Basic Information | |
---|---|
Family ID | F049328 |
Family Type | Metagenome |
Number of Sequences | 146 |
Average Sequence Length | 50 residues |
Representative Sequence | MEQVRELLDLIKGMEINGKLVAASFIVRHIQPCKERAHPGFDFKGDTDGT |
Number of Associated Samples | 65 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 49.62 % |
% of genes near scaffold ends (potentially truncated) | 42.47 % |
% of genes from short scaffolds (< 2000 bps) | 91.10 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (72.603 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.945 % of family members) |
Environment Ontology (ENVO) | Unclassified (97.945 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (97.945 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 42.31% β-sheet: 0.00% Coil/Unstructured: 57.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF04195 | Transposase_28 | 38.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 72.60 % |
All Organisms | root | All Organisms | 27.40 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300013297|Ga0157378_12744553 | Not Available | 545 | Open in IMG/M |
3300013297|Ga0157378_13184192 | Not Available | 510 | Open in IMG/M |
3300015267|Ga0182122_1038232 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 602 | Open in IMG/M |
3300015267|Ga0182122_1064432 | Not Available | 520 | Open in IMG/M |
3300015268|Ga0182154_1022515 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 696 | Open in IMG/M |
3300015269|Ga0182113_1054912 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 600 | Open in IMG/M |
3300015274|Ga0182188_1033458 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 593 | Open in IMG/M |
3300015275|Ga0182172_1029404 | Not Available | 661 | Open in IMG/M |
3300015276|Ga0182170_1017863 | Not Available | 759 | Open in IMG/M |
3300015276|Ga0182170_1077978 | Not Available | 500 | Open in IMG/M |
3300015279|Ga0182174_1042113 | Not Available | 621 | Open in IMG/M |
3300015279|Ga0182174_1053659 | Not Available | 580 | Open in IMG/M |
3300015281|Ga0182160_1004018 | Not Available | 1160 | Open in IMG/M |
3300015281|Ga0182160_1041528 | Not Available | 617 | Open in IMG/M |
3300015281|Ga0182160_1069462 | Not Available | 532 | Open in IMG/M |
3300015282|Ga0182124_1067283 | Not Available | 534 | Open in IMG/M |
3300015282|Ga0182124_1069835 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 529 | Open in IMG/M |
3300015282|Ga0182124_1072966 | Not Available | 522 | Open in IMG/M |
3300015282|Ga0182124_1083558 | Not Available | 500 | Open in IMG/M |
3300015283|Ga0182156_1042106 | Not Available | 625 | Open in IMG/M |
3300015283|Ga0182156_1050892 | Not Available | 592 | Open in IMG/M |
3300015283|Ga0182156_1079528 | Not Available | 518 | Open in IMG/M |
3300015286|Ga0182176_1066255 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 546 | Open in IMG/M |
3300015287|Ga0182171_1008937 | Not Available | 952 | Open in IMG/M |
3300015288|Ga0182173_1009630 | Not Available | 920 | Open in IMG/M |
3300015288|Ga0182173_1017851 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 783 | Open in IMG/M |
3300015288|Ga0182173_1017980 | Not Available | 781 | Open in IMG/M |
3300015288|Ga0182173_1045562 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 607 | Open in IMG/M |
3300015288|Ga0182173_1055984 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 572 | Open in IMG/M |
3300015288|Ga0182173_1061174 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 558 | Open in IMG/M |
3300015288|Ga0182173_1064908 | Not Available | 548 | Open in IMG/M |
3300015288|Ga0182173_1075774 | Not Available | 523 | Open in IMG/M |
3300015289|Ga0182138_1023678 | Not Available | 734 | Open in IMG/M |
3300015289|Ga0182138_1050807 | Not Available | 594 | Open in IMG/M |
3300015291|Ga0182125_1045219 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 627 | Open in IMG/M |
3300015291|Ga0182125_1047602 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 618 | Open in IMG/M |
3300015291|Ga0182125_1081403 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 527 | Open in IMG/M |
3300015292|Ga0182141_1019100 | Not Available | 793 | Open in IMG/M |
3300015294|Ga0182126_1015791 | Not Available | 844 | Open in IMG/M |
3300015295|Ga0182175_1044826 | Not Available | 637 | Open in IMG/M |
3300015298|Ga0182106_1038255 | Not Available | 677 | Open in IMG/M |
3300015298|Ga0182106_1040870 | Not Available | 664 | Open in IMG/M |
3300015298|Ga0182106_1071493 | Not Available | 563 | Open in IMG/M |
3300015298|Ga0182106_1097983 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 510 | Open in IMG/M |
3300015299|Ga0182107_1051717 | Not Available | 624 | Open in IMG/M |
3300015299|Ga0182107_1083432 | Not Available | 540 | Open in IMG/M |
3300015300|Ga0182108_1034681 | Not Available | 705 | Open in IMG/M |
3300015300|Ga0182108_1085452 | Not Available | 539 | Open in IMG/M |
3300015302|Ga0182143_1033139 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 707 | Open in IMG/M |
3300015303|Ga0182123_1022946 | Not Available | 760 | Open in IMG/M |
3300015304|Ga0182112_1065356 | Not Available | 583 | Open in IMG/M |
3300015305|Ga0182158_1029429 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 730 | Open in IMG/M |
3300015305|Ga0182158_1048482 | Not Available | 634 | Open in IMG/M |
3300015308|Ga0182142_1088246 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 547 | Open in IMG/M |
3300015314|Ga0182140_1030786 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 748 | Open in IMG/M |
3300015321|Ga0182127_1081274 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 577 | Open in IMG/M |
3300015322|Ga0182110_1050978 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 663 | Open in IMG/M |
3300015323|Ga0182129_1035093 | Not Available | 718 | Open in IMG/M |
3300015341|Ga0182187_1034268 | Not Available | 926 | Open in IMG/M |
3300015341|Ga0182187_1137564 | Not Available | 577 | Open in IMG/M |
3300015343|Ga0182155_1120588 | Not Available | 633 | Open in IMG/M |
3300015343|Ga0182155_1175933 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 551 | Open in IMG/M |
3300015343|Ga0182155_1205790 | Not Available | 519 | Open in IMG/M |
3300015343|Ga0182155_1209456 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 516 | Open in IMG/M |
3300015344|Ga0182189_1085324 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 725 | Open in IMG/M |
3300015344|Ga0182189_1122166 | Not Available | 637 | Open in IMG/M |
3300015345|Ga0182111_1046319 | Not Available | 934 | Open in IMG/M |
3300015345|Ga0182111_1121856 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 658 | Open in IMG/M |
3300015345|Ga0182111_1151513 | Not Available | 606 | Open in IMG/M |
3300015345|Ga0182111_1180069 | Not Available | 567 | Open in IMG/M |
3300015346|Ga0182139_1229487 | Not Available | 516 | Open in IMG/M |
3300015347|Ga0182177_1086908 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 749 | Open in IMG/M |
3300015347|Ga0182177_1132353 | Not Available | 641 | Open in IMG/M |
3300015347|Ga0182177_1170480 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 582 | Open in IMG/M |
3300015347|Ga0182177_1174747 | Not Available | 577 | Open in IMG/M |
3300015347|Ga0182177_1245327 | Not Available | 505 | Open in IMG/M |
3300015351|Ga0182161_1067238 | Not Available | 861 | Open in IMG/M |
3300015351|Ga0182161_1098903 | Not Available | 744 | Open in IMG/M |
3300015351|Ga0182161_1159430 | Not Available | 619 | Open in IMG/M |
3300015351|Ga0182161_1240422 | Not Available | 525 | Open in IMG/M |
3300015351|Ga0182161_1242479 | Not Available | 523 | Open in IMG/M |
3300015355|Ga0182159_1124769 | Not Available | 784 | Open in IMG/M |
3300015355|Ga0182159_1125173 | Not Available | 783 | Open in IMG/M |
3300015355|Ga0182159_1224463 | Not Available | 612 | Open in IMG/M |
3300015355|Ga0182159_1297239 | Not Available | 541 | Open in IMG/M |
3300015355|Ga0182159_1313738 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 528 | Open in IMG/M |
3300015361|Ga0182145_1088701 | Not Available | 654 | Open in IMG/M |
3300015361|Ga0182145_1146325 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Zizaniinae → Zizania → Zizania palustris | 553 | Open in IMG/M |
3300017404|Ga0182203_1047458 | Not Available | 749 | Open in IMG/M |
3300017404|Ga0182203_1117302 | Not Available | 562 | Open in IMG/M |
3300017404|Ga0182203_1121239 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 556 | Open in IMG/M |
3300017407|Ga0182220_1066357 | Not Available | 579 | Open in IMG/M |
3300017409|Ga0182204_1108696 | Not Available | 518 | Open in IMG/M |
3300017409|Ga0182204_1117010 | Not Available | 506 | Open in IMG/M |
3300017410|Ga0182207_1146643 | Not Available | 536 | Open in IMG/M |
3300017410|Ga0182207_1175461 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 503 | Open in IMG/M |
3300017411|Ga0182208_1013468 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 988 | Open in IMG/M |
3300017411|Ga0182208_1111891 | Not Available | 527 | Open in IMG/M |
3300017415|Ga0182202_1056107 | Not Available | 672 | Open in IMG/M |
3300017424|Ga0182219_1035853 | Not Available | 768 | Open in IMG/M |
3300017424|Ga0182219_1113204 | Not Available | 538 | Open in IMG/M |
3300017425|Ga0182224_1127211 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 549 | Open in IMG/M |
3300017427|Ga0182190_1061305 | Not Available | 704 | Open in IMG/M |
3300017427|Ga0182190_1126896 | Not Available | 551 | Open in IMG/M |
3300017430|Ga0182192_1172112 | Not Available | 503 | Open in IMG/M |
3300017433|Ga0182206_1062443 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 678 | Open in IMG/M |
3300017433|Ga0182206_1085091 | Not Available | 615 | Open in IMG/M |
3300017436|Ga0182209_1099107 | Not Available | 604 | Open in IMG/M |
3300017436|Ga0182209_1110365 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 583 | Open in IMG/M |
3300017436|Ga0182209_1120791 | Not Available | 567 | Open in IMG/M |
3300017436|Ga0182209_1157296 | Not Available | 519 | Open in IMG/M |
3300017438|Ga0182191_1152306 | Not Available | 535 | Open in IMG/M |
3300017442|Ga0182221_1105551 | Not Available | 585 | Open in IMG/M |
3300017442|Ga0182221_1113430 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 571 | Open in IMG/M |
3300017443|Ga0182193_1011759 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 1225 | Open in IMG/M |
3300017443|Ga0182193_1044751 | Not Available | 825 | Open in IMG/M |
3300017443|Ga0182193_1156372 | Not Available | 546 | Open in IMG/M |
3300017680|Ga0182233_1087543 | Not Available | 569 | Open in IMG/M |
3300017682|Ga0182229_1069204 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 606 | Open in IMG/M |
3300017683|Ga0182218_1067911 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 647 | Open in IMG/M |
3300017683|Ga0182218_1111625 | Not Available | 556 | Open in IMG/M |
3300017683|Ga0182218_1112495 | Not Available | 555 | Open in IMG/M |
3300017684|Ga0182225_1070951 | Not Available | 627 | Open in IMG/M |
3300017684|Ga0182225_1118423 | Not Available | 535 | Open in IMG/M |
3300017685|Ga0182227_1052131 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza | 730 | Open in IMG/M |
3300017685|Ga0182227_1120417 | Not Available | 526 | Open in IMG/M |
3300017685|Ga0182227_1129587 | Not Available | 512 | Open in IMG/M |
3300017686|Ga0182205_1122758 | Not Available | 564 | Open in IMG/M |
3300017689|Ga0182231_1112437 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 530 | Open in IMG/M |
3300017690|Ga0182223_1031571 | Not Available | 732 | Open in IMG/M |
3300017690|Ga0182223_1047052 | Not Available | 658 | Open in IMG/M |
3300017690|Ga0182223_1082725 | Not Available | 564 | Open in IMG/M |
3300025938|Ga0207704_11271956 | Not Available | 628 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 97.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015274 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015276 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015279 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015289 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015292 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017680 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017682 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017689 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0157378_127445531 | 3300013297 | Miscanthus Rhizosphere | MEQVRELLDLIKGMEINGKLVAASFIVRHIQPCKERAHPGFDFKGDTDGT* |
Ga0157378_131841921 | 3300013297 | Miscanthus Rhizosphere | LVEAKKPSSTDMEQVRELLNLIKGVKMNGGLVAASFIVRRVQPCKERAHLGFDYRGDDDGT* |
Ga0182122_10382322 | 3300015267 | Miscanthus Phyllosphere | MEQVKELLDLIQGMEMRGELVAASFIVRRVQPCKERAHPGFDYRGDDDRTR* |
Ga0182122_10644322 | 3300015267 | Miscanthus Phyllosphere | MEQVRELLALIKGVEINGGLVAASFIVRCVQPCKERAHAGFDFKGDTNGT* |
Ga0182154_10225151 | 3300015268 | Miscanthus Phyllosphere | MEQVRELLGLIKGVNTNGGLVVASFIVHRVQPCKERAHVAFDFKRGD* |
Ga0182113_10549122 | 3300015269 | Miscanthus Phyllosphere | MEQVMELLDLIKGMELRGELVAASFIMRRVQPCKERAHPAFDYKGDN |
Ga0182188_10334581 | 3300015274 | Miscanthus Phyllosphere | MEQVRELLGLIKGVKMNDGLVAASFIVRRVQTCKERAHVGY |
Ga0182172_10294041 | 3300015275 | Miscanthus Phyllosphere | SADMEQVRGLLGLIKGLKTNSGLVAASFIVRRVQPYKERAHMGYDFKGNTDGT* |
Ga0182172_10513303 | 3300015275 | Miscanthus Phyllosphere | VRELLSLIKGVKMNGRLVAASFIVRRVQPCKERAHVGFDFKG |
Ga0182170_10178631 | 3300015276 | Miscanthus Phyllosphere | VRELLNLIKGVKMNGGLVAASFKVRRIQPCKERDHVGFDFKGDTD |
Ga0182170_10779781 | 3300015276 | Miscanthus Phyllosphere | MEQVKELLDLIQGVELRGELVAASFIVRRVQPCKERAYPAFDFKGDDNGT* |
Ga0182174_10421131 | 3300015279 | Miscanthus Phyllosphere | MEQVMELLDLIRGMEIRGELVATSFIVCRVQPCKERAHPGFDYRGDDDETRERTE* |
Ga0182174_10536591 | 3300015279 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEIRGELVATSFIVRHVQPCKERAHVGFDFKRDTDST* |
Ga0182160_10040181 | 3300015281 | Miscanthus Phyllosphere | MEQVRELLALIRGVRTNDRLVAASFIVRRVQPCKERAHPAFEFKGETNGTRER* |
Ga0182160_10415281 | 3300015281 | Miscanthus Phyllosphere | MEQVMELLDLIKGLELRGELVAASFIVRRIQPCKERAHIGFDFRGDNDGTRDRTE* |
Ga0182160_10694621 | 3300015281 | Miscanthus Phyllosphere | MDQVRELLDLIKGIKMNGILVVASFIVCHVQPCKERAHVGVDFKGDTNGTQ* |
Ga0182124_10672832 | 3300015282 | Miscanthus Phyllosphere | MEQVRELLALIRGMRTNGGLVAASFIVRRVQPYKERAHPAFKFKGETNGT* |
Ga0182124_10698351 | 3300015282 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEISGELVAASFIVRRVQPYKERAHLGFDYKGDDDGT* |
Ga0182124_10729661 | 3300015282 | Miscanthus Phyllosphere | VKELLELIRSMEMNRVVGAVSFIVRHVQPCKERAHLGFNFKGDTNGT* |
Ga0182124_10835581 | 3300015282 | Miscanthus Phyllosphere | MEQVVELLDLIKGMEIRGELVAASFIVCRIQPCKERAHLGFDYRGDDDGTRERT |
Ga0182156_10421062 | 3300015283 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEINGELVAASFIVSRVQPYKERAHPGFNFKGDDDGTRERLK* |
Ga0182156_10508922 | 3300015283 | Miscanthus Phyllosphere | MEQVRELLDLIKGMEIRGELVTTSFIVRHVQPCKERAHASFDFKWDTDGTW* |
Ga0182156_10556051 | 3300015283 | Miscanthus Phyllosphere | MEQVRELLDLIKGMKINGGLVVASFIVCHIQPYKEWAHPGFDFKGDDDGT* |
Ga0182156_10795281 | 3300015283 | Miscanthus Phyllosphere | DHIFESQKSWWEKPSSVHMEQVGELLNLIKGVKMNDGLVVASFIVRRVQPCKERAHVGYDFKGDNIGT* |
Ga0182176_10376571 | 3300015286 | Miscanthus Phyllosphere | MEQERELLNLIKGVEIRGELVAASFIVHRIQPYKERAHPG |
Ga0182176_10662551 | 3300015286 | Miscanthus Phyllosphere | MEQVVELLNLMKDLELRGELVAASFIVRRIQPCKERAHLGF |
Ga0182171_10089373 | 3300015287 | Miscanthus Phyllosphere | MDQVKELLSLIKSVKMNGRLVAVSFIVRRVQPCKERAHAGFDFKGDT |
Ga0182173_10096303 | 3300015288 | Miscanthus Phyllosphere | ADMEQVMELLDLIRGVEIRGKLVAASFIVRYIQPCKERAHPGFDYRGDDDMT* |
Ga0182173_10178512 | 3300015288 | Miscanthus Phyllosphere | MEQVMELLDLIKDLELRGELVAASFIVRRIQPCKERAHIGFDFRGDNDGTRDRTE* |
Ga0182173_10179803 | 3300015288 | Miscanthus Phyllosphere | MDQVRELLGLIKGIKMNDVLVAASFIVRRVHPCKERAHMGFDFK |
Ga0182173_10455622 | 3300015288 | Miscanthus Phyllosphere | MEQVKELLNLLKGVEINDGLVVASFIVLRVQPCKERAHPGFDFKGDDD |
Ga0182173_10559841 | 3300015288 | Miscanthus Phyllosphere | MEQVRELLGLIKGVKTNGGLVAASFIVRRVQPYKERAHTSYDFKGDTDNT* |
Ga0182173_10611741 | 3300015288 | Miscanthus Phyllosphere | MEQVRELLGLIKGIKMNDVLVAASFIVRRVHPCKERAHMGFDFK |
Ga0182173_10649082 | 3300015288 | Miscanthus Phyllosphere | MEQVRELLNLIKGVKTNGGQVVASFIVHHVQPCKERAHVGYD |
Ga0182173_10757741 | 3300015288 | Miscanthus Phyllosphere | VRELLGLIKGINMNGVLVAASFIVHLIQPYKERAYMSFDFKGDTDSTR |
Ga0182138_10236782 | 3300015289 | Miscanthus Phyllosphere | VRELLGIIKGMKTNGGLVAASFIVRYVQPCKERPHMGYDFKGDTDGT* |
Ga0182138_10258682 | 3300015289 | Miscanthus Phyllosphere | LEQVNELLGLIKAMKTNGGLVAANFIVRRIQPCKERAHLGFE |
Ga0182138_10508071 | 3300015289 | Miscanthus Phyllosphere | MEQVMGLLDLIKGLELRGELVAASFIVRRIQPCKERAHPGFDFRGDNDGTRERIE* |
Ga0182125_10452192 | 3300015291 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEINGELVAASFIVHRVQPCKERAHPGFDFKGDDDRTRERTE* |
Ga0182125_10476022 | 3300015291 | Miscanthus Phyllosphere | MEQVMELLDLIRGMEMRGELVAASFIVRRVQPYKERAHPGFDYRGDD |
Ga0182125_10814031 | 3300015291 | Miscanthus Phyllosphere | MEQVKELLSLIKGMRTNGGLVAASFIVRHIQPYKERAHPGFEFKGETDDT* |
Ga0182141_10191001 | 3300015292 | Miscanthus Phyllosphere | KKLNSAEMEQVMELLDLIRGMEIRGKLVEASFIVRHVQPCKERAHPGFEYRGDDDGTREGTE* |
Ga0182126_10157912 | 3300015294 | Miscanthus Phyllosphere | MEQVKELHDLIQGVELRGELVAASFIVRRVQPCKERAYPAFDYKGDDDGTRERPE* |
Ga0182175_10448262 | 3300015295 | Miscanthus Phyllosphere | MEQVRELLNLIKGVKMNGGLVAASFIVRRVQPCKERAHAGFEFKGDNDGT* |
Ga0182106_10382551 | 3300015298 | Miscanthus Phyllosphere | MEQVRELLCLIKGVKMNNRLVAVSFIVRRVQPCKERAYAGFDFKGDTDGT* |
Ga0182106_10408701 | 3300015298 | Miscanthus Phyllosphere | MEKLTSADMEQVKELLELIKGMKMNGVVLAVSFIVCRVQPYKERAHLGFDFKGDTDGT* |
Ga0182106_10714931 | 3300015298 | Miscanthus Phyllosphere | MEQVKELLDLIEGVEINDKLVAASFIVRHVQPCKEKAHPGFDFKGDDDGTRERTE* |
Ga0182106_10979832 | 3300015298 | Miscanthus Phyllosphere | MEQVMELLDLIKGVELRGELVAASFIVRRVQPCKERAHPAFDFKGDNDGTRENTDRL |
Ga0182107_10517171 | 3300015299 | Miscanthus Phyllosphere | IADIDQVRELIGLIKGIKMNGVLVAASFIVRCVQPCKERAHAGFDFNGDTDDT* |
Ga0182107_10834322 | 3300015299 | Miscanthus Phyllosphere | VRELLNLIKGVRMNGGLVVVSFIVRRIQPYKERAHMGFDLKGDTDGT* |
Ga0182108_10346812 | 3300015300 | Miscanthus Phyllosphere | MEQVNELLGLIKGVKTNGGLVAVSFIVRHIQPCKERVHPGFEFKGETDRT* |
Ga0182108_10854521 | 3300015300 | Miscanthus Phyllosphere | QVRELLDLIKGVEINDKLVAASFIVRCVQPCKERAHPGFNFKGDDNNT* |
Ga0182143_10331393 | 3300015302 | Miscanthus Phyllosphere | MDQVKELLELMKGMKMNGVVVAVSFIVRRIQLCKERAHPGFDFKGNTDG |
Ga0182123_10229461 | 3300015303 | Miscanthus Phyllosphere | MDQVRELLHLIKGIKMNGVLVAASFIVRCVQPCKERAHAGFDFNGDTDGT* |
Ga0182112_10653561 | 3300015304 | Miscanthus Phyllosphere | VRELLDLIKGVEMNGGLVAASFIVHRIQPCKERAHPGFNFKGDDNGT* |
Ga0182158_10172531 | 3300015305 | Miscanthus Phyllosphere | MDQVNELLGLIKGMKTNGGLVAVSFIVCHIQPCTERAHPGFE |
Ga0182158_10294291 | 3300015305 | Miscanthus Phyllosphere | MEQVKELLDLIQSVELRGELVAASFIVRRVQPCKERAYPAFDYKGDDDGT* |
Ga0182158_10484822 | 3300015305 | Miscanthus Phyllosphere | VRELLNLIKGVEINDRLVAASFIVRRIQPYKERAHAAFEFKGETDGT* |
Ga0182158_10530602 | 3300015305 | Miscanthus Phyllosphere | MEQVRELLGLIKGVKTNGGLVAASFIIRRIQPCKERAHAGF* |
Ga0182142_10882461 | 3300015308 | Miscanthus Phyllosphere | MEQVRVLLDLIKGMKTNGGLVAASFIVRHVQPYKERAHAGYAFKGDTDGTQERT* |
Ga0182140_10307862 | 3300015314 | Miscanthus Phyllosphere | MEQVRELLDLIKGMEINGGLVAASFIVRLIQPFKERAHPGFDFKGDDDGT* |
Ga0182127_10812742 | 3300015321 | Miscanthus Phyllosphere | MEQVRELLDLIKGMEINGEQVVASFIVHHVQPCKERAHSGFDFKGDDDGTRERLE* |
Ga0182110_10509781 | 3300015322 | Miscanthus Phyllosphere | MDQVKELLSLIKGVKMNDALVAASFIVRHVQPYKERAHAGFDFNGDTDGS |
Ga0182129_10350931 | 3300015323 | Miscanthus Phyllosphere | VRELLGLIKDIKMNGVLVAASFIVRHIQPCKERAHTGFDFKGDTDGT* |
Ga0182187_10342681 | 3300015341 | Miscanthus Phyllosphere | NMDQVMEILDLIRGMEIRGKLVAASFIVHHVQPYKERAHPSFDYRGDDDGTRERTE* |
Ga0182187_11375641 | 3300015341 | Miscanthus Phyllosphere | MEQVRVLLDLLEGIEISGELVAVSFIVCRIQPCKERAHPGFDYRGDDDRTQERTE* |
Ga0182109_10947191 | 3300015342 | Miscanthus Phyllosphere | MEQVRELLALIKGMRTNNGLVAASFIVCRVQPCKERAYPAFEFKGE |
Ga0182155_11205881 | 3300015343 | Miscanthus Phyllosphere | LLDLIKGMKMNGGLVEGSFIVHCAQPCKERAHVGFDFKGDTDGT* |
Ga0182155_11759332 | 3300015343 | Miscanthus Phyllosphere | MEQVMELLDLIRGVEIRGKLVAASFIVRYIQPCKERAHPGFDYRGD |
Ga0182155_12057901 | 3300015343 | Miscanthus Phyllosphere | QVKELLDLMQRVELRGELVAASFIVRRVQPCKERAYPAFDYKGDDDGTWERP* |
Ga0182155_12094561 | 3300015343 | Miscanthus Phyllosphere | MPNNADMERVRELLALIRGMRTNGGLVAASFIVRRVQPCKERVHPTFEFKGETDGTQERP |
Ga0182189_10853241 | 3300015344 | Miscanthus Phyllosphere | MDQVRELLDLIKGIKMNGVLVAASFILLCVQPCKERAHAGFDFKGDTDGTWERMERLLKE |
Ga0182189_11221661 | 3300015344 | Miscanthus Phyllosphere | MEQVMELLDLIRGVEIRGKLVAASFIVRYIQPCKERAHPGFDYRGDDDGT |
Ga0182189_11326702 | 3300015344 | Miscanthus Phyllosphere | VRELLNLIKGMKMNGRLVAASFIVRRVQPCKERAHTGFEFKGTTMAPGRARGG* |
Ga0182111_10463191 | 3300015345 | Miscanthus Phyllosphere | MEQVKELLDLVKGVEIRGELVVASFIVRRVQPCKERAHPGL* |
Ga0182111_11218561 | 3300015345 | Miscanthus Phyllosphere | MEQVRELLDLIKGMEINGELVVASFIVRRVQPCKERAHPSFDFKGDDD |
Ga0182111_11515132 | 3300015345 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEISGELVAASFIVRSVLPCKERAHPSFDYKGDDDGT* |
Ga0182111_11800692 | 3300015345 | Miscanthus Phyllosphere | MDQVRELLSLIKGIKMNGVLVAASFIVRCVQPCKERAHAGFDFNGDTDDT* |
Ga0182139_12294871 | 3300015346 | Miscanthus Phyllosphere | DMEQVKELLDLIQRVELRGELVVASFIVRRVQPCKERAYPAFDYKGDDDGT* |
Ga0182177_10869082 | 3300015347 | Miscanthus Phyllosphere | MEQVKELLDLIQGVELRGELVAASFIVRRVQPYKERAHPGFDYRGDDDGI* |
Ga0182177_11323531 | 3300015347 | Miscanthus Phyllosphere | MEQARELLGLIKGVKMNDTPVVASFIACHVQPYKERAHTGFDFKGDTDGT* |
Ga0182177_11704801 | 3300015347 | Miscanthus Phyllosphere | MEQVGELLELIKGVEIRGKLVAASFIVRRIQPCKERAYPGFDYTGDDDGTREMMEW |
Ga0182177_11747471 | 3300015347 | Miscanthus Phyllosphere | EQVRELLDLIKGMELSGELVAASFIVHHVQPCKERAHPGFDYRGDDDRT* |
Ga0182177_12453271 | 3300015347 | Miscanthus Phyllosphere | MEQVRELLNLIKGVEINGRLVAASFIVRRIQPCKKRAHPGFDFMGDNDGT* |
Ga0182161_10672382 | 3300015351 | Miscanthus Phyllosphere | VRELLGLIKGVKTNSGLVAASFIVRRVQPYKERAHPAFKFKGETYGTWERP* |
Ga0182161_10989032 | 3300015351 | Miscanthus Phyllosphere | MEQVRELIGLIKGVRMNGGLVMAIFIVCRVQPRKERTHAGFDFKGDTDD |
Ga0182161_11291062 | 3300015351 | Miscanthus Phyllosphere | MEQVRELLDLLEGIEMSGELVAASFIVHRIQPYKERAHPGFDYTGDDDETRERTERLTKQ |
Ga0182161_11594301 | 3300015351 | Miscanthus Phyllosphere | SERPNSIDMEQVKEILNLIHGVELRGELVAASFIVRRVQPCKERAHLGFDFRGHDDGTR* |
Ga0182161_12404222 | 3300015351 | Miscanthus Phyllosphere | MEQMMELLDLIKGMEIRGELVAASFIVRRVQPCKERAHPGF |
Ga0182161_12424791 | 3300015351 | Miscanthus Phyllosphere | MEQVRELLDWLEGVEISDELVAASFIVHRSQPCKERAHPSFDYRGDDDGT* |
Ga0182159_11247691 | 3300015355 | Miscanthus Phyllosphere | MEQVRELLNLIKGMEINGGLVVASFIVHSIQPYKERAHPSIDF* |
Ga0182159_11251732 | 3300015355 | Miscanthus Phyllosphere | VKELLELIRGMKMKGVVMAVSFIVRRIQPYKERAHPGFDFNGDTDDT* |
Ga0182159_12244631 | 3300015355 | Miscanthus Phyllosphere | DMEQVKELLDLIQGVELRGELVAASFIVRRVQPCKERAYPAFDYKGDDDGTRERPE* |
Ga0182159_12804662 | 3300015355 | Miscanthus Phyllosphere | VRELLDLIKGVKTNYGIVAVSFIVRPVQPCKERAHVGFDFKGDTDGTRERTK |
Ga0182159_12972391 | 3300015355 | Miscanthus Phyllosphere | MDQVRELLSIIKGVRMNGGLVAASIIMRPIQPCKERAHVGFDFKGDTNGT* |
Ga0182159_13137381 | 3300015355 | Miscanthus Phyllosphere | MEQVRELLNLIKGVKTNDRLVAASFIVRRVQPCKERAHPAFEFKGESDGTRERQE |
Ga0182145_10887011 | 3300015361 | Miscanthus Phyllosphere | MEQVKELLDLIQGVEMRGELVAASFIVRHVQPFKERAHPGFDYTGDDDGTQESA* |
Ga0182145_11463251 | 3300015361 | Miscanthus Phyllosphere | MEQVMELLDLIKGLEPRGELVATSFIVHRIQPCKERAHPGFDYKGDNDR |
Ga0182203_10474581 | 3300017404 | Miscanthus Phyllosphere | MEQVQELLGLIKGMETNGGLVAVSFIVRRVQPCKERAHTGFEFKGDNDGT |
Ga0182203_11173021 | 3300017404 | Miscanthus Phyllosphere | MEQVRELVGLIKGVKTNGGLVAASFIVHRIQPCKERAHLGVDFKGDTNGT |
Ga0182203_11212392 | 3300017404 | Miscanthus Phyllosphere | MEQVRELLDLIKGMKMNGGLVAVSFIVRRVQPYKERAHLGFDYKGDDDGT |
Ga0182220_10663572 | 3300017407 | Miscanthus Phyllosphere | MEQVRELLDLIKGVRTNGGLVAASFIVRRIQPYKERAHMGYDFKGNTDGT |
Ga0182204_11086961 | 3300017409 | Miscanthus Phyllosphere | DMEQVRELLGLIKGMKMNGGLVAVSFIVRRVQPYKERAHTGFDFKGDTDGTRER |
Ga0182204_11170102 | 3300017409 | Miscanthus Phyllosphere | VRELLDLIKGVRTNGGLVAASFIVRYVQPCKERPHMGYDFKGDTDGT |
Ga0182207_11466431 | 3300017410 | Miscanthus Phyllosphere | MEQVMELLDLIQGVELRGELVAASFIVRRVQPCKERAHPGFDYRGDDDRTR |
Ga0182207_11754611 | 3300017410 | Miscanthus Phyllosphere | MDQVRELLSLIKGIKMNGVLVAASFIVRCIQPCKERAHAGFDFNGDTDGT |
Ga0182208_10134683 | 3300017411 | Miscanthus Phyllosphere | MEQVKELLGLIKGVKTNDGLVAASFIVRHVQPYKERAHISFDFK |
Ga0182208_11118911 | 3300017411 | Miscanthus Phyllosphere | EQVKELLDLIKGVRTNGGLVATSFIVCRVQPCKERAHLGFEFKGETDGT |
Ga0182202_10561072 | 3300017415 | Miscanthus Phyllosphere | MEQVNELLDLIQGVELRGELVAASFIVRRVQPYKERAHPGFDYRGDDNGTRESTE |
Ga0182219_10358532 | 3300017424 | Miscanthus Phyllosphere | MEQVGELFDLIKGVEIRGELVAASFIVRRIQPCKERAHPGFDYRGDD |
Ga0182219_11132042 | 3300017424 | Miscanthus Phyllosphere | MEQVRELLDLLEAVEISSELVAASFIVRRIQPYKERAHPGFDCRGD |
Ga0182224_11272111 | 3300017425 | Miscanthus Phyllosphere | MPSSADMEQVRELLNLIKGVKTNGGLVVVSFIVRRVQPCKERAHPAFEFTGETD |
Ga0182190_10613051 | 3300017427 | Miscanthus Phyllosphere | MELLDLIKGVEIRGKLVVASFIVRRVQPCKERAHPGFDYRGDDDGT |
Ga0182190_11268962 | 3300017427 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEIRGELVAASFIVRRVQPCKESAHPGFDYRGDDDRTQESVERLSKKEV |
Ga0182192_11721122 | 3300017430 | Miscanthus Phyllosphere | MEQVRELLGLIKGMKTNGGLVAASFIVRHIQPCKEGAHPAFELKGETDGT |
Ga0182206_10624431 | 3300017433 | Miscanthus Phyllosphere | VRELLDLIKGMEINDELVVVSFIVRHVQPCKERAHLGFDFKGNNDGT |
Ga0182206_10850911 | 3300017433 | Miscanthus Phyllosphere | MEQVRELLDLLEGIEISGELVAASFIVCRIRPCKERAHSGF |
Ga0182209_10991071 | 3300017436 | Miscanthus Phyllosphere | VRELLSLIKGVKMNGRLVAASFIVRRVQPCKERAHAGFDFKGDTNGT |
Ga0182209_11103651 | 3300017436 | Miscanthus Phyllosphere | MEQVRELLDLIKGMEINDELVAASFIVRCVQPCKERAHLGFD |
Ga0182209_11207912 | 3300017436 | Miscanthus Phyllosphere | MEQVKELLGLIKGVRTNGGLVAASFIVRRIQPCKERAHPGFEFKGETDGT |
Ga0182209_11572962 | 3300017436 | Miscanthus Phyllosphere | MDQVRELLDLIKGIKMNGILVVASFIVRRVQPYKERAHSSFDYRGDDDGT |
Ga0182209_11706231 | 3300017436 | Miscanthus Phyllosphere | MDQVRELLGLIKGVKTNDRLVAASFIVRRVQPYKERAHAGFDFKRD |
Ga0182191_11523062 | 3300017438 | Miscanthus Phyllosphere | VRELLDLIKGVRTNGGLVAASFIVRCVQPCKERAHMGYDFKGDTDST |
Ga0182221_11055511 | 3300017442 | Miscanthus Phyllosphere | MEQVRELLNLIKGMEINGGLVAASFIVRRVWPCKERAHPGFDFMGDNDGT |
Ga0182221_11134302 | 3300017442 | Miscanthus Phyllosphere | MEQVKELLSLIKGMRTNGGLVAASFIVRHIQLCKERVHPGFEFKGETDGTREK |
Ga0182193_10117591 | 3300017443 | Miscanthus Phyllosphere | MEQVMELLDLMKDLELRGELVATSFIVHRIQPCKERAHPGFDFRGDDDGT |
Ga0182193_10447511 | 3300017443 | Miscanthus Phyllosphere | MELLDLIKGVELRGELVVASFIVRCVQPYKERAHLAFDYKGDNDGTRENIDRLTKK |
Ga0182193_11563721 | 3300017443 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEISGELVVARFIVRRIHPYKERTHPSFDYRGDDDGT |
Ga0182233_10875432 | 3300017680 | Miscanthus Phyllosphere | EQVMELLDLIRGELVATSFIVRHIQPYKERAHPGFDYRGDDDRTQERTE |
Ga0182229_10692041 | 3300017682 | Miscanthus Phyllosphere | MEQVNELLGLIKGVKTNGGLVAASFIVHRIQPCKERAHPGDEFKGETDETRE |
Ga0182218_10679112 | 3300017683 | Miscanthus Phyllosphere | MEQVRELLDLIKGVRTNGGLVEASFIVRRIQPYKERAHMGYDFKGNTDG |
Ga0182218_11116251 | 3300017683 | Miscanthus Phyllosphere | MEQVKELLGLIKGVRTNGGLVAASFIVRHVQPCKERAHPGFEFKGETDGT |
Ga0182218_11124952 | 3300017683 | Miscanthus Phyllosphere | MEQVQELLGLIKGMETNGGLVAVSFIVRHVQPCKERAHTAFDFKGETDGT |
Ga0182225_10503871 | 3300017684 | Miscanthus Phyllosphere | MEQVRELLNLIKVVKTNGGLVAASFIVRRVQPCKERDHPAFEFKGESDGTREMQEMLSGDVVDE |
Ga0182225_10709511 | 3300017684 | Miscanthus Phyllosphere | LETPSSADMEQVRELLGLIKGMKTNGGLVAASFIVHHVQPYKERAHAAFDFKGETDG |
Ga0182225_11184232 | 3300017684 | Miscanthus Phyllosphere | MPSSADIEQVRELLGLIKGVKTNGGLVAASFIVHRVQPYKERAHVAFDFKGETDGT |
Ga0182227_10405902 | 3300017685 | Miscanthus Phyllosphere | ELLNLIKGVEINGRLVVARFIVCHIQPCKERAHLGFDFKGDNDGT |
Ga0182227_10521311 | 3300017685 | Miscanthus Phyllosphere | MEQVRELLSLIKGVEMNGGLVAVSFIVRRVQPYKERAHMGFDFKGDTVGTQER |
Ga0182227_11204172 | 3300017685 | Miscanthus Phyllosphere | MEQVRELLDLIKGVEINGELVAASFIVRHVQPYKERVHAGFDFKGDTDGT |
Ga0182227_11295871 | 3300017685 | Miscanthus Phyllosphere | MPSSTDMEQVRELLSLIKGVKTNDELVAASFIVCRVQPYKERAHPTFEFKGEADCIRERP |
Ga0182205_11227581 | 3300017686 | Miscanthus Phyllosphere | LVGELSSAYMEEVKELLDLIKGMKMNGRLVVMSFIMRHIQPYKERAHMGFDFKGDTDGT |
Ga0182231_11124371 | 3300017689 | Miscanthus Phyllosphere | MEQVRELLDLLEGVEISAELVAMSFIVRRIQPCKERAHLGFDYRGDD |
Ga0182223_10315711 | 3300017690 | Miscanthus Phyllosphere | LDLIKGVWTNGGLVALSIIVRHVQPCKERAHTGFDFKGDMDDT |
Ga0182223_10470521 | 3300017690 | Miscanthus Phyllosphere | MEQVKELLNLIKGLEIRGELVAASFIVRRVQPCKERAHLGLDFKGDTDGT |
Ga0182223_10827252 | 3300017690 | Miscanthus Phyllosphere | MDQVRDLLSLIKGIKMNGVLVAASFIVRCVQPCKERAHAGFDFNGDTDDT |
Ga0207704_112719563 | 3300025938 | Miscanthus Rhizosphere | MEQARELLDLIKGMEINDELVAASFIVRRVQPCKERAHPGFDYKGDDDGT |
⦗Top⦘ |