NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049090

Metagenome / Metatranscriptome Family F049090

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049090
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 115 residues
Representative Sequence MALVGEFPGLNQMHRRTIRAPVNPMDKSTIVSILPKFISERKATIQPGTFEIQPGSFEQPSILVVGPSSWWREVDENQPLLEIPVSSIQIADSVVRDYCNGLLACNM
Number of Associated Samples 127
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.24 %
% of genes near scaffold ends (potentially truncated) 95.92 %
% of genes from short scaffolds (< 2000 bps) 93.20 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.510 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(20.408 % of family members)
Environment Ontology (ENVO) Unclassified
(40.136 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.374 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.85%    β-sheet: 23.70%    Coil/Unstructured: 64.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF14083PGDYG 0.68
PF00313CSD 0.68
PF03237Terminase_6N 0.68
PF02945Endonuclease_7 0.68
PF04466Terminase_3 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms84.35 %
UnclassifiedrootN/A15.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_39084All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
2199352025|deepsgr__Contig_76017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium695Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_13676438All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium834Open in IMG/M
3300000559|F14TC_102832338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300000787|JGI11643J11755_10767560Not Available834Open in IMG/M
3300002100|JGI24809J26612_1012592All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1693Open in IMG/M
3300004157|Ga0062590_101309729Not Available714Open in IMG/M
3300004463|Ga0063356_103260935All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium699Open in IMG/M
3300004480|Ga0062592_101443020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium657Open in IMG/M
3300005289|Ga0065704_10029155All Organisms → Viruses → Predicted Viral1335Open in IMG/M
3300005293|Ga0065715_10143081All Organisms → cellular organisms → Bacteria1825Open in IMG/M
3300005294|Ga0065705_10155488All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1875Open in IMG/M
3300005294|Ga0065705_10693299Not Available634Open in IMG/M
3300005330|Ga0070690_101106679All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium628Open in IMG/M
3300005331|Ga0070670_101527454All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium613Open in IMG/M
3300005364|Ga0070673_101643776All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300005473|Ga0074250_10961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300005518|Ga0070699_100286051All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1477Open in IMG/M
3300005543|Ga0070672_102172778Not Available500Open in IMG/M
3300005553|Ga0066695_10319437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium977Open in IMG/M
3300005618|Ga0068864_100346630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1400Open in IMG/M
3300005713|Ga0066905_102200715All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300006196|Ga0075422_10168261All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium885Open in IMG/M
3300006603|Ga0074064_10092938Not Available555Open in IMG/M
3300006797|Ga0066659_11659161All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium538Open in IMG/M
3300006845|Ga0075421_101641059All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium698Open in IMG/M
3300006852|Ga0075433_10447829All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300006852|Ga0075433_10645253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium928Open in IMG/M
3300006880|Ga0075429_100002127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium16532Open in IMG/M
3300006880|Ga0075429_100009398All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium8490Open in IMG/M
3300006880|Ga0075429_100826227All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300006904|Ga0075424_101527808All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium708Open in IMG/M
3300006969|Ga0075419_10295965All Organisms → Viruses → Predicted Viral1090Open in IMG/M
3300007619|Ga0102947_1253797All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium651Open in IMG/M
3300009094|Ga0111539_11225478All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium871Open in IMG/M
3300009094|Ga0111539_11380842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium817Open in IMG/M
3300009100|Ga0075418_10634542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1150Open in IMG/M
3300009156|Ga0111538_11929919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium743Open in IMG/M
3300009156|Ga0111538_13822920Not Available521Open in IMG/M
3300009157|Ga0105092_10163166Not Available1241Open in IMG/M
3300009167|Ga0113563_13507108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300009610|Ga0105340_1088287All Organisms → Viruses → Predicted Viral1235Open in IMG/M
3300010047|Ga0126382_12147154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium536Open in IMG/M
3300010366|Ga0126379_11886851All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium701Open in IMG/M
3300010398|Ga0126383_10710627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1084Open in IMG/M
3300011402|Ga0137356_1062778All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium703Open in IMG/M
3300011403|Ga0137313_1000125All Organisms → cellular organisms → Bacteria26048Open in IMG/M
3300011403|Ga0137313_1037100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium822Open in IMG/M
3300011403|Ga0137313_1055748Not Available692Open in IMG/M
3300011409|Ga0137323_1019191All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1534Open in IMG/M
3300011413|Ga0137333_1113654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300011417|Ga0137326_1061786Not Available825Open in IMG/M
3300011419|Ga0137446_1049422All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium937Open in IMG/M
3300011420|Ga0137314_1053537Not Available976Open in IMG/M
3300011427|Ga0137448_1106392All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium761Open in IMG/M
3300011438|Ga0137451_1058380All Organisms → Viruses → Predicted Viral1138Open in IMG/M
3300011439|Ga0137432_1000759All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium12982Open in IMG/M
3300011445|Ga0137427_10006430All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4719Open in IMG/M
3300011445|Ga0137427_10145372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium973Open in IMG/M
3300011445|Ga0137427_10410372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300012143|Ga0137354_1048782Not Available673Open in IMG/M
3300012161|Ga0137336_1022076All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1128Open in IMG/M
3300012168|Ga0137357_1117311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300012200|Ga0137382_11341644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium503Open in IMG/M
3300012212|Ga0150985_100703198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium570Open in IMG/M
3300012212|Ga0150985_109443582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium919Open in IMG/M
3300012231|Ga0137465_1066367Not Available1073Open in IMG/M
3300012685|Ga0137397_11001085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium615Open in IMG/M
3300012892|Ga0157294_10019354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1307Open in IMG/M
3300012895|Ga0157309_10257041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300012900|Ga0157292_10096675All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium874Open in IMG/M
3300012901|Ga0157288_10019791Not Available1271Open in IMG/M
3300012903|Ga0157289_10124247Not Available767Open in IMG/M
3300012903|Ga0157289_10215934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium634Open in IMG/M
3300012909|Ga0157290_10146534All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium752Open in IMG/M
3300012913|Ga0157298_10026005All Organisms → Viruses → Predicted Viral1159Open in IMG/M
3300012915|Ga0157302_10114729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium870Open in IMG/M
3300012916|Ga0157310_10310601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium622Open in IMG/M
3300012916|Ga0157310_10349070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium598Open in IMG/M
3300012948|Ga0126375_11442698All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300012985|Ga0164308_10637695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium911Open in IMG/M
3300013296|Ga0157374_11030376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium842Open in IMG/M
3300013306|Ga0163162_11537270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium758Open in IMG/M
3300013306|Ga0163162_11986197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium666Open in IMG/M
3300013308|Ga0157375_12777286All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300013760|Ga0120188_1058373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300014166|Ga0134079_10217888Not Available809Open in IMG/M
3300014326|Ga0157380_10191706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1805Open in IMG/M
3300014745|Ga0157377_10990158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium636Open in IMG/M
3300014861|Ga0180061_1078207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium555Open in IMG/M
3300014866|Ga0180090_1023423All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium965Open in IMG/M
3300014873|Ga0180066_1020648All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1207Open in IMG/M
3300014879|Ga0180062_1088541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium697Open in IMG/M
3300014880|Ga0180082_1173500All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300015201|Ga0173478_10744144All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300015257|Ga0180067_1166630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium504Open in IMG/M
3300015371|Ga0132258_10997450All Organisms → cellular organisms → Bacteria2116Open in IMG/M
3300017659|Ga0134083_10329212All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium653Open in IMG/M
3300017792|Ga0163161_10291082All Organisms → Viruses → Predicted Viral1284Open in IMG/M
3300018063|Ga0184637_10020113All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4018Open in IMG/M
3300018068|Ga0184636_1279809Not Available589Open in IMG/M
3300018074|Ga0184640_10292162All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium740Open in IMG/M
3300018083|Ga0184628_10005589All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6009Open in IMG/M
3300019362|Ga0173479_10558968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium590Open in IMG/M
3300020059|Ga0193745_1121376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300020146|Ga0196977_1013884All Organisms → cellular organisms → Bacteria1959Open in IMG/M
3300021445|Ga0182009_10302529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium806Open in IMG/M
3300022915|Ga0247790_10192702All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300022917|Ga0247777_1129659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium836Open in IMG/M
3300023062|Ga0247791_1026432All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium880Open in IMG/M
3300023066|Ga0247793_1084381All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300023073|Ga0247744_1006954All Organisms → Viruses → Predicted Viral1418Open in IMG/M
3300023073|Ga0247744_1065287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium613Open in IMG/M
3300023102|Ga0247754_1035706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1127Open in IMG/M
3300023102|Ga0247754_1045556All Organisms → Viruses → Predicted Viral1010Open in IMG/M
3300023169|Ga0247762_1058484All Organisms → Viruses → Predicted Viral1073Open in IMG/M
3300023169|Ga0247762_1126102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium713Open in IMG/M
3300023263|Ga0247800_1060351All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium709Open in IMG/M
3300023266|Ga0247789_1058298All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium721Open in IMG/M
3300023270|Ga0247784_1160253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium587Open in IMG/M
3300024254|Ga0247661_1084923All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium594Open in IMG/M
3300025146|Ga0209322_10002004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium11685Open in IMG/M
3300025289|Ga0209002_10754461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300025315|Ga0207697_10172081All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium947Open in IMG/M
3300025923|Ga0207681_10153700Not Available1727Open in IMG/M
3300025930|Ga0207701_10310510All Organisms → Viruses → Predicted Viral1368Open in IMG/M
3300025938|Ga0207704_11160164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium658Open in IMG/M
3300026088|Ga0207641_11898439Not Available597Open in IMG/M
3300026095|Ga0207676_10312514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1439Open in IMG/M
3300027513|Ga0208685_1141697Not Available513Open in IMG/M
3300027533|Ga0208185_1043683Not Available1087Open in IMG/M
3300027533|Ga0208185_1054741Not Available959Open in IMG/M
3300027573|Ga0208454_1046247Not Available1012Open in IMG/M
3300027722|Ga0209819_10101727Not Available1003Open in IMG/M
3300027880|Ga0209481_10176708All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1061Open in IMG/M
3300027880|Ga0209481_10229273All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium932Open in IMG/M
3300027907|Ga0207428_10122716All Organisms → Viruses → Predicted Viral1991Open in IMG/M
3300027956|Ga0209820_1057525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1033Open in IMG/M
3300027993|Ga0247749_1000098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5891Open in IMG/M
3300028802|Ga0307503_10802866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium537Open in IMG/M
3300030606|Ga0299906_11303606All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300031184|Ga0307499_10322850All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium515Open in IMG/M
3300031547|Ga0310887_10992699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300031949|Ga0214473_11183236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium793Open in IMG/M
3300032053|Ga0315284_10809390All Organisms → Viruses → Predicted Viral1083Open in IMG/M
3300032211|Ga0310896_10305203All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium824Open in IMG/M
3300034147|Ga0364925_0191737All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium751Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil20.41%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.24%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere11.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.72%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.72%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.04%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.04%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.04%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.36%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.36%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.36%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.36%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.68%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.68%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.68%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.68%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.68%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005473Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1Host-AssociatedOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007619Soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_D2_MGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011420Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012161Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT300_2EnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012231Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013760Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C3.rep2EnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014879Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020146Soil microbial communities from Anza Borrego desert, Southern California, United States - S3+v_10-13CEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300022917Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L154-409C-5EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300023102Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5EnvironmentalOpen in IMG/M
3300023169Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L081-202R-4EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300023266Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S220-509R-4EnvironmentalOpen in IMG/M
3300023270Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L169-409R-5EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025146Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 1EnvironmentalOpen in IMG/M
3300025289Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027513Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes)EnvironmentalOpen in IMG/M
3300027533Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300030606Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_003099802199352025SoilMLVGEFPGIGQQNRRTIRAPVNPMDKSTVVSILPKLIYERKPTISPGIFELNPGTFDKPTVLVVGPSSWWREVDENQPLLEIPVSSIQVADSIVKDYCNGLL
deepsgr_010640702199352025SoilQVGSFPGLNSPNRRTIRSPVNPLDKSTIVSILPKQISERKLTISPGSFDIPPGSFEKPSILVVGTSSWWREIDEHQPLLEITVSSIQVADSIVRDYSNGLLGCNMDDLKPGLFYIPGEFSLEGIKKQHMPSLLKAQFSQR
ICChiseqgaiiFebDRAFT_1367643813300000363SoilMSVVGQFPGFAERNRRTIRAPINPLDRSTVVSIFPKLIEERKVTIQPGLFVIPPGSIEHPSLLVVTPSSWWREIDEEQPLLEIPVSSIQIADSIVRDYCNGALACNMADTMPG
F14TC_10283233823300000559SoilMSQVGAFPGMDWRRRTIRGPINPLDKSTIVSIYPKEINERKATIQPGQFIIAPGTVEKPKILVVGPSSWWRDIDEDQPLLEIPVSSIQIADSV
JGI11643J11755_1076756013300000787SoilMSVVGQFPGFAERNRRTIRAPINPLDRSTVVSIFPKLIEERKVTIQPGLFVIPPGSIEHPSLLVVTPSSWWREIDEEQPLLEIPVSXXQIADSIVRDYCNGALACNMADTMPG
JGI24809J26612_101259243300002100SoilMSQVGFPGWSAINRRTTRAPVNPMDKATIVSIFPIEINETKCTLQPGVFNIPAGHYEKPSILVVGPSSWWREIDPEQPLLEIPVASILIADSVVRDY
Ga0062590_10130972913300004157SoilMSMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWRE
Ga0063356_10326093513300004463Arabidopsis Thaliana RhizosphereMSQVGAFPGINDWKRRTIRGAVNPLDKSTIVSILPKDIDEIKHTIQPGRFFISAGSIQKPSILVVGPSSWWREIDEEQPLLEIPVSSIQVADSVVKDYANGVFACNMA
Ga0062592_10144302023300004480SoilMVQVGEFPGLAQSNRRTIRAPINPMDKSTVASILPKRIVERKATIQPGTFELNPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSIQIADSIVRDYANGLLACNMADQMPGLFYVPGEFTVEKL
Ga0065704_1002915513300005289Switchgrass RhizosphereMQVGEFPGLHGPNRRTIRAPVNPMDKSTVVSVLPKLIWERKITIQPGVFEIKPGTFDNPSILV
Ga0065715_1014308163300005293Miscanthus RhizosphereMQVGEFPGIHQANRRTMRAAVNPLDKSTVVSILPKRILETKITIQPGVFELPAGSAEKPAILVVGSSSWWREVDIDQ
Ga0065705_1015548843300005294Switchgrass RhizosphereMPVSIGFADMAGLHKRKTVRSPVNPMDKSTVVSIYPKPIDEIKPTTQPSRFKMDAGSLENPALLVVGPSSWWREVDEDQPLLEITNSSIQVADSIVRDYCNGLLVCNMGDTMPGIFFVPGEYDIIGIRAKYKNL
Ga0065705_1069329913300005294Switchgrass RhizosphereMQVGEFPGLHGPNRRTIRAPVNPMDKSTVVSVLPKLILERKITIQPGVFEIKPGTFDNPSILVVGSSSWWR
Ga0070690_10110667913300005330Switchgrass RhizosphereMQVGEFPGIHQANRRTMRAAVNPLDKSTVVSILPKRILETKITIQPGVFELPAGSAEKPAILVVGSSSWWREVDIDQPLLEIPVSSIQVADSIVKDYCNGLLACNMTDMMPGIFYVPGEITVAKLKTDHAPLLAKAIATQR
Ga0070670_10152745413300005331Switchgrass RhizosphereMQVGNFPGLESPHRRIIRAPINPMDKATVVSILPKPILETKITIQPGVFEIKPGTFENPAVLVVGSSSWWREIDQDQPLLEIPVSSVQVADSIVADYCNGLLACDMADRMPGLF
Ga0070673_10164377613300005364Switchgrass RhizosphereMQVGEFPGIHQANRRTMRAAVNPLDKSTVVSILPKRILETKITIQPGVFELPAGSAEKPAILVVGSSSWWREVDIDQPLLEIPVSSIQVADSIVKDYCNGLLACNMTDMMPGIFYVPGEITVAKLKTDHAPLLAKAIATQRKWYYEL
Ga0074250_1096113300005473Switchgrass RhizosphereLAIQVGEFPGLQAPTNRRTIRSPVNPLDKSTIVSILPKPIYERKITIQPGVFELKPGSFDNPAILVVGPSSWWREVDIDQPLLEIP
Ga0070699_10028605113300005518Corn, Switchgrass And Miscanthus RhizosphereMSFGFPGLVDMNRRTVRAETNPLDVSTIVSILPKEIDEKKSTIQPGRFIIPPGSFEKPALLTIEPSSWWKEISDEEPLLEIPISSIVVANSVVQDYCNGIY
Ga0070672_10217277823300005543Miscanthus RhizosphereMSQVGEFPGMNALKRRTIRAPINPMDKSTVVSILPKPIEERKVTIQPGLFSIPPGTFDKPAILVVGP
Ga0066695_1031943723300005553SoilLGVVGQFPLMSDLKRRTIPAPVNPLDKCTVVSIYPKAIHEKKHTIQPGVFDIEPGSYDKPSILVVGPSSWWKELDENQPLLEIPQSSIQIADSVVKDYINGIYGCDMGEN
Ga0068864_10034663013300005618Switchgrass RhizosphereMQVGEFPGLQQTNRRTIRAPVNPMDKSTIVSILPKVISERKATIQPGFFHIEAGTLESPAVLVVGPSSWWREVDEHQPLLEIPVSSIQIADSIVRDYANGLLACNMAEQMPGLFYVPGEYTVERIKKEHAPLLQQANAKQRNWYKELIRIADILWSRSNGNPLSISEDARIACHELNI
Ga0066905_10220071513300005713Tropical Forest SoilMSQVGAFPTHAAFRRRTIRGPVNPMDKSTVVSIYPKEIHEKKITLQPGEFHIMPGTYETPAVLVVGTSSWWREIDEEQPLLEIPVSSIQIADSIVRDYNN
Ga0075422_1016826133300006196Populus RhizosphereMQVGEFPGLLQQNNRRTIRAPVNPMDKSTVVSILPKLIEERKPTCQPGFFALKPGNYENPSILVVGPSSWWREIDENQPLLEIPVSSIQIADSIVRDYCNGLLAC
Ga0074064_1009293813300006603SoilMLVGEFPGMNQMNRRTIRAPVNPLDKSTVVSILPKPISERKATIQPGVFELTPGTFENPSILVVGTSSWWREIDENQPLLEIPVS
Ga0066659_1165916123300006797SoilMTLQIGQNAPWMVPSNRRLIKSPINPLDKSTVISIYPKEITEEKPTLQPGMFHIEAGSYDKPTILIIGPSVWWKEVDEQQPLLEITISSIQIADSIVKDYAGAL
Ga0075421_10164105923300006845Populus RhizosphereMSGAVGAFPGINDWKRRTIRGPINPLDRSTVVSIFPKDIEEKKPTIQPGIFRIPAGTVENPGILIVGPSSWWRDIDEEQPLLEIPVSSIQIADSVVRDYLNGYLACNMDSHMPGLFY
Ga0075433_1044782933300006852Populus RhizosphereMQVGEFPGLQHANNRRTIRAPINPMDKSTVVSILPKEIHERKPTIQPGFFDLGPGSFDSPSILVVGPSSWWREIDENQPLLEIPVSSIQIADSIVK
Ga0075433_1064525313300006852Populus RhizosphereMIMQVGEFPGLGNTNRRTIRGPINPMDKSTIVSLLPKAISERKATIQPGIFEIPAGSFDKPAILVVGPSSWWREIDEHQPLLEIPVSSIQIADSIVRDYCNGLLACNMADQMPGIFYVPGDYNLERLRKEHAPLLANAIA
Ga0075429_100002127263300006880Populus RhizosphereMAGVDDLVEVNVGSFPGMAGSNRRTIRSPVNPLDKSTVVSILPKQISERKATIFPGVFEIPPGSFEHPSILVVGTSSWWRDIDEGQPLLEITVGSVQVADSIVRDYSNGLLACNMDDMKPGLFYIPGEFSLEGIKKQHMPSLLKAQAAQKKWFAELVRIADILWSRS
Ga0075429_100009398133300006880Populus RhizosphereMTQVGEFPGLQSPVNRRTVRAPQNPLDKSTVVSILPKFIHERKITLQPGVFDINPGTFDSPSLLVVGTSSWWREV
Ga0075429_10082622723300006880Populus RhizosphereMSGAVGAFPGINDWKRRTIRGPINPLDKSTVVSIFPKNIEEKKCTIQPGIFNIPAGTFEKPGILVVGPSSWWRDIDEDQPLLEIPVSSIQIADSVVRDYLNGYLACNMDSHMPGLFYVMGCKTNAKGEP
Ga0075424_10152780823300006904Populus RhizosphereMGQVGEFPGLHQMHRRTIRAAVNPMDKSTIVSIYPKSITEFKATIQPNTFVIPAGSFEKPAILVVGPSSWWREVDEEQPLLEIPVSSIQIADSVVKDYANGLLGCNMSDQMPGLFYIPGEFTSAEIKEKHVPLL
Ga0075419_1029596533300006969Populus RhizosphereMQVGEFPGLTTRNRRTIRAAVNPLDKSTVVSILPKSISERKATIQPGMFELNPGTYENPSILVLGPSSWWREIDENQPLLEIPVSSIQVADSIVRDYCNGLLACNMADQMPGLFYLPGEFTVEKLKKEHLALLNKARDQQK
Ga0102947_125379723300007619SoilMASPVGQFPDLNRRMIRAPVNPLDKSTVVSILPKEIIEIKHTIQPGKFVIPPGSEDKPSLLVVGPSSWWRDIDEEQPLLEIPHSSVQIAESIVIDYCNGILGY
Ga0111539_1122547813300009094Populus RhizosphereMMQVGEFPDPNRRTIRAAVNPLDKSSIVSILPKRIVETKLSIQPGVFELRPGTVENPSILVVGPSSWWREVDENQPLLEIPVSSIQIADSVVKDYCVGLLACDMAGQMPGLFYVPGELTVEKLKKEYAPLIQKANASQRKWFAELIRLADIMWARTNGNPLSISDDARLACKELNIHNKP
Ga0111539_1138084223300009094Populus RhizosphereMPGMQVGDLGPTNRRTIRAAVNPMDKSTIVSILPKWINERKPTIQPGMFDLAPGTFENPSLLVIGPSSWWREVDENQPLLEIPVSSIQIADSVVRDYTNGLLACNMGDQAPGLFYVPGEYTVEKLKKEHMPLLLK
Ga0075418_1063454213300009100Populus RhizosphereMSQVGAFPGMDWRRRTIRGPINPLDKSTIVSIYPKEINERKATIQPGQFIIAPGTVEKPKILVVGPSSWWRDIDEDQPLLEIP
Ga0111538_1192991923300009156Populus RhizosphereMGQVGEFPGLHQMHRRTIRAAVNPMDKSTIVSIYPKLITEFKATIQPNTFVIPAGSFEKPAILVVGPSSWWREVDEEQPLLEIPVSSIQIADSVVKDYANGLLGCNMSDQMPGLFYIPGEFTSAEIK
Ga0111538_1382292013300009156Populus RhizosphereMVQVGEFPGLGVTNRRTIRAPVNPMDKSTVVSILPKHIVEKKITIQPGTFELAPGTFENPAVL
Ga0105092_1016316613300009157Freshwater SedimentMSVVGEFPGIQATTRRTIRAQVNPMDKSTIVSILPKQISERKATISPGFFELAPGTFDSPSILVVGTSSW
Ga0113563_1350710823300009167Freshwater WetlandsMSIGLPGLDIHRRTIRGPVNPLDKSTVVSIFPKRIDELKHTLQPGRFIIEPGTYDKPAILTVGPSSWWRELDEQQPLLEIPVSSIQIAESIVVDYC
Ga0105340_108828713300009610SoilMQVGEFPGMAQMNRRTIRAPVNPMDKSTVVSILPKRILERKATCQPGIFELSPGSAELPAVLVVGPSSWWREVDENQPLLEIPVSS
Ga0126382_1214715423300010047Tropical Forest SoilMSIVGQFPGLHSFKRRLIRAPANPLDKCTIVSIYPKDVDEYKCTIQPGRFKIPAGSLQKPSLLVVGPSSWWREVDEDQPLLEIPVSSIQIADS
Ga0126379_1188685123300010366Tropical Forest SoilMQLLMTEQRRTVRAPVNPMDKSTVVSIFPAAVDDRKVTIQPGHFHLEPGTYENPATLVVGPSSWWRDGGEDQPLIEVVNSSIQVADSIVRDYINGMIGCDMGES
Ga0126383_1071062713300010398Tropical Forest SoilMGLVGEFPGIAATMRRTIRATPNPLDKSTVVSLLPKPILERKPTIQPGLFELAPGSPERPSLLVVGSSSWWREVDENQPLLEIPTSSIQIADAVVRDYCNGLLACNMSDQMPGLFYVPGEITVEKLKKEHQPLIDRYTSYQKRWYLELIRLADILWSR
Ga0137356_106277813300011402SoilFPGIAQTNRRAIRAEINPMDKSTVVSILPKQISERKATISPGYFEIPPGTFEKPSILVVGTSSWWREIDENQPLLEIPVSSIQIEIVS*
Ga0137313_100012513300011403SoilMDKSTVVSILPKVIMERKATIQPGIFELKKGSLENPAILVVGASSWWREVDIDQPLLEIPVSSIQIADSIVRDYCNGLLACNMADLMPGLFYLPGEFTVAKLKAEHEPLLKKAAANQKRWFLELVRIADILWSRSNGNPLAISEDARIA
Ga0137313_103710023300011403SoilMSMVAGEFPGIAQTNRRAIRAEINPMDKSTVVSILPKQISERKATISPGYFEIPPGTFEKPSILVVGTSSWWREIDENQPLLEIPVSSIQIADSIVRDYCNGLLACNLDDMMPGLFYIPGEFTVEKIQKDYSPLLVQAKEKQKKWFMELIRIADILWSRSNGNPLAISTDARVACRELNITNKPWL
Ga0137313_105574813300011403SoilMLVGEFPGLNQTNRRTIRAQVNPLDKSTIVSILPKAINERKATISPGFFNLAPGTFENPAILVVGPSSWWREV
Ga0137323_101919113300011409SoilMGMAPGSVGAFPGINAWKRRTIKAPDNPLDRCTIVSIYNKEIDEIKETIQPGRFVIPAGTLEKPGILVVGSSSWWKEVDTEQPLLEIPVSSIQIADSVVRDYCNGIVGCDMAETMPG
Ga0137333_111365413300011413SoilMALMEVLNRRTLRAPVNPMDVSTIVSILPKEIDEVKPTLQPGRFIIPPGSYENPGILVVGPSSWWKELENDQPLLEIPVGSIRIADSVVKDYCNGIF
Ga0137326_106178613300011417SoilMSMVAGEFPGIAQTNRRAIRAEINPMDKSTVVSILPKQISERKATISPGYFEIPPGTFEKPSILVVGTSSWWREIDENQPLL*
Ga0137446_104942213300011419SoilMSLVGGFPGLREMRRRTIRAPVNPMDKATIVSIYPKEITETKFTIEPGVFHIKAGSYENPALLVVGPSSWWREIDEEQPLLEIPVGSIQIADSVVKDFCNGLIAYVVEVSSPGLFYIAG
Ga0137314_105353713300011420SoilMSVVGEFPGLQHTHRHTVRAPLNPMDKSTIVSILPKEINERKPTMQPGFFNIGPGSFDSPAILVIGSSSWWKEIDENQPLLEIPVSSI
Ga0137448_110639223300011427SoilMSVVGGFPGLADHMRRTIRAPVNPIDKSTIVSIFPKEIKETKHTIQPGYFEIPAGTYDKPALLIVGPSSWWKEVDDNQPLLEIPVSSVQIADSIVKDYCNGILACDMSESMPGLFYVPGEHKLEGILKSYKHVL
Ga0137451_105838023300011438SoilMDAAQVGEFPGLHAPANRRTVRAPVNPMDKSSIVSILPKQISERKITIQPGVFEIPPGSFDKPSILVVGTSSWWREVDIDQPLLEIPVSSVQIADSIVRDYCNGLLACDMADLMPGLFYIPGDFGVEKLKKEYMPLLVKAQAKQRNWYKELIRIADILWSR
Ga0137432_1000759173300011439SoilMDKSTVASILPKRIVERKATCQPGTFELNPGTFENPSVLVVGPSSWWREVDENQPLLEIPVSSIQIADSIVRDYANGLLACNMADQMPGLFYIPGEFTVEKLKKEHTALLLSAQAKQKKWFLELVRIADILWSRSNGNPLSISDDARLACREL
Ga0137427_1000643013300011445SoilMQVGEFPGISNPNRRTIRAAINPMDKSTVVSILPKSISERKATIQPGIFEIKPGTFENPSILVLGPSSWWREVDENQPLLEIPVSSIQVADSIVRDYSNGLLACNMSDQMPGLFYVPGEWTVEKLKKDHMQLLIKAQNAQKKWFIEL
Ga0137427_1014537223300011445SoilMPVGGFPGMQSQMSRTVRAPVNPMDKSTVVSIFPKEINEVKNTISPGSFKVEAGSWDKPSLLVVGPSSWWKFIDDEQPILEIPCGSNQVANSIVNDYCNGLVGCNMTNSMPGVFWVPGEYDLVT
Ga0137427_1041037213300011445SoilMMSQVGAFPGLNWKRMTIRGPINPLDRSTIVSICPKTVHERKCTIQPGEFHIEPGSVAKPSLLIVGPSSWWRDIDEEQPLLEIPVSSIQIADSVVRDYCNGIVGCDMAETMPGFFYVPGAKVNDK
Ga0137354_104878213300012143SoilMQVGEFPGIAQTTRRTIRAPVNPMDKSTVVSILPKRISERKATISPGFFELAPGTFENPSVLVI
Ga0137336_102207613300012161SoilMDKSTVVSILPKHISERKATISPGFFEIPPGTFDNPAVLVVGTSSWWREIDENQPLLEIPVSSIQIADSIVKDYCNGLLACNLDDMMPGLFYVPGEYNVEKLKKEFMPLLLSYRDKQRRWFMELIRIADILWSRSNGNPLSVSSDARLACRELNITEKPWLTDMQT
Ga0137357_111731123300012168SoilMAIMTLGDIHRRLIRAPVNPLDKSTVVSILPKEIDETKHTIQPGRFIIPPGSYDKPALLVVGSSSWWKELDEGQPMLEIPCSSIQVADSIVKDYCNGILACNMGDI
Ga0137382_1134164423300012200Vadose Zone SoilVISTFLNDTNRGTTRAPVNPLDKSTIVSIFPKLIEEIKHTIQPGKFRIEAGTYEKPTSLIVGPSSWWKELDPEQPLLEIPVSSIQIADSVVKDYCNGLV
Ga0150985_10070319813300012212Avena Fatua RhizosphereMPIQVGEFPGLNVPSNRRTIRAPVNPLDKSTVVSILPKYINERKATISPGVFELLPGSFEKPSILVLGTSSWWREIDEGQPLLEITVSSIQVADSIVRDYSNGLLACDMAELMPGLFYVPGEFDITKLKKDHMPSLMRAQANQKRWFMELIR
Ga0150985_10944358223300012212Avena Fatua RhizosphereMQVGEFPGLDQSNRRTIRAQVNPLDKSTIVSILPKYISERKATIQPGIFELKPGTYENPSVLVVGPSSWWREVDEHQPLLEIPVSSIQIADSVVRDYTVGLLGCNMSDMMPGLFYVPGEFDVTRLKKEHAALLIKAQMNQKKWFLELVKLADILWSRSNGNP*
Ga0137465_106636713300012231SoilMQVGEFPGIQQSNNRRTIRAPSNPMDKSTVVSILPKEIHERKATIQPGFFDISPGTFDNPAILVVGPSSWWREIDENQPLLEIP
Ga0137397_1100108523300012685Vadose Zone SoilMSFAVLNDLRRRTIRAPINPMDKCTIVSIYPQEIGPEKKPTISPGIFLIPAGTYDVPGILVVGPSSWWRDIDENQPLLEIPNSSIQVADSVVKDYCNGLIACNM*
Ga0157294_1001935433300012892SoilMQVGEFPGINQVNRRTIRAPVNSLDKSTVVSILPKRIYETKITIQPGVFEIAPGSMEHPSVLVVGASSWWREVDTDQPLLEIPV
Ga0157309_1025704123300012895SoilMQVGEFPGIQQTGRRTIRAPINPMDKSTVVSILPKEIHERKATIQPGFFDLAPGTFDNPSILVVGPSSWWREIDENQPLLEIPVSSIQIA
Ga0157292_1009667523300012900SoilMSVVGEFPGISTTGRRTIRAEINPMDKSTVVSILPKKINERKPTISPGFFELAPGSFENPSILVVGTSSWWREIDENQPFLEIPVSSIQIADSIVRDYCNGLLACNLDDMMPGLFYIPGEITVEKLKKEHAPLLIQARDNQKRWFMELVRIADILWS
Ga0157288_1001979113300012901SoilMQVGEFPGIQQTGRRTIRAPINPMDKSTVVSILPKEIHERKATIQPGFFDLAPGTFDNPSVLVVGPSYWGREIDENQPLLEIPVSSIQIADSIVKDYLNGLLAANMSDQMPGLFYVPGEYTVEKLKKEHMPLLLAAQARQKKWYMELIRIADILWSRSNGNPLSISTDARMGCKELNI
Ga0157289_1012424713300012903SoilMQVGEFPGIQQTTRRTIRAPINPMDKSTVVSILPKEIHERKPTIQPGFFDMGPGSFDSPSVLVVGP
Ga0157289_1021593423300012903SoilMTQVGEFPGLQQTNRRAIRAPVNPLDKSTVVSILPKLLHENKITIQPGIFEVPPGSFDNPSVLVVGSSSWWREIDENQPLLEIPLSSVQIADSIVRDYCNGLLGCNMADLMPGLFYIPGEYTADRVKKEQFLLLNKARENQKRWYLELVRIADILWS
Ga0157290_1014653423300012909SoilMDKSTIVSILPKYIAERKLTIQPGLFEIKPGNYENPAILVVGPSSWWREVDADQPLLEIPVSSIQIADAVVRDYCNGLLACDMDTLMPGLFYVPGEFTIEKLKKDHTPLLMKAQLNQRKWYAELIRIADIMWSRTN
Ga0157298_1002600513300012913SoilMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSVQIADAIVRDYCNGLLACNMADQMPGIFYLPGEYTVEKVKKEQPLLLQKALANQKKWFMELIRIADILWSRSNGNPLSISDDSRLA
Ga0157302_1011472913300012915SoilMPGFPLMSELKRRTVAAPVNAMDKSTIVSIFPKHILEKKPTIQPGIFEIKPGSYLSPSILVVGSSSWWKEIDENQPLLEIPHSSVVVADSIIKDYCNGI
Ga0157310_1031060113300012916SoilMSQVGEFPGLHQMHRRTIRAQVNPMDKSTVVSIYPKAITEFKATIQPNTFVIPAGTFDKPSVLIVGPSSWWREVDEEQPLLEIPVSSIQIADSIVKDYANGLLGCNMQDQMPGIFYLPGEYTSVEVKTKHPALLVSAQAKQKKWLLELIRMADIMWSRSQGNPLSVSDDARMACRELNIQNKPWL
Ga0157310_1034907023300012916SoilMQVGEFPGIQQNNNRRTIRAAINPMDKSTVVSILPKEIHERKATIQPGFFDLAPGTFDSPSVLVVGPSSWWREVDENQPLLEIPVSSIQIADSIVKDYLNGLLAANM
Ga0126375_1144269823300012948Tropical Forest SoilMDKTTIVSIFPKPLDETKHTIEPGFFHINPGSPENPALLVVGPSSWWKHLEENQPLLEIPQSSIVVAHAIVNDYCNGLLGCNMGDKFPGLFYI
Ga0164308_1063769513300012985SoilMQVGEFPGLQQTNRRTIRAPVNPMDKSTIVSILPKHISERKATIQPGFFEIQAGSLENPALLVVGPSSWWREVDEHQPLLEIPVSSIQIAYSIVRDYANGLLACNMAEQMPGLFYVPGEYTVER
Ga0157374_1103037623300013296Miscanthus RhizosphereMLVGEFPGLNQANRRTIRAPTNPMDKSTVVSILPKHISERKATISPGIFEIPPGSMEMPSLLVVGTSSWWREIDENQPLLEI
Ga0163162_1153727023300013306Switchgrass RhizosphereMLVGEFPGLNQANRRTIRAPTNPMDKSTVVSILPKLISERKATISPGIFEIPPGSVEMPSLLVVGTSSWWREIDENQPLLEIPVSSIQVADSIVKDYCNGLLACNMGDMMP
Ga0163162_1198619723300013306Switchgrass RhizosphereMSQVGEFPGMNALKRRTIRAPINPMDKSTVVSILPKPIEERKVTIQPGLFSIPPGTFDKPAILVVGPSSWWRDIDEDQPLLELPVSSIQVADSIVRDYCNGLHLC
Ga0157375_1277728613300013308Miscanthus RhizosphereMSQVGEFPGMNALKRRTIRAPINPMDKSTVVSILPKPIEERKVTIQPGLFSIPPGTFDKPAILVVGPSSWWRDIDEDQPLLELPVSSIQVADSIVRDYCNGLHLCNMADQMPGLFYIPGEFSAEKIKKDFGPLLIAAQAKQKKWFLELVKAADILWS
Ga0120188_105837323300013760TerrestrialMSVIGGFPLMSDIKRRTIRAPSNPLDKSTVVSILPKYILEKKCTIQPGVFEIKPGTYQSPSLLVVGPSSWWKEIDENQPLLEIPQSSIQIADSIVRDYCNGILGCDMADNMPGLFYVPGAIDISKLRKDYLP
Ga0134079_1021788813300014166Grasslands SoilMPIQVGEFPGLNVPSNRRTIRAPVNPLDKSTVVSILPKYINERKATISPGVFELLPG
Ga0157380_1019170613300014326Switchgrass RhizosphereMQVGNFPGLESPHRRIIRAPINPMDKATVVSILPKPILETKITIQPGVFEIKPGTFENPAVLVVGSSSWWREIDQDQPLLEIPVSSVQVADSIVADYCNGLLACDMADRMPGLFYVPGEYTVEKLKKDHTNMLIKAKAQ
Ga0157377_1099015813300014745Miscanthus RhizosphereMQVGEFPGLQQTNRRTIRAPVNPMDKSTIVSILPKVISERKATIQPGFFHIEAGTLESPAVLVVGPSSWWREVDEHQPLLEIPVSSIQIADSIVRDYANGLLACNMAEQMPGLFYVPGEYTVERIKKEHAPLLQ
Ga0180061_107820723300014861SoilMSIVGEFPGISQINRRTLRAPVNPMDKCTIVSIFPKWVRESKATITPGFFEIPPGSFEKPSILVVGTSSWWKEIDEHQPLLEIPVSSIQVADSIVNDYCNCLLASNAGDQKPGIFYIPGEHTEDGLKKNHMPLLIDAQAK
Ga0180090_102342313300014866SoilMSMVGEFPGLQNNNRRTIRASVNPLDKSTIVSIMPKEIHERKPTIQPGFFDMGPGSFDSPSILVVGPSSWWKEIDENQPLLEIPVSSIQIADSVVKDYLNGLLAA
Ga0180066_102064813300014873SoilMAVMTLGDMNRRLIRAPINPLDKSTVVSILPKLIDETKHTIQPGRFIIPPGSYDKPALLVVGSSSWWKETDEGQPMLEIPHSSIQIADSIVKDYCNGIL
Ga0180062_108854123300014879SoilMLVGEFPGLNQTNRRTIRAQVNPLDKSTIVSILPKAINERKATISPGFFNLAPGTFENPAILVVGPSSWWREVDENQPLLEIPVSSIQIADSVVRDYANGLLACNMG
Ga0180082_117350013300014880SoilDKSTIVSILPKEINERKPTMQPGFFNIGPGSFDSPAILVIGSSSWWKEIDENQPLLEIPVSSIQVADAIVTDYVNGLLACNMADMTPGLFYLPGEYTVEKLKKEHMPLLVAARDKQRKWYMELVRIADILWSRSNGNPLAISTDARIACAELNITNKPWLGDSQTA
Ga0173478_1074414413300015201SoilMQVGEFPGLHQMHRRTIRAAVNPMDKSTVVSILPKRIYERKATIQPGIFEIYPGTFDSPSVLVVGSSSWWREVDEEQPLLEIPVSSIQVADSIVRDYSNGLLGCNMSDQMPGLFYIPGA
Ga0180067_116663023300015257SoilMSTVAGEFPGIASTHRRTIRAAINPMDKSTIVSILPKELHERKVTIQPGYFDIPAGSFDNPAILVVGTSSWWREIDENQPLLEIPVSSIQIADSIV
Ga0132258_1099745053300015371Arabidopsis RhizosphereMPPFGSLNRQTIRAPINPLDKSTVVSILPKEIDEVKHTIQPGRFIIAPGSYEHPAVLVVGPSSWWKELEPEQPLLEIPISSIQIAD
Ga0134083_1032921213300017659Grasslands SoilMSSVGAFPGINDWRKRTTRAPINPLDKSTVVSIYPKEIDEKKATIQPGRFIVKSGTPSNPSLLVVGPSSWWKEIDEDQPLLEIPVSSIQIADSIVKDYCNGILACNMADAMPGLFYVPGEHDIHSIRKSYAHELIN
Ga0163161_1029108243300017792Switchgrass RhizosphereMLVGEFPGLNQANRRTIRAPTNPMDKSTVVSILPKLISERKATISPGIFEIPPGSVEMPSLLVVGTSSWWREIDENQPLLEIPVSSIQVADSIVKDYC
Ga0184637_1002011313300018063Groundwater SedimentMSFAQLADYRRNTVRAPVNPLDKSTIVSIYPKEIKETKHTIQPGYFEIPAGTYLNPAILVVGPSSWWKEIDEQQPILEIPTSSIHVADSVVKDYCNGL
Ga0184636_127980913300018068Groundwater SedimentMVQVGEFPGLAQSNRRTIRAPINPMDKSTVASILPKRIVERKATIQPGTFELNPGTFENPSVLVI
Ga0184640_1029216213300018074Groundwater SedimentMQNPFQFLNRQTVRAPSNPLDKCTIISIYPKDIHEEKCTIQPGVFDIKGGTYEKPSVLIVGPSSWWKELDDSQPLLEIPQSSIQIADSIVRDYANGLLACNMG
Ga0184628_1000558913300018083Groundwater SedimentMVQVGEFPGLAQSNRRTIRAPINPMDKSTVASILPKRIVERKATIQPGTFELNPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSIQIADSIVRDYANGLLACNMADQMPGLFYVPGEFTVEKLKKEHTPLLLKAQAQQKKWFLEL
Ga0173479_1055896823300019362SoilMQVGEFPGIQQTTRRTIRAPINPMDKSTVVSILPKEIHERKATIQPGFFDLAPGTFDNPSVLVVGPSSWWREIDENQPLLEIPVSSIQIADSIVKDYLNGLLAANMSDQMPGLFYVPGEYDVARLKKEHM
Ga0193745_112137623300020059SoilMSQVGVFPGFHDFRRRTIRAPVNPMDVSTVVSILPKEIDERKWTIQPGKFLIPAGSFENPGVLVVGPSSWWKELDEEQPLLEIPCSSIQVADSVVKDYCNGILGCNMGDTMPGLF
Ga0196977_101388413300020146SoilMSGILAIHQQHVMRAPVNPLDKSTLVSIYPLLISQKNVTITPGVFEIPPGSLEKPSLLVVGSSSWFREVDENQPLLEIPVSSIV
Ga0182009_1030252913300021445SoilMAQVGEFPGIHQLHRRTVRGPINPMDKSTIISIYPKEIVEIKYTIQPGKFVVPPGTLDKPGILTVGPSSWWRDIDEDQPLLEIPVSSIQI
Ga0247790_1019270223300022915SoilMSMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSV
Ga0247777_112965923300022917Plant LitterMLVGEFPGLNQANRRTIRAPTNPMDKSTVVSILPKHISERKATISPGIFEIPPGSVEMPSLLVVGTSSWWREIDENQPLLEIPVSSIQVADSIVKDYCNGLLACNMGDMMPGLFYLPGEYTVNKLQTDH
Ga0247791_102643223300023062SoilMSMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSVQIADAIVRDYCNGLLACNMADQMPGIFYLPGEYTVEKVKKEQPLLLQKALANQKKWFM
Ga0247793_108438113300023066SoilMVQVGEFPGLAQSNRRTIRAPINPMDKSTVASILPKRIVERKATIQPGTFELNPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSIQIADSIVRDYANGLLACNMADQMPGLFYVPGEFTVEKLKKEHTPLLLKAQAQQKKWFLELIRIADILWSRSNGNPLSISED
Ga0247744_100695443300023073SoilMLVGEFPGLNQANRRTIRAPTNPMDKSTVVSILPKHISERKATISPGIFEIPPGSVEMPSLLVVGTSSWWREIDENQPLLEIP
Ga0247744_106528713300023073SoilMSQVGEFPTITNPNRRTIRAAVNPMDKSTIVSILPKRISERKATIQPGFFEIPSGTFDSPSVLVVGPSSWWREVDENQPLLEIPVSSIQIADSVVRDYCNGILACNMADQQPGLFYIHGEWTAKDLKKEHPLLLLEAQIKQKKWFSELIRI
Ga0247754_103570633300023102SoilMVQVGEFPGLAQSNRRTIRAPINPMDKSTVASILPKRIVERKATIQPGTFELNPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSIQIADSIVRDYANGLLACNMADQMPGLFYVPGEFTVEKLKKEHTPLLLKAQAQQKKWFLELIRIADI
Ga0247754_104555623300023102SoilMQVGEFPGMTVSNRRTIRSPVNPLDKSTIVSILPKYIAERKLTIQPGFFEIKPGNYENPSILVVGPSSWWREVDADQPLLEIPVSSIQIADAVVRDYCNGLLACDMADLMPGLFYVPGEFDVVKLKRDHTPLLMKAQATQRKWYAELIRIADIMWSRTNGNPLSISDDARLACKELNITN
Ga0247762_105848423300023169Plant LitterMQVGEFPGLQNNNNRRTIRAPINPMDKSTVVSILPKEIHERKATIQPGFFDISPGSFDHPAILVVGPSSWWREIDENQPLLEIPVSSIQIADSIVQDYLNGLLAANMGDQQPGLFYLPGEFTVEKLKKEHMSLLLNAQVKQKKWFLELIRIADILWSRSNGNPLAISSDARLAC
Ga0247762_112610213300023169Plant LitterMSMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSVQIADAIVRDYCNGLLACNMADQMPGIFYLPGEYTVEKVKKEQPLLLQKA
Ga0247800_106035123300023263SoilMSMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSVQI
Ga0247789_105829823300023266SoilMQVGEFPGMTVSNRRTIRSPVNPLDKSTIVSILPKYIAERKLTIQPGFFEIKPGNYENPSILVVGPSSWWREVDADQPLLEIPVSSIQIADAVV
Ga0247784_116025323300023270Plant LitterMTLVGEFPGMTVSNRRTIRSPVNPLDKSTIVSILPKYIAERKLTIQPGFFEIKPGNYENPSILVVGPSSWWREVDADQPLLE
Ga0247661_108492323300024254SoilMPVGEFPGLQQSHRRTIRAEVNPLDKSTIVSILPKHIMERKVTIQPGVFEILPGTYEKPSILVVGPSSWWREIDENQPLLEIPVFSVQIADSIVRDYCNGLLACNMGDQMPGLFYVP
Ga0209322_1000200413300025146SoilMELTMSLVGNFPGLGALARRVIRAPINPLDRSTVISIYPKDIVEVKHTIQPGIFKIPKGSYKVPSITVIGPSSWWRELDDSQPLLEIPVSSVQVADSIVKDYCNGLLASNMSDSMPGIFFVPGEYDLTGILSKHRTELE
Ga0209002_1075446123300025289SoilMSVGGFPGIQDIRRRTLRAPVNPMDKSTVVSIYPKEICEVKHTIQPGRFKIDAGTYLIPALLVVGPSSWWKEIDDEQPLLEIPNSSIQVADSIVKDYCNGLLACNMSDSMPGIFY
Ga0207697_1017208113300025315Corn, Switchgrass And Miscanthus RhizosphereMQVGEFPGIHQANRRTMRAAVNPLDKSTVVSILPKRILETKITIQPGVFELPAGSAEKPAILVVGSSSWWREVDIDQPLLEIPVSSIQVADSIVKDYCNGLLACNMTDMMPGIFYVPGEITVAKLKTDHAPLLAKAIATQRK
Ga0207681_1015370053300025923Switchgrass RhizosphereMVQVGEFPGLAQSNRRTIRAPINPMDKSTVASILPKRIVERKATIQPGTFELNPGTFENPSVLVIGPSSWWREVDENQPL
Ga0207701_1031051013300025930Corn, Switchgrass And Miscanthus RhizosphereMQVGEFPGMTVSNRRTIRSPVNPLDKSTIVSILPKYIAERKLTIQPGFFEIKPGNYENPSILVVGPSSWWREVDADQPLLEIPVSSIQIADAVVRDYCNGLLACDMADLMPGLFYVPGEFDVVKLKRDHTPLLMKAQATQRKWYAELIRIA
Ga0207704_1116016413300025938Miscanthus RhizosphereMLVGEFPGLNQANRRTIRAPTNPMDKSTVVSILPKLISERKATISPGIFEIPPGSVEMPSLLVVGTSSWWREIDENQPLLEIPVSSIQVADSIVKDYCNGLLACNMGDMMPGLFYLPGEYTVNKLQTDHAAMLHSALAKQKKWFLELIRIADILWSRSNGNPLTNAYV
Ga0207641_1189843913300026088Switchgrass RhizosphereMQVGEFPGIHQANRRTMRAAVNPLDKSTVVSILPKRILETKITIQPGVFELPAGSAEKPAILVVGSSSWWREVDID
Ga0207676_1031251413300026095Switchgrass RhizosphereMQVGEFPGLQQTNRRTIRAPVNPMDKSTIVSILPKVISERKATIQPGFFHIEAGTLESPAVLVVGPSSWWREVDEHQPLLEIPVSSIQIADSIVRDYANGLLACNMAEQMPGLFYVPGEYTVERIKKEHAPLLQQANAKQRNWYKELIRIADILWSRSNGNPLSISEDARIACHELNISNKPWL
Ga0208685_114169713300027513SoilMLVGEFPGLNQTNRRTIRAQVNPLDKSTIVSILPKAINERKATISPGFFNLAPGTFENPA
Ga0208185_104368313300027533SoilMGQVGEFPGLQQSNRRTIRAAINPLDKSTVVSILPKRISERKPTVSPGFFEIAPGTYDNPAVLVVGPSSWWREVDDGQPLLEI
Ga0208185_105474133300027533SoilMQVGEFPGMAQMNRRTIRAPVNPMDKSTVVSILPKRILERKATCQPGIFELSPGSAELPAVLVVGPSSWWREVDENQPL
Ga0208454_104624713300027573SoilMGQVGEFPGMSHMHRRTIRAAVNPLDKSTIVSILPKEIHERKATIQPGFFDIPAGTFENPAVVVVGPSSWWREIDENQPLLEIPVSSIQIADSVVK
Ga0209819_1010172733300027722Freshwater SedimentMSVVGEFPGIQATTRRTIRAQVNPMDKSTIVSILPKQISERKATISPGFFELAPGTFDSPSILVVGTSS
Ga0209481_1017670813300027880Populus RhizosphereMAGVDDLVEVNVGSFPGMAGSNRRTIRSPVNPLDKSTVVSILPKQISERKATIFPGVFEIPPGSFEHPSILVVGTSSWWRDIDEGQPLLEITVGSVQVADSIVRDYSNGLLACNMDDMKPGLFYIPGEFSLEGIKKQHMPSLLKAQAAQKKWF
Ga0209481_1022927313300027880Populus RhizosphereMQVGEFPGLTTRNRRTIRAAVNPLDKSTVVSILPKSISERKATIQPGMFELNPGTYENPSILVLGPSSWWREIDENQPLLEIPVSSIQVADSIVRDYCNGLLACNMADQMPGLFYLPGEFTVEKLKKEHLALLNKAR
Ga0207428_1012271653300027907Populus RhizosphereMQVGEFPGLQHANNRRTIRAPINPMDKSTVVSILPKEIHERKPTIQPGFFDLGPGSFDSPSILVVGPSSWWREIDENQPLLEIPVSSIQIAD
Ga0209820_105752513300027956Freshwater SedimentMQVGEFPGIQHNNNRRTIRAPSNPMDKSTVVSILPKEIHERKATIQPGFFDIGPGSFDSPSVLVVGPSSWWREIDENQPLLEIPVSSIQIADSIVKDYLNGL
Ga0247749_100009863300027993SoilMSMVGEFPGMQQTNRRTIRAPINPMDRSTVVSILPKRIIERKATLQPSTFELSPGTFENPSVLVIGPSSWWREVDENQPLLEIPVSSVQIADAIVRD
Ga0307503_1080286623300028802SoilMIQVGEFPGFVPQNRRTIRAAVNPMDKSTVISILPKQISERKATIQPGLFNIAPGTFENPAILVLGPSSWWREVDENQPLLEIPVSSIQVADSIVRDYSNGLLACNMSDQMPGLFYIPGE
Ga0299906_1130360623300030606SoilMSLGVGGFARARHTIRSTPNPIDKCTVVSILPKLIEERKPTIEPGYFRIEPGTYENPAILVVGMSSWWRDIDPEQPLLEIPVSSIQIADSVVKDYCNGIVGCNMGDSMPGLFYVPGEHNVASVKTS
Ga0307499_1032285023300031184SoilMQVGEFPGLQQTNRRTIRAAVNPMDKSTVVSILPKAIHERKATIQPGFFDLAPGSFDNPSILVVGPSSWWREIDENQPLLEIPVSSIQIADSIVRDYSNGLLACNMADQMPGLFYVPGEFDL
Ga0310887_1099269913300031547SoilMALVGEFPGLNQMHRRTIRAPVNPMDKSTIVSILPKFISERKATIQPGTFEIQPGSFEQPSILVVGPSSWWREVDENQPLLEIPVSSIQIADSVVRDYCNGLLACNM
Ga0214473_1118323613300031949SoilMVVGAFPGMQSSLRRTVRAPINPIDKSTVVSIFPKEINETKPTITPGRFRVEAGTYENPSLLVIGPSSWWKETDEAEPLLEIPCGSHQVADSIVKDYCNGL
Ga0315284_1080939013300032053SedimentMSIVGEFPGKNSIGRRTIRGPVNPMDKTTIVSIYPSEIIETKPTISPGRFIIPAGSYDNPAILIVGPSSWWREIDEEQPLLEIPVSSIQIADSIIKDYCNGILGCN
Ga0310896_1030520323300032211SoilMALVGEFPGLNQMHRRTIRAPVNPMDKSTIVSILPKFISERKATIQPGTFEITPGSFEKPALLVVGPSSWWREIDENQLLLEIPVSSIQVADSVVKDYCNGLLACNMSDMMPGL
Ga0364925_0191737_3_3803300034147SedimentMSGQVGEFPGMSITHRRLIRAPVNPLDKSTVVSILPKKISERKFTIQPGVFEIEPGTPDKPAILVVGSSSWWREVDESQPMLEIPVSSIQVADSIVRDYCVGLLACNMEDMKPGLFYIPGEWNVER


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.