARR |
Ga0179592_100174983 | 3300020199 | Vadose Zone Soil | VTVRSFLRNLFLSRHVEADLDQEVQSHLEMLAEENIRA |
Ga0210407_101398183 | 3300020579 | Soil | MPLIPKVRSFLRNAFLSHRVEVDLDKEVHSHLGLLTEENIRAGMS |
Ga0210403_105124163 | 3300020580 | Soil | VPLFVKARSLLRNLFLSRGVEAELDQEVHSYLELLIAENIRAGMTPRE |
Ga0210403_113608352 | 3300020580 | Soil | MPLLVKVQSFLRNLFLSRRVDADLDQEVHTQLEILT |
Ga0210395_113711742 | 3300020582 | Soil | MPLFMRARSFLRSLFSSHRVEADLDQEIRSHLEMLIEE |
Ga0210401_105435883 | 3300020583 | Soil | MPLLVKVQSFLRNLFLSRRVDADLDQEVHTQLEIL |
Ga0210404_107889441 | 3300021088 | Soil | MPLLVKARSFLRNLFLSRRVEADLDHEVHAHLEMLIA |
Ga0210400_109471172 | 3300021170 | Soil | MPVLAKARSFLRNLFLSRRVEADLDQEVHAHLEMLIEENIRAGMPPNE |
Ga0210405_113182941 | 3300021171 | Soil | MPLFVKVQSLLRNLFLSRRVEAELEQEVHSHLELLIDENIRR |
Ga0210385_105761591 | 3300021402 | Soil | MPILLKLRSLVQNLFSSRRVEKDLDQEVQSHLEMVRDEKIREGMSADEAQ |
Ga0210385_114739592 | 3300021402 | Soil | VPLLVKARSFLRNLFSSRRVDGDLDQEVRSHLALL |
Ga0210387_100185567 | 3300021405 | Soil | MPLFVKARSFLRNLFLSRGVEAELDREVHSHLELLIA |
Ga0210387_100791701 | 3300021405 | Soil | MPVLAKARSFLRNLFLSRRVEVDLDKEVHSHLELL |
Ga0210387_107701303 | 3300021405 | Soil | MPLFVKVRSFLRNLFSIRRVEMGLDAEVRAHLEMLAEEKIAAGMKPE |
Ga0210387_115255242 | 3300021405 | Soil | MPLFVKARSFLRNLFLSRRVDADLDQEVRAHLEMLIAENIRAG |
Ga0210386_115564731 | 3300021406 | Soil | MSLLAKLRSFLRNLFSSQSVDADLDREVHSHLSMLIDENIRAGMPPDE |
Ga0210410_105426853 | 3300021479 | Soil | MPLLVKARSFLRNLFFVRRVDADLDREVHSHLEMLI |
Ga0124853_15150774 | 3300024056 | Freshwater Wetlands | MRLIVKARSFLRNLLLLRRVDLDLDQELRSHLELLT |
Ga0247667_10542871 | 3300024290 | Soil | LKARSFRRNLFLSRRVDIHFDQEVHSHLELLIEENIQAGIALKEA |
Ga0210132_10042093 | 3300025538 | Natural And Restored Wetlands | MPLLTKARSFLRNLFSTNRVEADLDQEIHSHLEMLIEE |
Ga0207685_100153885 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLFVKGRSLLRNLFWKQGVEADLDQEVHAHLEMLIA |
Ga0207699_109302121 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLAKVQSFLRNLLSTRRADVELDREVHSHLELLTDENIRAGM |
Ga0207693_100962981 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLFVKARSFLRNFFLSRRVDADLDQEVRAHLEMLIAENIRAG |
Ga0207665_102912974 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLVAKARNLLRNLFSRGRTENDLHNEVHSHLELLTDEYI |
Ga0209154_10839441 | 3300026317 | Soil | RRFLRNLFLSRHVETDLDQEVDSHLEMLIEENIRAGFR |
Ga0209472_10193351 | 3300026323 | Soil | MPLFVKARSFLRNLFSTRRVEVDLDQEVHAHLELLSEENMR |
Ga0209801_11161061 | 3300026326 | Soil | MPLILKVRSFVGNLFSPRRVDADLDQEVHAHLELLIAENIRAGMPPEEAR |
Ga0209804_11763721 | 3300026335 | Soil | MPLFVKARRFLRNLISSRRVEVDLDEEVHAHLELLTEENMRAG |
Ga0257160_10993521 | 3300026489 | Soil | MTLFVKARSFLRNLFLSRRVEIDLDQEVHSHLSMLVEENTRGGMS |
Ga0257153_10683671 | 3300026490 | Soil | MPLFVKARSFLRNLFLSHRVEADLDQEVHSHVAMLVEENIRAGMSPKEA |
Ga0257168_10938431 | 3300026514 | Soil | MPLLVKARSFLRNLFLSRRVDLDLDQEIHSHLDMLI |
Ga0209378_12125842 | 3300026528 | Soil | MRLIAKIRSLLRNLFLSHRVEADLDHELRSHLAMLTEE |
Ga0209807_12172881 | 3300026530 | Soil | MPLFVQAKSFLRNLFRSNRVEIDLDHEVHSHLAMLVDENIRAGMSAQQ |
Ga0209156_103837742 | 3300026547 | Soil | MPLFVKARSFLRNFFLSRRVDADLDQEVRAHLEMLIAENIRAGM |
Ga0209161_104406402 | 3300026548 | Soil | MPLAEKARSLLRNLFWSRRVEADLDHEVHSHLEMLV |
Ga0209474_103823513 | 3300026550 | Soil | MPLFVKARSFLRNLFLSRRVEIDLDQEVHAHLEMMAEENIRAGMQP |
Ga0209648_104268611 | 3300026551 | Grasslands Soil | LLVKARSFLRNLFLSRRVEVDLDQEVHSHLDMLIAENVRARMPPHDAKSQSFSSERR |
Ga0179587_110879491 | 3300026557 | Vadose Zone Soil | MPLFVKARSFLRNLFLSRRVEADLDKEVHSHLELMIEENVRA |
Ga0208859_10358252 | 3300027069 | Forest Soil | MPLLVKARSFLRNLFFTRRVDADLDQEVHSHLELLI |
Ga0209421_10848322 | 3300027432 | Forest Soil | MPLVAKARSFLRNLFFTGCVDADLEREVQSHLEILIEEKMR |
Ga0209008_10871461 | 3300027545 | Forest Soil | MPLLVKARSFFCNLFFTRRVDADLDQEVRSHLELLIEEKMRGGMPAAEARR |
Ga0209422_10570922 | 3300027629 | Forest Soil | MPLFVKARSFLRNLFLPHRVDSDLDQEVRSHLELLVEENLRAGMPAK |
Ga0209626_11686991 | 3300027684 | Forest Soil | MPLFSKVRSFLRNFFLSRRIDVDLDDEVRAHLELMTEEN |
Ga0209038_102283651 | 3300027737 | Bog Forest Soil | MPLLVKAQSFLRNLFLARRVDADLDREVNAHLEMLIEE |
Ga0209689_13919272 | 3300027748 | Soil | MPLAEKARSLLRNLFWSRRVEADLDHEVHSHLEMLVA |
Ga0209073_104254932 | 3300027765 | Agricultural Soil | MPLLVKARSFLRNLFSSRRVEADLDQEVRAHLEMMTEEKIRA |
Ga0209772_100525581 | 3300027768 | Bog Forest Soil | MPLLVKARSFLRNLFFTRRVDADLDQEVRSHLEMLV |
Ga0209060_100626244 | 3300027826 | Surface Soil | MVPLVAKVRSFFRNVFLSRRVESDLDQEVRSHFEMLKEENL |
Ga0209166_100211596 | 3300027857 | Surface Soil | MVEVFTTPLVVKARSFLRNLFLSRRVDIHLDQEVHSHLELLIEENIQAGMPLREA |
Ga0209166_101938703 | 3300027857 | Surface Soil | MVEGFTTPLVLKARSFLRNLFLSRRVDIHFDQEVHSHLELLIEENMQAGMPLKEA |
Ga0209380_102916492 | 3300027889 | Soil | MRLLVKARSFLRNLFYSRRMDADLDQEVHAHLELLIEEKMRAGM |
Ga0209380_103093392 | 3300027889 | Soil | MPLFARARSFLQNLFSSRRVEADLDHEVRSHFEMLKEEKIRDGMSADEAQR |
Ga0265351_10256471 | 3300028020 | Soil | MPLSVKLRSFLRNLFWSRRAEIDLDQEIHSYLEMLTEENI |
Ga0209526_102316563 | 3300028047 | Forest Soil | MPLFVKARSFLRNLFLSRHVEADLDNELRSHLELMTAENLRAG |
Ga0247675_10677731 | 3300028072 | Soil | MPLLAKVQSFLRNLLSTRRADVELDREVHSHLELLTDENIRAGMPSKEAER |
Ga0265744_1156772 | 3300031017 | Soil | MPLLVKARSFLRNLFFVRRVDADLDSEVHAHLEMLVEEKMRAGMPAAAARRA |
Ga0170824_1281629911 | 3300031231 | Forest Soil | MPLFVKARSFLRNFFLSRRVDADLDQEVRAHLEMLIA |
Ga0318571_102828161 | 3300031549 | Soil | MLLFAKARSFLRNLLFTERVEVDLDQEVRSHLQMLVDENIRAGM |
Ga0310686_1167879931 | 3300031708 | Soil | MPLSVKLRSFLRNLFWSRQAEIDLDQEIHSYLEMLTGEHSCGLAAE |
Ga0307476_104853141 | 3300031715 | Hardwood Forest Soil | MPLAVKVRSFLRNLISSRHVATDLDAEVRAHLELLTEENIRAGMSPQEAQR |
Ga0307469_118647432 | 3300031720 | Hardwood Forest Soil | MPLLVKARSFLRNLFPSRSVEGDLDEEIQSHLEMVTAENIRAGMTP |
Ga0307468_1021090481 | 3300031740 | Hardwood Forest Soil | MSLSLKLRSFLRNLFFSQRVDADLEYEVHSHLNLLIEENIRAGMSPEEA |
Ga0307477_104300452 | 3300031753 | Hardwood Forest Soil | MPLFVKARSFLRNLFLSRRVDVDLDQEVRSHLELLIAEKIRAGMPPQEAQR |
Ga0307477_105545363 | 3300031753 | Hardwood Forest Soil | VPLLVKARSFLRNLFSFRGVDTDLDQEVHAHLEMLIAENIRAGMTQEEAQ |
Ga0310917_109128442 | 3300031833 | Soil | MPVVPLIRSFVRNLFLPRSTESDLDQEIQSHLEMLADEY |
Ga0318511_105897841 | 3300031845 | Soil | MLLFAKARSFLRNLLFTERVEVDLDQEVRSHLQMLVDENIRAGMGPR |
Ga0306921_126217992 | 3300031912 | Soil | MPVFAKIHSFVRNLFLSRRVEADLAREVHAHLQMLMDENIRAGMTPSEAERAAR |
Ga0310909_104826873 | 3300031947 | Soil | MPLFVKARSLLRNLFSSGRRDGDLDQEIHAHLEMLIEENIRAGMPP |
Ga0306922_100656461 | 3300032001 | Soil | MPLFAKARSFLRNLIFVGRAEEDLDQEVRSHLQMLIDENLKA |
Ga0318504_104487243 | 3300032063 | Soil | MPLFQKAQSFLRNLFTFNRIETDLDHEVHSHLEMLTEENLR |
Ga0306924_120200181 | 3300032076 | Soil | MPLFAKARSFLRNLIFVGRAEEDLDQEVRSHLQMLIDENLKAGLWREE |
Ga0307470_116768682 | 3300032174 | Hardwood Forest Soil | MPLFVKAKSFLRNLFFSRRVEVDLDQEVRAHLEMLIAENIR |
Ga0307471_1006565551 | 3300032180 | Hardwood Forest Soil | MPLRVKVRSFLRNLFLSRRVDRDLDQEVHSHLELLTDENI |
Ga0307471_1014470703 | 3300032180 | Hardwood Forest Soil | MPLLVKARSFLRNLFLSRRVDVDLDQEVRSHLELLIDENI |
Ga0306920_1018110592 | 3300032261 | Soil | MPLFVRARNLLRNLFSSRSAEKDLDQEMHAHLEMLMEE |
Ga0335083_101465771 | 3300032954 | Soil | MPLFTKARSFLRNLLSFRRIDQDLDEEVRAHLEMLTE |
Ga0316624_106058961 | 3300033486 | Soil | MPLLAKVQSFLRNLLSIRRVEVELDREVHSHLELLT |
⦗Top⦘ |