Basic Information | |
---|---|
Family ID | F049455 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 41 residues |
Representative Sequence | MAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Number of Associated Samples | 80 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.19 % |
% of genes near scaffold ends (potentially truncated) | 28.08 % |
% of genes from short scaffolds (< 2000 bps) | 76.03 % |
Associated GOLD sequencing projects | 76 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (77.397 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (21.233 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.781 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.411 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF11138 | DUF2911 | 39.73 |
PF00092 | VWA | 10.96 |
PF06418 | CTP_synth_N | 1.37 |
PF02492 | cobW | 0.68 |
PF00294 | PfkB | 0.68 |
PF01479 | S4 | 0.68 |
PF04773 | FecR | 0.68 |
PF04014 | MazE_antitoxin | 0.68 |
PF13519 | VWA_2 | 0.68 |
PF03703 | bPH_2 | 0.68 |
PF01914 | MarC | 0.68 |
PF06827 | zf-FPG_IleRS | 0.68 |
PF01252 | Peptidase_A8 | 0.68 |
PF01872 | RibD_C | 0.68 |
PF01676 | Metalloenzyme | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 1.37 |
COG0597 | Lipoprotein signal peptidase | Cell wall/membrane/envelope biogenesis [M] | 1.37 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.68 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.68 |
COG2095 | Small neutral amino acid transporter SnatA, MarC family | Amino acid transport and metabolism [E] | 0.68 |
COG3402 | Uncharacterized membrane protein YdbS, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.68 |
COG3428 | Uncharacterized membrane protein YdbT, contains bPH2 (bacterial pleckstrin homology) domain | Function unknown [S] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.40 % |
Unclassified | root | N/A | 22.60 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003293|Ga0006843J48913_114597 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
3300004620|Ga0068957_1403832 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
3300006860|Ga0063829_1375231 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300006860|Ga0063829_1432845 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300009518|Ga0116128_1021103 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2213 | Open in IMG/M |
3300009518|Ga0116128_1118627 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
3300009519|Ga0116108_1005613 | All Organisms → cellular organisms → Bacteria | 5321 | Open in IMG/M |
3300009519|Ga0116108_1181621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300009522|Ga0116218_1370300 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 640 | Open in IMG/M |
3300009547|Ga0116136_1018027 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
3300009552|Ga0116138_1235833 | Not Available | 506 | Open in IMG/M |
3300009615|Ga0116103_1136795 | Not Available | 601 | Open in IMG/M |
3300009616|Ga0116111_1046983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1270 | Open in IMG/M |
3300009617|Ga0116123_1112827 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300009617|Ga0116123_1162829 | Not Available | 573 | Open in IMG/M |
3300009618|Ga0116127_1187821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
3300009639|Ga0116122_1064202 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300009640|Ga0116126_1036402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2025 | Open in IMG/M |
3300009641|Ga0116120_1107802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
3300009646|Ga0116132_1197338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
3300009646|Ga0116132_1254558 | Not Available | 534 | Open in IMG/M |
3300009683|Ga0116224_10553769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 549 | Open in IMG/M |
3300010341|Ga0074045_10728407 | Not Available | 629 | Open in IMG/M |
3300010343|Ga0074044_10402278 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
3300010343|Ga0074044_11132804 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300010379|Ga0136449_103583816 | Not Available | 589 | Open in IMG/M |
3300011073|Ga0138584_1114317 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300011110|Ga0138578_1087223 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300014152|Ga0181533_1045394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2328 | Open in IMG/M |
3300014152|Ga0181533_1368714 | Not Available | 510 | Open in IMG/M |
3300014155|Ga0181524_10422438 | Not Available | 578 | Open in IMG/M |
3300014156|Ga0181518_10265681 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300014162|Ga0181538_10690531 | Not Available | 529 | Open in IMG/M |
3300014164|Ga0181532_10044637 | All Organisms → cellular organisms → Bacteria | 2963 | Open in IMG/M |
3300014200|Ga0181526_10802567 | Not Available | 593 | Open in IMG/M |
3300014491|Ga0182014_10046326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3060 | Open in IMG/M |
3300014638|Ga0181536_10528753 | Not Available | 510 | Open in IMG/M |
3300017822|Ga0187802_10075051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1256 | Open in IMG/M |
3300017823|Ga0187818_10440810 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300017925|Ga0187856_1005612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8036 | Open in IMG/M |
3300017925|Ga0187856_1074670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1404 | Open in IMG/M |
3300017925|Ga0187856_1128766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
3300017925|Ga0187856_1228266 | Not Available | 664 | Open in IMG/M |
3300017929|Ga0187849_1070279 | All Organisms → cellular organisms → Bacteria | 1558 | Open in IMG/M |
3300017929|Ga0187849_1090279 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1319 | Open in IMG/M |
3300017929|Ga0187849_1347046 | Not Available | 548 | Open in IMG/M |
3300017931|Ga0187877_1058963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1716 | Open in IMG/M |
3300017931|Ga0187877_1070451 | All Organisms → cellular organisms → Bacteria | 1525 | Open in IMG/M |
3300017931|Ga0187877_1143521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
3300017931|Ga0187877_1218027 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
3300017934|Ga0187803_10328499 | Not Available | 613 | Open in IMG/M |
3300017938|Ga0187854_10218076 | Not Available | 837 | Open in IMG/M |
3300017938|Ga0187854_10486315 | Not Available | 513 | Open in IMG/M |
3300017941|Ga0187850_10048551 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
3300017941|Ga0187850_10167407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1022 | Open in IMG/M |
3300017941|Ga0187850_10216544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
3300017946|Ga0187879_10431494 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300017961|Ga0187778_11189182 | Not Available | 534 | Open in IMG/M |
3300017966|Ga0187776_10815335 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300017972|Ga0187781_10014955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5481 | Open in IMG/M |
3300017972|Ga0187781_10052586 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2802 | Open in IMG/M |
3300017972|Ga0187781_10501879 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
3300017973|Ga0187780_10165926 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300017975|Ga0187782_10036411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3580 | Open in IMG/M |
3300017975|Ga0187782_10090947 | Not Available | 2241 | Open in IMG/M |
3300017975|Ga0187782_10210151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1457 | Open in IMG/M |
3300017975|Ga0187782_10664103 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300017975|Ga0187782_11011609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
3300017996|Ga0187891_1055889 | All Organisms → cellular organisms → Bacteria | 1632 | Open in IMG/M |
3300017998|Ga0187870_1123942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
3300017998|Ga0187870_1275839 | Not Available | 570 | Open in IMG/M |
3300018005|Ga0187878_1093331 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
3300018005|Ga0187878_1096259 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300018008|Ga0187888_1210435 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300018015|Ga0187866_1237063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300018016|Ga0187880_1274034 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300018018|Ga0187886_1098223 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
3300018019|Ga0187874_10266871 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300018020|Ga0187861_10026446 | All Organisms → cellular organisms → Bacteria | 3349 | Open in IMG/M |
3300018023|Ga0187889_10335927 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300018026|Ga0187857_10565147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
3300018057|Ga0187858_10963489 | Not Available | 500 | Open in IMG/M |
3300018062|Ga0187784_10005633 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10112 | Open in IMG/M |
3300018062|Ga0187784_10869414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
3300018086|Ga0187769_10436925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 985 | Open in IMG/M |
3300018086|Ga0187769_11014465 | Not Available | 628 | Open in IMG/M |
3300018088|Ga0187771_10003944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10432 | Open in IMG/M |
3300018088|Ga0187771_10022974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4674 | Open in IMG/M |
3300018088|Ga0187771_11068618 | Not Available | 685 | Open in IMG/M |
3300018088|Ga0187771_11668704 | Not Available | 541 | Open in IMG/M |
3300018088|Ga0187771_11828110 | Not Available | 516 | Open in IMG/M |
3300018088|Ga0187771_11906456 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300018090|Ga0187770_10064072 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2677 | Open in IMG/M |
3300018090|Ga0187770_11353184 | Not Available | 578 | Open in IMG/M |
3300019211|Ga0187799_1042146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 728 | Open in IMG/M |
3300019275|Ga0187798_1067663 | Not Available | 767 | Open in IMG/M |
3300019275|Ga0187798_1103484 | Not Available | 559 | Open in IMG/M |
3300019275|Ga0187798_1103607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1312 | Open in IMG/M |
3300019275|Ga0187798_1110692 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
3300019275|Ga0187798_1264969 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300019275|Ga0187798_1267783 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
3300019275|Ga0187798_1308547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1191 | Open in IMG/M |
3300019275|Ga0187798_1406946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
3300019275|Ga0187798_1511173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
3300019275|Ga0187798_1739014 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
3300019284|Ga0187797_1054993 | Not Available | 513 | Open in IMG/M |
3300019284|Ga0187797_1237751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
3300019284|Ga0187797_1651066 | Not Available | 695 | Open in IMG/M |
3300019284|Ga0187797_1720689 | Not Available | 527 | Open in IMG/M |
3300019284|Ga0187797_1821866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1038 | Open in IMG/M |
3300019788|Ga0182028_1528467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1271 | Open in IMG/M |
3300023088|Ga0224555_1008908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6776 | Open in IMG/M |
3300023090|Ga0224558_1027243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2703 | Open in IMG/M |
3300025442|Ga0208034_1044042 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
3300025446|Ga0208038_1006556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3970 | Open in IMG/M |
3300025506|Ga0208937_1034120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1232 | Open in IMG/M |
3300027905|Ga0209415_10638654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 778 | Open in IMG/M |
3300028445|Ga0189899_110289 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300028450|Ga0189898_1031778 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
3300032069|Ga0315282_10043840 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5096 | Open in IMG/M |
3300032160|Ga0311301_10004071 | All Organisms → cellular organisms → Bacteria | 53024 | Open in IMG/M |
3300032892|Ga0335081_12746997 | Not Available | 501 | Open in IMG/M |
3300033402|Ga0326728_10001448 | All Organisms → cellular organisms → Bacteria | 83457 | Open in IMG/M |
3300033402|Ga0326728_10004332 | All Organisms → cellular organisms → Bacteria | 42185 | Open in IMG/M |
3300033402|Ga0326728_10006511 | All Organisms → cellular organisms → Bacteria | 31346 | Open in IMG/M |
3300033402|Ga0326728_10102740 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3434 | Open in IMG/M |
3300033402|Ga0326728_10112631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3187 | Open in IMG/M |
3300033402|Ga0326728_10190556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2094 | Open in IMG/M |
3300033402|Ga0326728_10209533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1943 | Open in IMG/M |
3300033402|Ga0326728_10242243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1733 | Open in IMG/M |
3300033402|Ga0326728_10403449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1166 | Open in IMG/M |
3300033402|Ga0326728_10506544 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
3300033405|Ga0326727_10546421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.Bin373 | 987 | Open in IMG/M |
3300033977|Ga0314861_0003075 | All Organisms → cellular organisms → Bacteria | 16384 | Open in IMG/M |
3300033977|Ga0314861_0022932 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3881 | Open in IMG/M |
3300033977|Ga0314861_0044535 | All Organisms → cellular organisms → Bacteria | 2513 | Open in IMG/M |
3300033977|Ga0314861_0068393 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
3300033977|Ga0314861_0120574 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
3300033977|Ga0314861_0145792 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300033977|Ga0314861_0168826 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300033977|Ga0314861_0369451 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300033977|Ga0314861_0442502 | Not Available | 564 | Open in IMG/M |
3300033977|Ga0314861_0515076 | Not Available | 512 | Open in IMG/M |
3300033983|Ga0371488_0025964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4122 | Open in IMG/M |
3300034091|Ga0326724_0001541 | All Organisms → cellular organisms → Bacteria | 41362 | Open in IMG/M |
3300034091|Ga0326724_0052595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2948 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 21.23% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 17.81% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 15.75% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 13.01% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 9.59% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 8.90% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 5.48% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.05% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.05% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.37% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.68% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003293 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome, Counting Only) | Environmental | Open in IMG/M |
3300004620 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 49 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006860 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011073 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 74 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018005 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_150 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
3300025446 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028445 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 61 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300028450 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 63 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034091 | Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00N | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0006843J48913_1145972 | 3300003293 | Peatlands Soil | MAIIVVVGGLLAGAAVFAALKNTGKAKESKVTKLDILEYE |
Ga0068957_14038321 | 3300004620 | Peatlands Soil | MVIIVIVGGLFAGAALFAVLKNTGKARESKVTKLDIRLALGS |
Ga0063829_13752312 | 3300006860 | Peatlands Soil | MAIIVVVGGLLAGAAVFAALKNTGKAKESKVTKLDIG* |
Ga0063829_14328452 | 3300006860 | Peatlands Soil | MVIIVIVGGLFAGAALFAVLKNTGKARESKVTKLDIG* |
Ga0116128_10211032 | 3300009518 | Peatland | MAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG* |
Ga0116128_11186272 | 3300009518 | Peatland | GVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0116108_10056136 | 3300009519 | Peatland | MAIIVVVGGLFAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0116108_11816211 | 3300009519 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0116218_13703001 | 3300009522 | Peatlands Soil | MVIIVLGGGLFAGAAVFAALKNTSKARESKVTKLDIS* |
Ga0116136_10180274 | 3300009547 | Peatland | MAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0116138_12358332 | 3300009552 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKV |
Ga0116103_11367951 | 3300009615 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSK |
Ga0116111_10469832 | 3300009616 | Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG* |
Ga0116123_11128272 | 3300009617 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRES |
Ga0116123_11628291 | 3300009617 | Peatland | MLLGNFLGGVSVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG* |
Ga0116127_11878212 | 3300009618 | Peatland | GGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG* |
Ga0116122_10642022 | 3300009639 | Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0116126_10364023 | 3300009640 | Peatland | MLLGNFIEGVRVIMAIIVVVGGLLAGAAILAALKNTSKSREPKVTKLDIG* |
Ga0116120_11078021 | 3300009641 | Peatland | IIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0116132_11973382 | 3300009646 | Peatland | MLLENFLGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG* |
Ga0116132_12545581 | 3300009646 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSR |
Ga0116224_105537691 | 3300009683 | Peatlands Soil | KLWRVSVIMVIIVLGGGLFAGAAVFAALKNTSKARESKVTKLDIS* |
Ga0074045_107284072 | 3300010341 | Bog Forest Soil | VSIVLGNFIRGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG* |
Ga0074044_104022782 | 3300010343 | Bog Forest Soil | MAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG* |
Ga0074044_111328041 | 3300010343 | Bog Forest Soil | MVIIVIVGGLLAGAGLFAALKNTSKARESKVTKLN |
Ga0136449_1035838161 | 3300010379 | Peatlands Soil | MVIIVLVGGLLAGGAIFAALKNAGKAKDSKVTKLNIG* |
Ga0138584_11143171 | 3300011073 | Peatlands Soil | MVIFVVVGGLLAGGAIFAALKNAGKSTESKVTKLHIG* |
Ga0138578_10872232 | 3300011110 | Peatlands Soil | MVIIVIVGGLFAGAALLAVLKNTSKARESKVTKLDIG* |
Ga0181533_10453942 | 3300014152 | Bog | MPLGNFIEGVSVIMAIIVVVGGLLAGAAILAALKNTSKSREPKVTKLDIG* |
Ga0181533_13687141 | 3300014152 | Bog | MVIIVLVGGLFAGAAVFAALKNTSKARESKITKLDIG* |
Ga0181524_104224381 | 3300014155 | Bog | MAIIVVVGGLIAGAAVFAALKNTSKSRESEVTKLDIG* |
Ga0181518_102656812 | 3300014156 | Bog | MVIIVLVGGLFAGAAVFAALKNTSKARESKVTKLDLG* |
Ga0181538_106905311 | 3300014162 | Bog | RVSVIMVIIVLVGGLFAGAAVFAALKNTSKAGESKITKLDIG* |
Ga0181532_100446371 | 3300014164 | Bog | MVIIVLVGGLFAGAAVFAALKNTSKARESKVTKLDIS* |
Ga0181526_108025672 | 3300014200 | Bog | MAIIVAVGGLLAGAAVFAALKNTGKARESKVTKLD |
Ga0182014_100463263 | 3300014491 | Bog | MLLGNFIEGVRVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG* |
Ga0181536_105287531 | 3300014638 | Bog | MLLGNFIEGVRVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG* |
Ga0187802_100750512 | 3300017822 | Freshwater Sediment | MAIIVIVGGLLAGASILAILKNTSKSKESKVTKLDIG |
Ga0187818_104408101 | 3300017823 | Freshwater Sediment | MVIIVIVGGLFAGAALLAVLKNTSKARESKVTKLDIG |
Ga0187856_10056124 | 3300017925 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187856_10746702 | 3300017925 | Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAIFAALKNTIKSRESKVTKLDIG |
Ga0187856_11287662 | 3300017925 | Peatland | MLLGNFIEGVRVIMAIIVVVGGLLAGAAILAALKNTSKSREPKVTKLDIG |
Ga0187856_12282661 | 3300017925 | Peatland | MVIFVVVGGLLAGGVIFAALKNAGKSTKSKVTKLDIS |
Ga0187849_10702791 | 3300017929 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDI |
Ga0187849_10902792 | 3300017929 | Peatland | MAIIVVVGGLFAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187849_13470461 | 3300017929 | Peatland | MAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG |
Ga0187877_10589632 | 3300017931 | Peatland | MLLENFLGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0187877_10704512 | 3300017931 | Peatland | MAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187877_11435212 | 3300017931 | Peatland | MLLGNFNGGVSVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG |
Ga0187877_12180271 | 3300017931 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLD |
Ga0187803_103284991 | 3300017934 | Freshwater Sediment | MVIIVIVGGLFAGAAFLAVLKNTSKARESKVTKLNIG |
Ga0187854_102180762 | 3300017938 | Peatland | MLLGNFLGGVSVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG |
Ga0187854_104863151 | 3300017938 | Peatland | MLLGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVT |
Ga0187850_100485512 | 3300017941 | Peatland | MLLGNFFGGLSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187850_101674072 | 3300017941 | Peatland | MPLGNFSGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187850_102165442 | 3300017941 | Peatland | GGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0187879_104314942 | 3300017946 | Peatland | MVIIVLVGGLFAGAAVFAALKNTSKARESKVTKLDIG |
Ga0187778_111891821 | 3300017961 | Tropical Peatland | MVMIVIVGGLFAGAAILALLKNTRKSRESKVTKLDIG |
Ga0187776_108153352 | 3300017966 | Tropical Peatland | MENSFGGVSVIMVIIVLVGGLVVGGAFFAALKNTSKAKESKVTKLDIG |
Ga0187781_100149555 | 3300017972 | Tropical Peatland | MVIIVIVGGLLAGAGIFAALKNTSKARESKVTKLDIG |
Ga0187781_100525864 | 3300017972 | Tropical Peatland | MAIIVIVGGLLAGATILAVLKNTSKSRESKVTKLDIG |
Ga0187781_105018791 | 3300017972 | Tropical Peatland | MAIIVVVGGLLAGATVFALLKNTSKSRESKVTKLNIG |
Ga0187780_101659262 | 3300017973 | Tropical Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187782_100364111 | 3300017975 | Tropical Peatland | MVIIVLVGGLLAGAGIFAALKNTSKARESKVTKLDIG |
Ga0187782_100909473 | 3300017975 | Tropical Peatland | MVIIVIVGGLLAGAGILVALKNTSKSRESKVTKLNIG |
Ga0187782_102101512 | 3300017975 | Tropical Peatland | MVIIVIVGGLLAGAGIFAALKNTSQARESKVTKLDIG |
Ga0187782_106641032 | 3300017975 | Tropical Peatland | MAIIVIVGGLLAGAGILAALKNTSKSGESKVTKLDIG |
Ga0187782_110116091 | 3300017975 | Tropical Peatland | MVIIVLVGALLAGAGIFAALKNTSKARESKVTKLDIG |
Ga0187891_10558892 | 3300017996 | Peatland | MLLGNFIGGVSVIMAIIVVVGVLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0187870_11239421 | 3300017998 | Peatland | RISVIMVIIVIVGGLFAGAALLAVIKNTSKARESKVTKLNIG |
Ga0187870_12758392 | 3300017998 | Peatland | MLLGNFLGGVSVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVT |
Ga0187878_10933312 | 3300018005 | Peatland | MVIIVIVGGLFAGAALLAVIKNTSKARESKVTKLNIG |
Ga0187878_10962592 | 3300018005 | Peatland | MPLGNFNGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187888_12104351 | 3300018008 | Peatland | RSVYAPGNFFGGVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187866_12370632 | 3300018015 | Peatland | GVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0187880_12740341 | 3300018016 | Peatland | MVIIVLVGGLFAGAAVFAALKNTSKAGESKITKLDIG |
Ga0187886_10982231 | 3300018018 | Peatland | MPLGNFSGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDI |
Ga0187874_102668712 | 3300018019 | Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLD |
Ga0187861_100264465 | 3300018020 | Peatland | MPLGNFNGGVSVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG |
Ga0187889_103359271 | 3300018023 | Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKV |
Ga0187857_105651472 | 3300018026 | Peatland | GNFIGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0187858_109634892 | 3300018057 | Peatland | LPSGVSMLLGNFFGGVSVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG |
Ga0187784_1000563310 | 3300018062 | Tropical Peatland | MVIIVLVGALLTGAGIFAALKNTTKARESKVTKLDIG |
Ga0187784_108694142 | 3300018062 | Tropical Peatland | MAIIVVVGALLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187769_104369251 | 3300018086 | Tropical Peatland | MVIIVLVGALLAGAGIFAALKNTNKARESKVTKLDIG |
Ga0187769_110144651 | 3300018086 | Tropical Peatland | MVIIVIVGGLLAGAGIFAALKNTSKARESKVTKLGIG |
Ga0187771_100039447 | 3300018088 | Tropical Peatland | MAIIVVVGGLLAGATVFAVLKNTSKSRESKVTKLNIG |
Ga0187771_100229743 | 3300018088 | Tropical Peatland | MVIIVIVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187771_110686181 | 3300018088 | Tropical Peatland | MVIIVIVGGLLAGAGIFAALKNTRKARESKVTKLDIG |
Ga0187771_116687042 | 3300018088 | Tropical Peatland | RISVIMVIIVIVGGLFAGAALLAVLKNTSKARESKVTKLNIG |
Ga0187771_118281101 | 3300018088 | Tropical Peatland | MVIIVIVGGLLAGAGILAALKNTSKSRESKVTKLDIG |
Ga0187771_119064562 | 3300018088 | Tropical Peatland | MVMIVIVGGLFAGAAFLAVLKNTSKARESKVTKLNIG |
Ga0187770_100640723 | 3300018090 | Tropical Peatland | MVIIVIAGGLLAGAGILVALKNTSKSRESKVTKLNIS |
Ga0187770_113531841 | 3300018090 | Tropical Peatland | MVMIVIVGGLFAGAALFAVLKNTSKARESKVTKLDIS |
Ga0187799_10421462 | 3300019211 | Peatland | LWRINVIMAIIVVVGGLLAGATVFAVLKNTSKSRESKVTKLNIG |
Ga0187798_10676631 | 3300019275 | Peatland | MVMILIVGGLLTGAAILAALKNTSKSRESKVQKLDIR |
Ga0187798_11034841 | 3300019275 | Peatland | VSQIVKNFLEDQRNMAIIVIVGVLLAGAGIFAALKNTSKSRESKVTKLDIG |
Ga0187798_11036072 | 3300019275 | Peatland | MAIIVIVGGLLAGASILAVLKNTSKSRESKVTKLDIG |
Ga0187798_11106923 | 3300019275 | Peatland | VSVIMVIIVLVGGLFAGAAVFAALKNTSKARESKVTKLNIG |
Ga0187798_12649691 | 3300019275 | Peatland | MAIIVALGGLFAGAAIFAALKNTGKARESKVQKLNIGR |
Ga0187798_12677832 | 3300019275 | Peatland | MVIIVIVGGLLAGAGILVALKNTSKSRESKVTKLNI |
Ga0187798_13085472 | 3300019275 | Peatland | WRVSVTMVIIVIVGGLLAGAGIFAALKNTRKARESKVTKLNIG |
Ga0187798_14069462 | 3300019275 | Peatland | FWRVSVTMVIIVIVGGLLAGAGIFAALKNTRKARESKVTKLNIG |
Ga0187798_15111732 | 3300019275 | Peatland | WRVSVTMVIIVIVGGLLAGAGIFAALKNTRKARESRVTKLNIG |
Ga0187798_17390141 | 3300019275 | Peatland | MAIIVIVGGLLAGAGILAVLKNTSKSRESKVTKLDIG |
Ga0187797_10549931 | 3300019284 | Peatland | MVMILIVGGLLTGAAILAALKNTGKSRESKVQKLDIR |
Ga0187797_12377511 | 3300019284 | Peatland | RTIMVMIVLLGGLIMGGAVFAALKSSGKSKDSKVTKLNIG |
Ga0187797_16510661 | 3300019284 | Peatland | LWRVSVIMVIIVIVGGLLAGAGILVALKNTSKSRESKVTKLNIG |
Ga0187797_17206891 | 3300019284 | Peatland | MAIIVIVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0187797_18218662 | 3300019284 | Peatland | MAIIVIVSGLIAGAAILAVLRNTGKSKESKVTKLDIG |
Ga0182028_15284673 | 3300019788 | Fen | MAIIVVVGGLLAGAAILAVLRNTGKSKESKVTKLNIG |
Ga0224555_10089082 | 3300023088 | Soil | MLLGNFIEGVRVIMAIIVVVGGLLAGAAILAVLKNTSKSRESKVTKLDIG |
Ga0224558_10272432 | 3300023090 | Soil | MVIIVLVGGLFAGAAVFAALKNTSKARESKVTKLDIS |
Ga0208034_10440422 | 3300025442 | Peatland | MLLGNFIGGVSVIMAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0208038_10065561 | 3300025446 | Peatland | GVSVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0208937_10341201 | 3300025506 | Peatland | AIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0209415_106386542 | 3300027905 | Peatlands Soil | MVIIVIVGGLFAGAALFAVLKNTGKARESKVTKLDIG |
Ga0189899_1102892 | 3300028445 | Peatlands Soil | MAIIVVVGGLLAGAAVFAALKNTGKAKESKVTKLDIG |
Ga0189898_10317782 | 3300028450 | Peatlands Soil | MVIFVVVGGLLAGGAIFAALKNAGKSTESKVTKLHIG |
Ga0315282_100438404 | 3300032069 | Sediment | MVIIVIVGGLFAGAAILALLKNTSKARESKVTKLNIG |
Ga0311301_1000407110 | 3300032160 | Peatlands Soil | MVIIVLGGGLFAGAAVFAALKNTSKARESKVTKLDIS |
Ga0335081_127469971 | 3300032892 | Soil | MVMIVLVGGLFAGAAVFAALKNTSKARESKVTKLDIG |
Ga0326728_1000144861 | 3300033402 | Peat Soil | MAIIVVVGGLLAGATVFAVLKNTGKSRESKVTKLDIG |
Ga0326728_100043325 | 3300033402 | Peat Soil | MVIVVIVGGLLAGAGILAALKNTSKSRESKVTKLDIG |
Ga0326728_100065114 | 3300033402 | Peat Soil | MVIIVIVGGLLAGAGIFAALKNTSKARESKVTKLNIG |
Ga0326728_101027403 | 3300033402 | Peat Soil | MVIILVAGGLLAGGAIFAALKNTGKARESKVTKLDIG |
Ga0326728_101126314 | 3300033402 | Peat Soil | MAIIVVVGGLLAGAAIFAALKNTSKSRESKVTKLDIG |
Ga0326728_101905562 | 3300033402 | Peat Soil | MLLGNSFGGVSVIMEIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0326728_102095332 | 3300033402 | Peat Soil | MGNFFGGVSVIMVIFVLVGGLLAGGAIFAALKNAGKSTESKVTKLDIG |
Ga0326728_102422432 | 3300033402 | Peat Soil | MVMILIVGGLIAGAAVLAALKNTGKSKESKVTKLNIG |
Ga0326728_104034492 | 3300033402 | Peat Soil | MAIIVIVGGLLAGASILAVLKNTSKSRESKVTKLDIGYR |
Ga0326728_105065442 | 3300033402 | Peat Soil | MAIIVVVGGLLAGAAVLAALKNTSKSRESKVTKLDIG |
Ga0326727_105464211 | 3300033405 | Peat Soil | LLGNFFGGISVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
Ga0314861_0003075_6940_7053 | 3300033977 | Peatland | MAIIVVLGGLLAGATILALLKNTSKSRQSKLTKLDIG |
Ga0314861_0022932_1946_2059 | 3300033977 | Peatland | MVIIVVVGGLLAGAAVFAILKNTGKSRESKVTKLDIG |
Ga0314861_0044535_399_512 | 3300033977 | Peatland | MVIILVVGGLLAGATILAVLKNTSKSSESKVTKLNIG |
Ga0314861_0068393_119_232 | 3300033977 | Peatland | MAIIVIVGGLLAGAAILALLKNTSKSRESKVTKLDIG |
Ga0314861_0120574_617_730 | 3300033977 | Peatland | MVIIVIVGGLLAGAGILAALKNTSKSRELKVTKLDIG |
Ga0314861_0145792_35_148 | 3300033977 | Peatland | MAIIVVVGGLLAGATIFAVLKNTSKSRESKVTKLNIG |
Ga0314861_0168826_509_622 | 3300033977 | Peatland | MAIIVVVGGLLAGATIFAVLKNRSKSRESKVTKLNIG |
Ga0314861_0369451_527_631 | 3300033977 | Peatland | MVIIVIVGGLLAGAGIFAALKNTRKARESKVTKLD |
Ga0314861_0442502_13_120 | 3300033977 | Peatland | MILLVGGLIAGAAILAALKNTSKSRESKVTKLNIG |
Ga0314861_0515076_223_336 | 3300033977 | Peatland | MVMILIVGGLVAGAAVLAALKNTSKSRESKVTKLNIG |
Ga0371488_0025964_2540_2653 | 3300033983 | Peat Soil | MVIIVLVGGLFAGAAVFAALKNTSKARESKVTKLDLG |
Ga0326724_0001541_8401_8514 | 3300034091 | Peat Soil | MVIIVLVGGLFAGAAVFAALKNTSKARESKITKLDIG |
Ga0326724_0052595_2731_2883 | 3300034091 | Peat Soil | MLLGNFFGGISVIMAIIVVVGGLLAGAAILAALKNTSKSRESKVTKLDIG |
⦗Top⦘ |