NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049692

Metagenome / Metatranscriptome Family F049692

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049692
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 69 residues
Representative Sequence RFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Number of Associated Samples 126
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 2.07 %
% of genes near scaffold ends (potentially truncated) 95.89 %
% of genes from short scaffolds (< 2000 bps) 89.04 %
Associated GOLD sequencing projects 121
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (52.055 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(31.507 % of family members)
Environment Ontology (ENVO) Unclassified
(81.507 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(86.986 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.47%    β-sheet: 0.00%    Coil/Unstructured: 50.53%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00149Metallophos 13.70
PF11753DUF3310 1.37
PF12850Metallophos_2 0.68
PF17212Tube 0.68
PF02839CBM_5_12 0.68



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms67.12 %
UnclassifiedrootN/A32.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000199|SI39nov09_10mDRAFT_c1015502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255667Open in IMG/M
3300001354|JGI20155J14468_10066346Not Available1419Open in IMG/M
3300001354|JGI20155J14468_10093082All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551084Open in IMG/M
3300001516|TahiMoana_1092806Not Available1031Open in IMG/M
3300001739|JGI24658J20074_1006548All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551394Open in IMG/M
3300001743|JGI24515J20084_1003269All Organisms → Viruses1460Open in IMG/M
3300001973|GOS2217_10149564Not Available1867Open in IMG/M
3300002231|KVRMV2_100026960All Organisms → cellular organisms → Bacteria → Proteobacteria4223Open in IMG/M
3300002231|KVRMV2_100571827All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551100Open in IMG/M
3300002242|KVWGV2_10007384Not Available2022Open in IMG/M
3300004110|Ga0008648_10061433All Organisms → cellular organisms → Bacteria → PVC group1067Open in IMG/M
3300004110|Ga0008648_10169837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255597Open in IMG/M
3300004829|Ga0068515_102039All Organisms → Viruses → Predicted Viral2594Open in IMG/M
3300004951|Ga0068513_1036338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255540Open in IMG/M
3300005239|Ga0073579_1187535All Organisms → Viruses15099Open in IMG/M
3300005408|Ga0066848_10197099All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255540Open in IMG/M
3300005423|Ga0066828_10188878All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255684Open in IMG/M
3300005426|Ga0066847_10041946All Organisms → Viruses1469Open in IMG/M
3300005430|Ga0066849_10199746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255779Open in IMG/M
3300005430|Ga0066849_10320189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255591Open in IMG/M
3300005514|Ga0066866_10155366All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255817Open in IMG/M
3300005523|Ga0066865_10079421Not Available1171Open in IMG/M
3300005523|Ga0066865_10190359All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255767Open in IMG/M
3300005596|Ga0066834_10029459Not Available1905Open in IMG/M
3300005735|Ga0076923_112228All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551013Open in IMG/M
3300005969|Ga0066369_10029332Not Available2013Open in IMG/M
3300006025|Ga0075474_10071575Not Available1145Open in IMG/M
3300006311|Ga0068478_1236034All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255724Open in IMG/M
3300006336|Ga0068502_1315628Not Available934Open in IMG/M
3300006336|Ga0068502_1527751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255606Open in IMG/M
3300006340|Ga0068503_10410458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255502Open in IMG/M
3300006357|Ga0075502_1646978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255557Open in IMG/M
3300006401|Ga0075506_1737030All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255518Open in IMG/M
3300006404|Ga0075515_10064758Not Available2002Open in IMG/M
3300006414|Ga0099957_1362565All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255580Open in IMG/M
3300006565|Ga0100228_1045186All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255773Open in IMG/M
3300006736|Ga0098033_1159747All Organisms → cellular organisms → Bacteria → PVC group630Open in IMG/M
3300006738|Ga0098035_1215983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255637Open in IMG/M
3300006750|Ga0098058_1112502All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255731Open in IMG/M
3300006753|Ga0098039_1187904All Organisms → cellular organisms → Bacteria → PVC group701Open in IMG/M
3300006754|Ga0098044_1145146Not Available953Open in IMG/M
3300006789|Ga0098054_1289033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255587Open in IMG/M
3300006793|Ga0098055_1280319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255624Open in IMG/M
3300006793|Ga0098055_1291127All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255611Open in IMG/M
3300006841|Ga0068489_109934All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551268Open in IMG/M
3300006925|Ga0098050_1013588Not Available2338Open in IMG/M
3300006925|Ga0098050_1090940All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255783Open in IMG/M
3300006925|Ga0098050_1119066All Organisms → cellular organisms → Bacteria → PVC group670Open in IMG/M
3300006926|Ga0098057_1049624Not Available1031Open in IMG/M
3300006926|Ga0098057_1060542Not Available926Open in IMG/M
3300006927|Ga0098034_1128440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255719Open in IMG/M
3300007513|Ga0105019_1004988Not Available14695Open in IMG/M
3300008220|Ga0114910_1052944All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551295Open in IMG/M
3300008220|Ga0114910_1156642All Organisms → cellular organisms → Bacteria → PVC group646Open in IMG/M
3300009409|Ga0114993_11338629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255501Open in IMG/M
3300009437|Ga0115556_1009333Not Available5462Open in IMG/M
3300009529|Ga0114919_10776566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255650Open in IMG/M
3300009543|Ga0115099_10163559Not Available1760Open in IMG/M
3300009603|Ga0114911_1136311All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255695Open in IMG/M
3300009604|Ga0114901_1158504All Organisms → cellular organisms → Bacteria → PVC group675Open in IMG/M
3300009605|Ga0114906_1178251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255720Open in IMG/M
3300009619|Ga0105236_1041203All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255595Open in IMG/M
3300009619|Ga0105236_1063244All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255509Open in IMG/M
3300009620|Ga0114912_1172869All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255500Open in IMG/M
3300010149|Ga0098049_1134019Not Available769Open in IMG/M
3300010151|Ga0098061_1177609All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255762Open in IMG/M
3300010153|Ga0098059_1254482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255676Open in IMG/M
3300010155|Ga0098047_10050201Not Available1648Open in IMG/M
3300010300|Ga0129351_1044572Not Available1822Open in IMG/M
3300011013|Ga0114934_10293357All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255734Open in IMG/M
3300012524|Ga0129331_1422475All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255561Open in IMG/M
3300012525|Ga0129353_1317549All Organisms → Viruses1559Open in IMG/M
3300012528|Ga0129352_10642903All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255602Open in IMG/M
3300012953|Ga0163179_10874970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255775Open in IMG/M
3300017702|Ga0181374_1081095All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255540Open in IMG/M
3300017713|Ga0181391_1024165Not Available1500Open in IMG/M
3300017732|Ga0181415_1088033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255700Open in IMG/M
3300017738|Ga0181428_1112260All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255638Open in IMG/M
3300017739|Ga0181433_1062333Not Available937Open in IMG/M
3300017744|Ga0181397_1081412Not Available863Open in IMG/M
3300017745|Ga0181427_1156834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255551Open in IMG/M
3300017746|Ga0181389_1075586Not Available950Open in IMG/M
3300017753|Ga0181407_1159820All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255554Open in IMG/M
3300017757|Ga0181420_1090037Not Available951Open in IMG/M
3300017760|Ga0181408_1061563Not Available995Open in IMG/M
3300017765|Ga0181413_1241709All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255533Open in IMG/M
3300017772|Ga0181430_1092989All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255902Open in IMG/M
3300017775|Ga0181432_1079456All Organisms → cellular organisms → Bacteria → PVC group956Open in IMG/M
3300017775|Ga0181432_1105614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255842Open in IMG/M
3300017775|Ga0181432_1229667All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255584Open in IMG/M
3300017781|Ga0181423_1076749Not Available1320Open in IMG/M
3300017956|Ga0181580_10537617All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255759Open in IMG/M
3300017967|Ga0181590_10737488All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255660Open in IMG/M
3300018036|Ga0181600_10100244All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1707Open in IMG/M
3300018428|Ga0181568_10419049Not Available1076Open in IMG/M
3300019938|Ga0194032_1011947Not Available924Open in IMG/M
3300020248|Ga0211584_1066297Not Available561Open in IMG/M
3300020459|Ga0211514_10029867All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2880Open in IMG/M
3300020469|Ga0211577_10131519Not Available1703Open in IMG/M
3300020477|Ga0211585_10482890All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255702Open in IMG/M
3300021347|Ga0213862_10312348All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255558Open in IMG/M
3300021957|Ga0222717_10080030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria2068Open in IMG/M
3300022057|Ga0212025_1043811All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255769Open in IMG/M
3300022061|Ga0212023_1041910Not Available636Open in IMG/M
3300022068|Ga0212021_1044296Not Available894Open in IMG/M
3300022069|Ga0212026_1078676All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255501Open in IMG/M
3300022227|Ga0187827_10358137Not Available919Open in IMG/M
3300023178|Ga0255759_10046183All Organisms → Viruses3254Open in IMG/M
(restricted) 3300023210|Ga0233412_10536803All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255530Open in IMG/M
3300023273|Ga0255763_1068749Not Available1716Open in IMG/M
(restricted) 3300024052|Ga0255050_10076273All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255747Open in IMG/M
(restricted) 3300024062|Ga0255039_10424451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255577Open in IMG/M
3300024344|Ga0209992_10041663Not Available2249Open in IMG/M
3300024344|Ga0209992_10284235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255679Open in IMG/M
3300025072|Ga0208920_1028649All Organisms → cellular organisms → Bacteria → PVC group1173Open in IMG/M
3300025072|Ga0208920_1069093All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255682Open in IMG/M
3300025109|Ga0208553_1097451All Organisms → cellular organisms → Bacteria → PVC group684Open in IMG/M
3300025132|Ga0209232_1017086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales2889Open in IMG/M
3300025141|Ga0209756_1208177All Organisms → cellular organisms → Bacteria → PVC group743Open in IMG/M
3300025151|Ga0209645_1110306Not Available883Open in IMG/M
3300025168|Ga0209337_1100546All Organisms → Viruses → Predicted Viral1349Open in IMG/M
3300025257|Ga0207899_1053836All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255628Open in IMG/M
3300025282|Ga0208030_1063811Not Available1006Open in IMG/M
3300025286|Ga0208315_1076001Not Available834Open in IMG/M
3300025300|Ga0208181_1064624All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255735Open in IMG/M
3300025685|Ga0209095_1060210Not Available1321Open in IMG/M
3300025704|Ga0209602_1042657Not Available1949Open in IMG/M
3300025707|Ga0209667_1166046All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255642Open in IMG/M
3300025722|Ga0209660_1186860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255667Open in IMG/M
3300025873|Ga0209757_10174295All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255678Open in IMG/M
3300026103|Ga0208451_1014404All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255845Open in IMG/M
3300026201|Ga0208127_1022198Not Available2188Open in IMG/M
3300026210|Ga0208642_1037036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C2551213Open in IMG/M
3300026210|Ga0208642_1073490All Organisms → cellular organisms → Bacteria → PVC group763Open in IMG/M
3300026263|Ga0207992_1149428Not Available586Open in IMG/M
3300027780|Ga0209502_10285688Not Available716Open in IMG/M
3300028137|Ga0256412_1125362Not Available942Open in IMG/M
3300028282|Ga0256413_1213188All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255691Open in IMG/M
3300031510|Ga0308010_1140374Not Available909Open in IMG/M
3300031655|Ga0308018_10140285All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255833Open in IMG/M
3300032006|Ga0310344_10599777Not Available942Open in IMG/M
3300032006|Ga0310344_11014614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255695Open in IMG/M
3300033742|Ga0314858_111897All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255695Open in IMG/M
3300033742|Ga0314858_162288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255574Open in IMG/M
3300034695|Ga0372840_233076All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → uncultured Mediterranean phage uvDeep-CGR2-KM22-C255545Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine31.51%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.64%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean7.53%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous7.53%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.11%
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine3.42%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.42%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.42%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.74%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic2.05%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.05%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.05%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.05%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment2.05%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface2.05%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine1.37%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.37%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine1.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.37%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.68%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.68%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.68%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water0.68%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.68%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.68%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.68%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.68%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.68%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000199Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10mEnvironmentalOpen in IMG/M
3300001354Pelagic Microbial community sample from North Sea - COGITO 998_met_05EnvironmentalOpen in IMG/M
3300001516Hydrothermal vent plume microbial communities from Tahi Moana, Pacific Ocean, of black smokersEnvironmentalOpen in IMG/M
3300001739Marine viral communities from the Deep Pacific Ocean - MSP-121EnvironmentalOpen in IMG/M
3300001743Marine viral communities from the Pacific Ocean - LP-38EnvironmentalOpen in IMG/M
3300001973Marine microbial communities from Bermuda, Atlantic Ocean - GS001EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002242Marine sediment microbial communities from Kolumbo Volcano mats, Greece - white/grey matEnvironmentalOpen in IMG/M
3300004110Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNAEnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005408Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV72EnvironmentalOpen in IMG/M
3300005423Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47EnvironmentalOpen in IMG/M
3300005426Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201310SV74EnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005514Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263EnvironmentalOpen in IMG/M
3300005523Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265EnvironmentalOpen in IMG/M
3300005596Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43BEnvironmentalOpen in IMG/M
3300005735Seawater microbial communities from Vineyard Sound, MA, USA - control T0EnvironmentalOpen in IMG/M
3300005969Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_AEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006311Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_1000mEnvironmentalOpen in IMG/M
3300006336Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500mEnvironmentalOpen in IMG/M
3300006340Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0770mEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006414Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500mEnvironmentalOpen in IMG/M
3300006565Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0125mEnvironmentalOpen in IMG/M
3300006736Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaGEnvironmentalOpen in IMG/M
3300006738Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaGEnvironmentalOpen in IMG/M
3300006750Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaGEnvironmentalOpen in IMG/M
3300006753Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006841Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT234_2_0200mEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006926Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaGEnvironmentalOpen in IMG/M
3300006927Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaGEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300008220Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_908EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009437Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009603Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_904EnvironmentalOpen in IMG/M
3300009604Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16EnvironmentalOpen in IMG/M
3300009605Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9EnvironmentalOpen in IMG/M
3300009619Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250EnvironmentalOpen in IMG/M
3300009620Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_51EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010155Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaGEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300017702Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaGEnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019938Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW8Nov16_MGEnvironmentalOpen in IMG/M
3300020248Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556118-ERR599141)EnvironmentalOpen in IMG/M
3300020459Marine microbial communities from Tara Oceans - TARA_X000000368 (ERX555913-ERR599095)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020477Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022227Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300023178Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaGEnvironmentalOpen in IMG/M
3300023210 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MGEnvironmentalOpen in IMG/M
3300023273Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025072Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025109Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025257Marine viral communities from the Deep Pacific Ocean - MSP-134 (SPAdes)EnvironmentalOpen in IMG/M
3300025282Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes)EnvironmentalOpen in IMG/M
3300025286Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes)EnvironmentalOpen in IMG/M
3300025300Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 (SPAdes)EnvironmentalOpen in IMG/M
3300025685Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404 (SPAdes)EnvironmentalOpen in IMG/M
3300025704Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes)EnvironmentalOpen in IMG/M
3300025707Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_165m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025722Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_100m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300026103Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes)EnvironmentalOpen in IMG/M
3300026201Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes)EnvironmentalOpen in IMG/M
3300026210Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031655Marine microbial communities from water near the shore, Antarctic Ocean - #282EnvironmentalOpen in IMG/M
3300032006Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MGEnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034695Seawater microbial communities from the Northeast subarctic Pacific Ocean - P26_June_2012_500mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SI39nov09_10mDRAFT_101550213300000199MarineLQQASASVEKGLLQQGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
JGI20155J14468_1006634643300001354Pelagic MarineGKRFLPIWLQQASASVEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
JGI20155J14468_1009308213300001354Pelagic MarineVGKRFLPIWLQQASASVEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
TahiMoana_109280613300001516Hydrothermal Vent PlumeATQNVSEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF*
JGI24658J20074_100654813300001739Deep OceanIERAINIGGHAGQRFLPIWLQTSVKTVSKGFEKDGISPDLAADVALEFVLGQLGHPKYKGPRTSQYKTKGLVRSPYETLF*
JGI24515J20084_100326953300001743MarineIWLQTASQNVAEGLQRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF*
GOS2217_1014956413300001973MarineVGMRFLPIWLQSASRNVAEGLQEQGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF*
KVRMV2_10002696033300002231Marine SedimentMKIGGHVGMRFLPIWLQSASRGIAEGLQKDGLSLDLASDTAVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
KVRMV2_10057182723300002231Marine SedimentMRFLPIWLQSASRTIAEGLQQEGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTRGLVRDPYKTLF*
KVWGV2_1000738483300002242Marine SedimentIGKRFLPIWLQTASQNISDGLQRDGLSADLAIDTAVDFVLGQSGHPRYKGPRTYTI*
Ga0008648_1006143343300004110MarineKRFLPIWLQQASASVEKGLHTDGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKDIF
Ga0008648_1016983733300004110MarineKRFLPIWLQQASASVEKGLQKDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0068515_10203983300004829Marine WaterGMRFLPIWLQSASRDIAEKLQSDGLSLDEASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF*
Ga0068513_103633813300004951Marine WaterKIGGHVGMRFLPIWLQSASRSIAEGLQAEGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF*
Ga0073579_118753593300005239MarineGHVGKRFLPIWLQQAANSVKEGMLREGLSLDLASDTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0066848_1019709923300005408MarineINKKDDSAIDRAINIGGHAGQRFLPIWLQTAVRTTAKGFERDGISKDLAADVALEFVLGQLGHPKYKGPRTTQYKTRGLVRSPYEMLF*
Ga0066828_1018887833300005423MarineFLPIWLQQASSSVSKGLQRDGLSADLAADVSVDFVLGQMGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0066847_1004194653300005426MarineIWLQTASQNVAEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKMKGLVRSPYETLF*
Ga0066849_1019974613300005430MarineWLQTASQNIAEGLERDGLSADLAIDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0066849_1032018933300005430MarineGKRFLPIWLQTASQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0066866_1015536613300005514MarineMGGHSSMRFLPIWLQTSVRTVAEGLEKDGISADLAADVALEFVLGQSGHPKYKGPRTSQYKTKGLVRSPYETLF*
Ga0066865_1007942143300005523MarineIGGHVGMRFLPIWLQSASRSIAEGLQAEGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF*
Ga0066865_1019035913300005523MarineGMRFLPIWLQSASRDIAEGLERDGLSADLAADTALDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0066834_1002945913300005596MarineSAIDRAINIGGHAGQRFLPIWLQTAVRTTAKGFEKDGISKDLAADVALEFVLGQIGHPKYKGPRTTQYKTKGLVRSPYETLF*
Ga0076923_11222833300005735MarineHVGKRFLPIWLQQASASIEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0066369_1002933213300005969MarineQRFLPIWLQTAVRTTAKGFEKDGISKDLAADVALEFVLGQIGHPKYKGPRTSQYKLKGLVRSPYETLF*
Ga0075474_1007157543300006025AqueousQSASRDIAEKLQSDGLSLDEASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF
Ga0068478_123603433300006311MarineFLPIWLQTASQNVAEGLQRDGLSVDLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0068502_131562813300006336MarineNIGGHAGQRFLPIWLQTAVRTTAKGFERDGISKDLAADVALEFVLGQIGHPKYKGPRTSQYKTRGLVRSPYETLF*
Ga0068502_152775133300006336MarineIWLQTATQNVAEGLQRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0068503_1041045823300006340MarineHINKKDDSAIDRAINIGGHAGQRFLPIWLQTAVRTTAKGFEKDGISKDLAADVALEFVLGQIGHPKYKGPRTSQYKTRGLVRSPYETLF*
Ga0075502_164697813300006357AqueousRFLPIWLQSASKDIAEKLQSDGLSLDEASNTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRNPYETLF*
Ga0075506_173703013300006401AqueousVGMRFLPIWLQSASKDIAEKLQSDGLSLDEASNTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRNPYETLF*
Ga0075515_1006475813300006404AqueousVGMRFLPIWLQSASRDIAEKLQSDGLSLDEASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF*
Ga0099957_136256533300006414MarineFMPIWLQTASQNVSEGLKRDGLSADLAADTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0100228_104518633300006565MarineMRFLPIWLQSASRDIAEGLERDGLSADLAADTALDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0098033_115974723300006736MarineVGMRFLPIWLQTASRNIAEGLQKDGLSADLAADVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098035_121598333300006738MarineAIDRAINIGGHAGQRFLPIWLQTAVRTTAKGFEKDGISKDLAADVALEFVLGQLGHPKYKGPRTTQYKTRGLVRSPYEMLF*
Ga0098058_111250213300006750MarineKIGGQIGKRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098039_118790413300006753MarineGGHVGMRFLPIWLQTASRNIAEGLQKDGLSADLAADVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYEMLF*
Ga0098044_114514613300006754MarineQTASQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0098054_128903323300006789MarineGQVGKRFLPIWLQTASQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098055_128031913300006793MarineRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDIVQGQSGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0098055_129112733300006793MarineLKIGGQVGKRFLPIWLQTASQNIAEGLERDGLSADLAIDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0068489_10993443300006841MarineAIDRAVKVGGHTGMRFLPIWLQTAVRTTAKGFEQDGINKDLAADVALEFVLGQIGHPKYKGPRTTQYKTQGLVRSPYETLF*
Ga0098050_101358813300006925MarineKIGGQVGKRFLPIWLQTASQNIAEGLERDGLSADLAIDTAVDFVLGQSGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0098050_109094043300006925MarineRFLPIWLQSASRDIAEGLERDGLSLDLASDVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098050_111906613300006925MarineASQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098057_104962413300006926MarineNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098057_106054243300006926MarineGGHVGMRFLPIWLQTASRNIAEGLQKDGLSADLAANVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098034_112844013300006927MarineVGMRFLPIWLQTASRSVAEGLQKDGLSADLAADVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0105019_100498813300007513MarineIGKRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0114910_105294443300008220Deep OceanLPIWLQTASQNIAEGLERDGLSADLAIDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0114910_115664233300008220Deep OceanLQTATQNISEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0114993_1133862923300009409MarineQTASQNISDGLQRDGLSADLAVDTAVDFVLGQSGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0115556_1009333133300009437Pelagic MarineGHVGKRFLPIWLQQASASVEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0114919_1077656633300009529Deep SubsurfaceQVGAKFLPIWLQQASRQISDRLESESGISPDLAMDVAVDFVLGQSGHPRYKGPRYTQYKLSGLARSPYEALF*
Ga0115099_1016355953300009543MarineGKRFLPIWLQQATASIEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0114911_113631113300009603Deep OceanFLPIWLQQASSSVSEGLQRDGLTADLAADVSVDFVLGQMGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0114901_115850433300009604Deep OceanLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0114906_117825113300009605Deep OceanQSASKNIAEELKKEGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTRGLVRSPYEMLF
Ga0105236_104120313300009619Marine OceanicIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYKGPRYTQYKTKGLVRSPYETLF*
Ga0105236_106324433300009619Marine OceanicGKRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0114912_117286923300009620Deep OceanWSPHINKKDDSAIDRAINIGGHAGQRFLPIWLQTAVRTTAEGFERDGISKDLAADVALEFVLGQLGHPKYKGPRTTQYKTRGLVRSPYEMLF*
Ga0098049_113401943300010149MarineSQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098061_117760913300010151MarineIGKRFLPIWLQTASQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0098059_125448233300010153MarineQYLTTGWSPRINKKDDSAIDRAINIGGHAGQRFLPIWLQTAVKTTAKGFEKDGISKDLAADVALEFVLGQLGHPKYKGPRTTQYKTRGLVRSPYEMLF*
Ga0098047_1005020113300010155MarineHVGRRFLPIWLQTASQNVAKGLERDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0129351_104457253300010300Freshwater To Marine Saline GradientIWLQSASRDIAEGLERDGLSLDLASDVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0114934_1029335713300011013Deep SubsurfaceKIGGQIGKRFLPIWLQTASQNISDGLQRDGLSADLAIDTAVDFVLGQSGHPRYKGPRTSQYKTKGLVRSPYETLF*
Ga0129331_142247513300012524AqueousFLPIWLQQATASIEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0129353_131754953300012525AqueousPIWLQSASKDIAEKLQSDGLSLDEASNTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRNPYETLF*
Ga0129352_1064290333300012528AqueousMRFLPIWLQSASKDIAEKLQSDGLSLDEASNTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRNPYETLF*
Ga0163179_1087497043300012953SeawaterFLPIWLQQASASIEQGLRREGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF*
Ga0181374_108109533300017702MarineLPIWLQSASRNVAKGLEKDGLSADLAADTALDFLLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0181391_102416553300017713SeawaterLPIWLQTASQNIAEGLERDGLSADLAADTAVDFVLGQLGHPRYNGPRYTQYKTKGLVRSPYETLF
Ga0181415_108803333300017732SeawaterWLQQATASIEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYNGPRYTQYKTKGLVRSPYETLF
Ga0181428_111226033300017738SeawaterKIGGQIGKRFLPIWLQTASQNISDGLQRDGLSADLAIDTAVDFVLGQSGHPRYNGPRYTQYKTKGLVRSPYETLF
Ga0181433_106233313300017739SeawaterRFLPIWLQQATASIEQGLLKDGLSLDLAADTSVDFILGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0181397_108141213300017744SeawaterIGGHVGKRFLPIWLQQASASIEQGLRKEGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0181427_115683413300017745SeawaterFLPIWLQQASASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0181389_107558613300017746SeawaterLQQATNSIKEGLLQQGLSLDLASDTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETL
Ga0181407_115982013300017753SeawaterQQASASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0181420_109003743300017757SeawaterFLPIWLQTASQNISDGLQRDGLSADLAIDTAVDFVLGQSGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0181408_106156343300017760SeawaterWLQTASQNISEGLQRDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0181413_124170933300017765SeawaterGGHVGKRFLPIWLQQATASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0181430_109298913300017772SeawaterGLKIGGQIGKRFLPIWLQTASQNISDGLQRDGLSADLAIDTAVDFVLGHSGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0181432_107945613300017775SeawaterQSASQNIAEGLQRDGLSADLAADTAVDFVLGQLGHPRYQGPRYTQYKTRGLVRSPYETLF
Ga0181432_110561413300017775SeawaterGGHVGRRFLPIWLQTASQNVAEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTRGLVRSPYETLF
Ga0181432_122966733300017775SeawaterDSAIDRAINIGGHAGQRFLPIWLQTAVRTTAKGFERDGISKDLAADVALEFVLGQIGHPKYKGPRTTQYKTKGLVRYPYEMLF
Ga0181423_107674943300017781SeawaterVGKRFLPIWLQTASQNIAEGLERDGLSADLAADTAVDFVLGQLGHPRYNGPRYTQYKTKGLVRSPYETLF
Ga0181580_1053761733300017956Salt MarshVGMRFLPIWLQSASRDIAEKLQSDGLSLDEASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF
Ga0181590_1073748813300017967Salt MarshGLKIGGHVGMRFLPIWLQSASRDIAEKLQSDGLSLDEASNTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRNPYETLF
Ga0181600_1010024453300018036Salt MarshLQQATNSIKEGLLQQGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETL
Ga0181568_1041904943300018428Salt MarshWLQSTTREISEALQGDGLSLDVASDTAMDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0194032_101194743300019938FreshwaterLSIGGHVGKRFLPIWLQQATASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0211584_106629713300020248MarineQSASRNIAEGLQEQGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF
Ga0211514_1002986793300020459MarineSIGGHVGKRFLPIWLQQASASIEQGLRREGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0211577_1013151953300020469MarineIGGHVGKRFLPIWLQQATASIEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0211585_1048289013300020477MarineRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0213862_1031234813300021347SeawaterLSIGGHVGKRFLPIWLQQASASIEQGVRKEGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0222717_1008003013300021957Estuarine WaterQASASVEKGLQKDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0212025_104381143300022057AqueousWLQSASRDIAEKLQSDGLSLDEASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLIRDPYKTLF
Ga0212023_104191013300022061AqueousGWLQQATASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0212021_104429613300022068AqueousRRFLPIWLQSASRDIAEGLERDGLSLDLASDVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0212026_107867633300022069AqueousVWLQSASKDIAEKLQSDGLSLDEASNTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRNPYETLF
Ga0187827_1035813743300022227SeawaterGQIGKRFLPIWLQQASSSVSKGLQRDGLSADLAADVSVDFVLGQMGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0255759_10046183103300023178Salt MarshWLQQSARQISERLETESGISPDLAMDVAVDFVLGQSGHPRYKGPRYTQYKLSGLARSPYETLF
(restricted) Ga0233412_1053680323300023210SeawaterKGLAIGGHVGKRFLPIWLQQASASVEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0255763_106874953300023273Salt MarshPIWLQQATNSIKEGLLQQGLSLDLASDTAVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
(restricted) Ga0255050_1007627313300024052SeawaterWLQTASQNIAEGLQRDGLSADLAIDTAVDFVLGQSGHPRYQGPRYTKYKTKGLVRSPYETLF
(restricted) Ga0255039_1042445133300024062SeawaterIWLQQASASVEKGLLQQGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0209992_1004166313300024344Deep SubsurfaceHVGMRFLPIWLQSASRGIAEGLQKDGLSLDLASDTAVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0209992_1028423513300024344Deep SubsurfaceGGQIGKRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0208920_102864943300025072MarineRFLPIWLQTASQNVAEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0208920_106909333300025072MarineLPIWLQTASRNIAEGLQKDGLSADLAADVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0208553_109745133300025109MarineGMRFLPIWLQTASRNIAEGLQKDGLSADLAADVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0209232_101708683300025132MarinePIWLQSASRDIAEGLQKEGLSLDLASDVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRNPYETLF
Ga0209756_120817713300025141MarineGHVGRRFLPIWLQTASQNVAEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKMKGLVRSPYETLF
Ga0209645_111030613300025151MarineWLQSASRDIAEGLERDGLSADLAADTALDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0209645_115659633300025151MarineMKMGGHASMRFLPIWLQTSVRTVAKGLEEDGISADLAADVALEYVLGQSGHPKYKGPRTTQYKLRGLVHNPYETLF
Ga0209337_110054613300025168MarineKRFLPIWLQQASASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0207899_105383633300025257Deep OceanDSAIERAINIGGHAGQRFLPIWLQTSVQTVAKGFEKDGINPDLAADVALEFVLGQLGHPKYKGPRTSQYKMKGLVRSPYETLF
Ga0208030_106381143300025282Deep OceanTASRSVAEGLQKDGLSADLAADVAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0208315_107600133300025286Deep OceanRQIADGYEREGLSPDLAIDTAVKFVLGQTGHPIYKGPRSSAYKLKGLAHDPMETLF
Ga0208181_106462433300025300Deep OceanLKIGGQVGKRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0209095_106021013300025685Pelagic MarineGGHVGKRFLPIWLQQATASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0209602_104265753300025704Pelagic MarineGHVGKRFLPIWLQQASASVEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0209667_116604633300025707MarineGKRFLPIWLQQASASVEKGLHTDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0209660_118686013300025722MarineGGHAGQRFLPIWLQTAVQTTAKGFEKDRISKDLAADVALEFVLGQIGHPKYKGPRTTQYKTRGLVRSPYETLF
Ga0209757_1017429513300025873MarineLTTGWSPHLNKKDDSAIDRAINIGGHAGQRFLPIWLQTAVRTTAKGFERDGISKDLAADVALEFVLGQIGHPKYKGPRTTQYKTRGLVRSPYETLF
Ga0208451_101440433300026103Marine OceanicIGGHIGRRFMPIWLQTATQNVSEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0208127_102219863300026201MarineQSASRDIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0208642_103703613300026210MarineLKIGGQIGKRFLPIWLQQASSSVSKGLQRDGLSADLAADVSVDFVLGQMGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0208642_107349013300026210MarineLQTASQNVAEGLKRDGLSADLAADTAVDFVLGQLGHPRYKGPRTSQYKMKGLVRSPYETL
Ga0207992_114942833300026263MarineQQASSSVSEGLQRDGLSADLAADVSVDFVLGQMGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0209502_1028568833300027780MarineLTIGGHVGKRFLPIWLQQASASVEKGLLQQGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0256412_112536243300028137SeawaterPIWLQQATASVEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0256413_121318813300028282SeawaterGGHVGKRFLPIWLQQASASIEQGLLKDGLSLDLAADTSVDFVLGQLGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0308010_114037413300031510MarineQAANSVKEGMLREGLSLDLASDTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0308018_1014028513300031655MarineLKIGGHVGMRFLPIWLQQAANSTKEGLLKQGLSLDLASDTSVDFVLGQLGHPRYHGPRYTQYKTKGLVRSPYETLF
Ga0310344_1059977713300032006SeawaterGGQVGKRFLPIWLQQASKSVSDGLEREGLSVDLAADVSVDFVLGQMGHPRYKGPRTSQYKTKGLVRSPYETLF
Ga0310344_1101461413300032006SeawaterKRFLPIWLQTASQNIAEGLERDGLSADLAWDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF
Ga0314858_111897_473_6703300033742Sea-Ice BrineMPIWLQQAANSVKEGMLREGLSLDLASDTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0314858_162288_2_1993300033742Sea-Ice BrineLPIWLQQASASVEQGLLKEGLSLDLAADTSVDFVLGQLGHPRYKGPRYTQYKTKGLVRSPYETLF
Ga0372840_233076_365_5443300034695SeawaterTASQNISEGLQRDGLSADLAIDTAVDFVLGQSGHPRYQGPRYTQYKTKGLVRSPYETLF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.