NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048851

Metagenome / Metatranscriptome Family F048851

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048851
Family Type Metagenome / Metatranscriptome
Number of Sequences 147
Average Sequence Length 44 residues
Representative Sequence MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFNG
Number of Associated Samples 115
Number of Associated Scaffolds 147

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 97.93 %
% of genes near scaffold ends (potentially truncated) 97.96 %
% of genes from short scaffolds (< 2000 bps) 90.48 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (80.952 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(33.333 % of family members)
Environment Ontology (ENVO) Unclassified
(47.619 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(46.259 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 21.13%    Coil/Unstructured: 78.87%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 147 Family Scaffolds
PF04586Peptidase_S78 8.16
PF04860Phage_portal 2.04
PF03354TerL_ATPase 1.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 147 Family Scaffolds
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 8.16
COG4626Phage terminase-like protein, large subunit, contains N-terminal HTH domainMobilome: prophages, transposons [X] 1.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms81.63 %
UnclassifiedrootN/A18.37 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001963|GOS2229_1002147All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1921Open in IMG/M
3300002161|JGI24766J26685_10118685Not Available559Open in IMG/M
3300002408|B570J29032_109747463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1196Open in IMG/M
3300005585|Ga0049084_10284284All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes551Open in IMG/M
3300006030|Ga0075470_10018210All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2174Open in IMG/M
3300006802|Ga0070749_10103905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae1678Open in IMG/M
3300006802|Ga0070749_10165389All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1280Open in IMG/M
3300006802|Ga0070749_10181319All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1212Open in IMG/M
3300006805|Ga0075464_10188592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1222Open in IMG/M
3300006805|Ga0075464_10343969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage902Open in IMG/M
3300006805|Ga0075464_10614660Not Available669Open in IMG/M
3300006805|Ga0075464_10890026All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M
3300006875|Ga0075473_10142604All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes960Open in IMG/M
3300006917|Ga0075472_10435264All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes650Open in IMG/M
3300007540|Ga0099847_1129682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes757Open in IMG/M
3300007541|Ga0099848_1288175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes566Open in IMG/M
3300007542|Ga0099846_1046057All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1661Open in IMG/M
3300007542|Ga0099846_1108288All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1020Open in IMG/M
3300007542|Ga0099846_1171834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300007559|Ga0102828_1203103Not Available509Open in IMG/M
3300007960|Ga0099850_1089118All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1282Open in IMG/M
3300007973|Ga0105746_1190302Not Available699Open in IMG/M
3300008450|Ga0114880_1132144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage923Open in IMG/M
3300009165|Ga0105102_10228134All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage941Open in IMG/M
3300009185|Ga0114971_10626893All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes593Open in IMG/M
3300009469|Ga0127401_1067792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage980Open in IMG/M
3300009469|Ga0127401_1168711All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300010297|Ga0129345_1031078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2076Open in IMG/M
3300010354|Ga0129333_10517737All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1044Open in IMG/M
3300010354|Ga0129333_11416062Not Available571Open in IMG/M
3300010370|Ga0129336_10364222All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage794Open in IMG/M
3300010370|Ga0129336_10489819All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage663Open in IMG/M
3300012017|Ga0153801_1058196All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes679Open in IMG/M
3300012706|Ga0157627_1106024Not Available1134Open in IMG/M
3300012706|Ga0157627_1112738All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1100Open in IMG/M
3300012707|Ga0157623_1173455Not Available529Open in IMG/M
3300012709|Ga0157608_1102283All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage666Open in IMG/M
3300012709|Ga0157608_1113463All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes518Open in IMG/M
3300012712|Ga0157598_1121374All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1218Open in IMG/M
3300012716|Ga0157605_1254034Not Available662Open in IMG/M
3300012717|Ga0157609_1112528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1311Open in IMG/M
3300012720|Ga0157613_1242951All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1263Open in IMG/M
3300012722|Ga0157630_1165266All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1221Open in IMG/M
3300012723|Ga0157604_1099979All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1273Open in IMG/M
3300012724|Ga0157611_1079635All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1217Open in IMG/M
3300012725|Ga0157610_1068440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1117Open in IMG/M
3300012725|Ga0157610_1157276All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1216Open in IMG/M
3300012726|Ga0157597_1187493Not Available567Open in IMG/M
3300012729|Ga0157625_1273541All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1136Open in IMG/M
3300012733|Ga0157606_1201084Not Available573Open in IMG/M
3300012733|Ga0157606_1301498Not Available602Open in IMG/M
3300012734|Ga0157615_1006303All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes660Open in IMG/M
3300012752|Ga0157629_1011047Not Available1029Open in IMG/M
3300012759|Ga0157626_1140330All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1803Open in IMG/M
3300012764|Ga0157624_1079440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1241Open in IMG/M
3300013010|Ga0129327_10807952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300013074|Ga0157618_1112080Not Available727Open in IMG/M
3300013092|Ga0163199_1109316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1155Open in IMG/M
3300013372|Ga0177922_10098372All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage531Open in IMG/M
3300013372|Ga0177922_10438950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes974Open in IMG/M
3300016699|Ga0180058_1208432Not Available1408Open in IMG/M
3300016699|Ga0180058_1227751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage707Open in IMG/M
3300017701|Ga0181364_1024236All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes993Open in IMG/M
3300017701|Ga0181364_1063175Not Available571Open in IMG/M
3300017736|Ga0181365_1068284Not Available878Open in IMG/M
3300017747|Ga0181352_1105459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage770Open in IMG/M
3300017754|Ga0181344_1067141Not Available1060Open in IMG/M
3300020172|Ga0211729_10308704All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage885Open in IMG/M
3300020549|Ga0207942_1003013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2689Open in IMG/M
3300020560|Ga0208852_1050064All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes697Open in IMG/M
3300022063|Ga0212029_1026924All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes795Open in IMG/M
3300022176|Ga0212031_1050499All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage698Open in IMG/M
3300022176|Ga0212031_1067262All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes608Open in IMG/M
3300022179|Ga0181353_1116460Not Available643Open in IMG/M
3300022190|Ga0181354_1210896All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage573Open in IMG/M
3300022198|Ga0196905_1058586All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1080Open in IMG/M
3300024239|Ga0247724_1002278All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3361Open in IMG/M
3300024262|Ga0210003_1093846All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1380Open in IMG/M
3300024262|Ga0210003_1342574All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage559Open in IMG/M
3300024533|Ga0256299_1022482All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1206Open in IMG/M
3300024537|Ga0255225_1047986All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes720Open in IMG/M
3300024552|Ga0256345_1083631Not Available612Open in IMG/M
3300024557|Ga0255283_1086012Not Available677Open in IMG/M
3300024558|Ga0255232_1035421All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1021Open in IMG/M
3300024853|Ga0255252_1093646All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes570Open in IMG/M
3300024862|Ga0256317_1029321All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1193Open in IMG/M
3300024863|Ga0255246_1030406All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1240Open in IMG/M
3300025075|Ga0209615_107381Not Available614Open in IMG/M
3300025075|Ga0209615_109964Not Available525Open in IMG/M
3300025543|Ga0208303_1040950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1174Open in IMG/M
3300025630|Ga0208004_1088585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage753Open in IMG/M
3300025646|Ga0208161_1152961All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes573Open in IMG/M
3300025647|Ga0208160_1166470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage523Open in IMG/M
3300025655|Ga0208795_1052585All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1200Open in IMG/M
3300025687|Ga0208019_1094078All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes932Open in IMG/M
3300025687|Ga0208019_1127068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes746Open in IMG/M
3300025687|Ga0208019_1131848All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage726Open in IMG/M
3300025687|Ga0208019_1156331All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage638Open in IMG/M
3300025732|Ga0208784_1070117All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1063Open in IMG/M
3300025746|Ga0255241_1047409All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes607Open in IMG/M
3300025761|Ga0256310_1034771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes788Open in IMG/M
3300025761|Ga0256310_1074553All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes513Open in IMG/M
3300025889|Ga0208644_1236726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300026415|Ga0256298_1044207All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes606Open in IMG/M
3300027365|Ga0209300_1050528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes705Open in IMG/M
3300027380|Ga0208432_1052626All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage675Open in IMG/M
3300027518|Ga0208787_1061589All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1007Open in IMG/M
3300027679|Ga0209769_1080007All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1072Open in IMG/M
3300027721|Ga0209492_1205377All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage676Open in IMG/M
3300027736|Ga0209190_1015493All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4391Open in IMG/M
3300027764|Ga0209134_10284589All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes563Open in IMG/M
3300027769|Ga0209770_10047970All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1819Open in IMG/M
3300027900|Ga0209253_10444774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes977Open in IMG/M
3300027956|Ga0209820_1002725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4289Open in IMG/M
3300028266|Ga0255227_1067251All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes557Open in IMG/M
3300029699|Ga0255233_1076176All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes664Open in IMG/M
3300031578|Ga0307376_10429144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage865Open in IMG/M
3300031578|Ga0307376_10435921All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300032050|Ga0315906_10637932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage869Open in IMG/M
3300033816|Ga0334980_0039534All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2008Open in IMG/M
3300033981|Ga0334982_0508109All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage532Open in IMG/M
3300033992|Ga0334992_0405393All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes611Open in IMG/M
3300034012|Ga0334986_0209466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1084Open in IMG/M
3300034020|Ga0335002_0263440All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1028Open in IMG/M
3300034020|Ga0335002_0286528All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage969Open in IMG/M
3300034020|Ga0335002_0398984All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage765Open in IMG/M
3300034061|Ga0334987_0700008Not Available581Open in IMG/M
3300034062|Ga0334995_0033047All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4418Open in IMG/M
3300034066|Ga0335019_0050817All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2839Open in IMG/M
3300034072|Ga0310127_294467All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage557Open in IMG/M
3300034072|Ga0310127_333227Not Available509Open in IMG/M
3300034073|Ga0310130_0094688All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage895Open in IMG/M
3300034093|Ga0335012_0149750All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1270Open in IMG/M
3300034093|Ga0335012_0161344All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1213Open in IMG/M
3300034101|Ga0335027_0071757All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2722Open in IMG/M
3300034101|Ga0335027_0662338All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes626Open in IMG/M
3300034104|Ga0335031_0757746All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300034117|Ga0335033_0338967Not Available759Open in IMG/M
3300034118|Ga0335053_0217844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1244Open in IMG/M
3300034118|Ga0335053_0521354All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes697Open in IMG/M
3300034118|Ga0335053_0684392All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage579Open in IMG/M
3300034121|Ga0335058_0417983All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage767Open in IMG/M
3300034272|Ga0335049_0026379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage4356Open in IMG/M
3300034279|Ga0335052_0018498All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4350Open in IMG/M
3300034280|Ga0334997_0826672All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage556Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater33.33%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous21.09%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater9.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake7.48%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient4.08%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater3.40%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.04%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface2.04%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water2.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater1.36%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater1.36%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.36%
Meromictic PondEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond1.36%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.36%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.68%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.68%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.68%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.68%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.68%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.68%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.68%
Deep Subsurface SedimentEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001963Marine microbial communities from Nags Head, North Carolina, USA - GS013EnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300007559Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300008450Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigsEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009469Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UDEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010370Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNAEnvironmentalOpen in IMG/M
3300012017Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012706Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012707Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012709Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012712Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012717Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012722Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012723Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012724Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012725Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012726Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012733Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012734Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012752Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012759Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012764Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300013074Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300016699Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017747Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.NEnvironmentalOpen in IMG/M
3300017754Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020159Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1EnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020560Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022176Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022179Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.NEnvironmentalOpen in IMG/M
3300022190Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.NEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300024239Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-EEnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024533Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024537Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024552Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024557Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024558Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024853Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024862Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024863Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025075Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025646Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025746Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025761Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026415Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027365Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes)EnvironmentalOpen in IMG/M
3300027380Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027518Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027721Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027736Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027764Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028266Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029699Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034020Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034072Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-AEnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034093Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034117Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124EnvironmentalOpen in IMG/M
3300034118Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165EnvironmentalOpen in IMG/M
3300034121Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174EnvironmentalOpen in IMG/M
3300034272Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156EnvironmentalOpen in IMG/M
3300034279Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163EnvironmentalOpen in IMG/M
3300034280Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GOS2229_100214743300001963MarineMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTYTVRALPQYC
JGI24766J26685_1011868523300002161Freshwater And SedimentMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTFTVR
B570J29032_10974746323300002408FreshwaterMAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGV
Ga0049084_1028428413300005585Freshwater LenticMAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAGVDAT
Ga0075470_1001821033300006030AqueousMATYSVTHKYLLDNYAVLQLLTPSEIAVGESITVASV
Ga0070749_1010390513300006802AqueousMATYTVTNKYLIDNFAVVQLLTAAELELSQSITVAGVGSPFDGSFTVRALPQYRFTG
Ga0070749_1016538923300006802AqueousMANYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATF
Ga0070749_1018131913300006802AqueousMATYTVTHKYLLDDYAVVQLLTPAELDVGQSMTIGGVDATFN
Ga0075464_1018859223300006805AqueousMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYTV
Ga0075464_1034396913300006805AqueousMAVYSVTQKYLLDNYAVLQSLTPTEIAVGQSITVAS
Ga0075464_1061466023300006805AqueousMAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDATF
Ga0075464_1089002613300006805AqueousMATYTVTNKYLIDDYALVQLLTPAELELGQSITVSGVD
Ga0075473_1014260413300006875AqueousMATYSVTHKYLLDNYAVLQLLTPSEIAVGESITVASVD
Ga0075472_1043526413300006917AqueousMATYTVTNKYLVDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYTV
Ga0099847_112968223300007540AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTYTVRALPQYLYLGVDTQGDLLY
Ga0099848_128817513300007541AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTYTV
Ga0099846_104605723300007542AqueousMATYTVTNKYLIDNFAVVQLLTAAELELSQSITVAGVGSPFDGSFTVRALPQYRFTGVD
Ga0099846_110828823300007542AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTF
Ga0099846_117183423300007542AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGTYLVRALP
Ga0102828_120310313300007559EstuarineMATYTVVEKYLSANFAILQLLTPSEIQIGQSIVVAGVNATFNGTYTVRALPEFLFVGVDTDGD
Ga0099850_108911813300007960AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGTYLVRALPQ
Ga0105746_119030213300007973Estuary WaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFNGTYT
Ga0114880_113214413300008450Freshwater LakeMATYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTNVDATFNGSYTV
Ga0105102_1022813413300009165Freshwater SedimentMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGV
Ga0114971_1062689313300009185Freshwater LakeMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVASVDATFNG
Ga0127401_106779223300009469Meromictic PondMATYTVTHKYLLNDYAVLQLLTPSEIAVGESIVVAGVDATFNGTYS
Ga0127401_116871123300009469Meromictic PondMATYTVTHKYLIDDYAVLQLLTPSEIAVGESIVVAGVDATFNGTYS
Ga0129345_103107813300010297Freshwater To Marine Saline GradientMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTYTVR
Ga0129333_1051773713300010354Freshwater To Marine Saline GradientMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFN
Ga0129333_1141606223300010354Freshwater To Marine Saline GradientVAVYQITHKYLLDDYAVVQLLTPGELDVGQSMTIAGVDATF
Ga0129336_1036422213300010370Freshwater To Marine Saline GradientMATYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATFNGSYTVYA
Ga0129336_1048981923300010370Freshwater To Marine Saline GradientMATYTVTHKYLLDDYAVVQLLTPAELDVGGSITIAGVDATFNGTYTIRALP
Ga0153801_105819613300012017FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTY
Ga0157627_110602413300012706FreshwaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGESITVASVDATFN
Ga0157627_111273833300012706FreshwaterMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVA
Ga0157623_117345523300012707FreshwaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFNG
Ga0157608_110228313300012709FreshwaterMAAYTVTHKQLIDDYAVLQLLTPAELEVGQSITVTGVDATFNGTYVVY
Ga0157608_111346323300012709FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFN
Ga0157598_112137413300012712FreshwaterMATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDATFNGTYTV
Ga0157605_125403423300012716FreshwaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVE
Ga0157609_111252823300012717FreshwaterMATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDATFN
Ga0157613_124295123300012720FreshwaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVA
Ga0157630_116526623300012722FreshwaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFN
Ga0157604_109997913300012723FreshwaterMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTYSVRALPQYLFIG
Ga0157611_107963523300012724FreshwaterMATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDATFNG
Ga0157610_106844013300012725FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFNGSYSVRALP
Ga0157610_115727623300012725FreshwaterMATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDA
Ga0157597_118749313300012726FreshwaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVD
Ga0157625_127354123300012729FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFNGSYSVRAL
Ga0157606_120108413300012733FreshwaterMAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDATFND
Ga0157606_130149813300012733FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDAT
Ga0157615_100630313300012734FreshwaterMAVYSVTQKYLIDDYAVLQLLTPSEIAVGQSITVASVDATFN
Ga0157629_101104723300012752FreshwaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGSSIVGVDGGVLLA*
Ga0157626_114033023300012759FreshwaterMATYTVTNKYLIVDFAVLQLLTPSEIAVGQSITVAGVDA
Ga0157624_107944023300012764FreshwaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFNGTY
Ga0129327_1080795223300013010Freshwater To Marine Saline GradientMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDAAIFDGTFVVRA
Ga0157618_111208023300013074FreshwaterMAVYSVTQKYLIDDYAVLQLLTPSEIAVGQSITVASVDATFNGTYTVRAL
Ga0163199_110931613300013092FreshwaterMTTYTVVEKYLSANFAVLQLLTPSEIQIGQSIVVAGVDATFNGTYTVRALPEFE
Ga0177922_1009837223300013372FreshwaterMATYSVTNKYLVDNYAVVELLTQADLELGVSVTVAGVDATFNGTYTVRALPQY
Ga0177922_1043895013300013372FreshwaterMAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGVD
Ga0180058_120843223300016699FreshwaterMAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDATFNGTFTVRALP
Ga0180058_122775123300016699FreshwaterMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFN
Ga0181364_102423623300017701Freshwater LakeMAVYSITQKYLIDNYAVVQLLTDAEIELGASVVIAGVDA
Ga0181364_106317513300017701Freshwater LakeMAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAGV
Ga0181365_106828413300017736Freshwater LakeMAVYSVTQKYLLDDYAVLQLLTPSEISVGQSITVAFL
Ga0181352_110545923300017747Freshwater LakeMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQYLF
Ga0181344_106714113300017754Freshwater LakeMAVYSVTQKYLLDNYAVLQSLTPTEIAVGQSITVASVDATFNGTYTV
Ga0181346_132376723300017780Freshwater LakeMATYTVTHKQLLDNYAVLQLLTPTEIEVGQSITVAAVGVPFNGT
Ga0211734_1082714823300020159FreshwaterMATYTVTHKQLLDNYAVLQLLTPTEIEVGQSITVAAVGAPFNGTFTVYDCPE
Ga0211729_1030870423300020172FreshwaterMAVYSVTNKYLIDDFAVLQLLTPTEIAVGESITVAGVDATFNGTYTV
Ga0207942_100301313300020549FreshwaterMAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGVDATFNG
Ga0208852_105006423300020560FreshwaterMATYSVTFKSLLDNYAVLQLLTPSEIAVGESITVTSVDATFN
Ga0212029_102692423300022063AqueousMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFNGS
Ga0212031_105049913300022176AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAG
Ga0212031_106726223300022176AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTYTVRALP
Ga0181353_111646023300022179Freshwater LakeMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNG
Ga0181354_121089613300022190Freshwater LakeMATYTVTHKYLLDDYAVLQLLTPTELVVGGAITVAGVDATFNGSYTVYA
Ga0196905_105858613300022198AqueousMATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVADVDATFNGTYTVRALPQYLY
Ga0247724_100227813300024239Deep Subsurface SedimentMANYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATFN
Ga0210003_109384623300024262Deep SubsurfaceMATYSVTFKYLLDDYAVLQLLTPTEIAVGESITVAGVDATFN
Ga0210003_134257423300024262Deep SubsurfaceMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDAAIFDGTFVVR
Ga0256299_102248213300024533FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTY
Ga0255225_104798613300024537FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVD
Ga0256345_108363123300024552FreshwaterMATYTVTHKYLVDNYAVLQLLTPSDVVVGGAITVTSVDATFNGSYTVY
Ga0255283_108601223300024557FreshwaterMATYTVTHKYLVDNYAVLQLLTPSDVVVGGAITVTSVDATFN
Ga0255232_103542123300024558FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVD
Ga0255252_109364613300024853FreshwaterMATYSVTHKYLLNNYAVLQLLTPSEIAVGESITVASVDATFNGSYVVRALPQ
Ga0256317_102932113300024862FreshwaterMATYSVTHKYLLNDYAVLQLLTPSEIAVGESIVVASVDATFN
Ga0255246_103040623300024863FreshwaterMATYSVTHKYLLNDYAVLQLLTPSEIAVGESIVVASVDATFNGTYTV
Ga0209615_10738123300025075FreshwaterMAVYSVTNKYLIDDFAVLQLLTPTELEVGQSITVAGVDATFNGTY
Ga0209615_10996413300025075FreshwaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFNGTYTV
Ga0208303_104095013300025543AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGT
Ga0208004_108858523300025630AqueousMATYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVT
Ga0208161_115296123300025646AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTY
Ga0208160_116647013300025647AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDS
Ga0208795_105258523300025655AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGTYLVRALPQY
Ga0208019_109407813300025687AqueousMATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVADVDA
Ga0208019_112706813300025687AqueousMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAD
Ga0208019_113184813300025687AqueousMATYTVTHKYLLDDYAVLQLLTPSELVVGGAITVAGVDATFNGSYTVYA
Ga0208019_115633123300025687AqueousMATYTVTNKYLLDNYAVVQLLTPAELELGQSITVAGVDATFN
Ga0208784_107011723300025732AqueousMATYSVTHKYLLDNYAVLQLLTPSEIAVGESITVASVDATFN
Ga0255241_104740913300025746FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFN
Ga0256310_103477123300025761FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPA
Ga0256310_107455323300025761FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDA
Ga0208644_123672613300025889AqueousMATYTVTNKYLIDNFAVVQLLTAAELELSQSITVAGVGSPFDGSF
Ga0256298_104420713300026415FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALP
Ga0209300_105052823300027365Deep SubsurfaceMAVYPVTHKQRQDDYAVLTLQVPSEVVVGGSITVASVDA
Ga0208432_105262613300027380Deep SubsurfaceMATYTVTNKYLIDNFAVLQLLTPSEIAVGNSITVAGVDATFNGTY
Ga0208787_106158913300027518Deep SubsurfaceMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYT
Ga0209769_108000723300027679Freshwater LakeMAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAGVD
Ga0209492_120537713300027721Freshwater SedimentMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDAT
Ga0209190_101549313300027736Freshwater LakeMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDAT
Ga0209134_1028458913300027764Freshwater LakeMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQY
Ga0209770_1004797013300027769Freshwater LakeMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQ
Ga0209253_1044477413300027900Freshwater Lake SedimentMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYSV
Ga0209820_100272543300027956Freshwater SedimentMATYTVTNKYLLDNFAVVQLLTAAELELGQSITVAGVDATFNGTFTVRALPQY
Ga0255227_106725113300028266FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGT
Ga0255233_107617623300029699FreshwaterMAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFN
Ga0307376_1042914423300031578SoilMATYTVTHKQLLDNYAVLQLLTPTEIEVGQSITVSEIAAP
Ga0307376_1043592113300031578SoilMATYSVTFKYLLDDYAVLQLLTPTEIAVGESITVAGVDATFNGTYTVRAL
Ga0315906_1063793213300032050FreshwaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFNGTYTV
Ga0334980_0039534_1852_20073300033816FreshwaterMATYTVTEKYLLDNYAVLQLLTPSEIAVGSSIVVSSVDATFNGTYTVRALPQ
Ga0334982_0508109_416_5323300033981FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVAGVDA
Ga0334992_0405393_3_1103300033992FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAG
Ga0334986_0209466_953_10843300034012FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGT
Ga0335002_0263440_918_10283300034020FreshwaterMATYSVTFKYLLDDYAVLQLLTPTEIAVGESITVTGV
Ga0335002_0286528_817_9693300034020FreshwaterMATYSVTNKYLIDDYAVLQLLTPTELEVGQSITVAGVDATFNGTYTIRALP
Ga0335002_0398984_1_1323300034020FreshwaterMATYQVISKQLTSNYAVLQLLTPAELTVGDSIVVAAVDATFNGS
Ga0334987_0700008_1_1203300034061FreshwaterMAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDAT
Ga0334995_0033047_4279_44163300034062FreshwaterMAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGVDATFNGTYT
Ga0335019_0050817_2732_28393300034066FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAG
Ga0310127_294467_407_5563300034072Fracking WaterMATYSVTNKYLVDNYAVVELLTQADLELGVTVTVAGVDATFNGTVTVRAL
Ga0310127_333227_2_1183300034072Fracking WaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDA
Ga0310130_0094688_766_8943300034073Fracking WaterMANYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATFNG
Ga0335012_0149750_1162_12693300034093FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAS
Ga0335012_0161344_1072_12123300034093FreshwaterMATYTVTNKYLIDDFAVLQLLTPTELEVGQSITVAAVDATFNGTYIV
Ga0335027_0071757_1_1383300034101FreshwaterMATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVAGVDATFNGTYT
Ga0335027_0662338_452_6253300034101FreshwaterMATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQYLFMGV
Ga0335031_0757746_3_1163300034104FreshwaterMATYTVTHKYLLDNYAVLQLLTPSEVVVGGAITVTGVD
Ga0335033_0338967_1_1293300034117FreshwaterMAVYSVTNKYLIDDFAVLQLLTPTELEVGQSITVAGVDATFNG
Ga0335053_0217844_2_1063300034118FreshwaterMATYTVTNKYLIDNYAVLQLLTPSEIAVGSSITVA
Ga0335053_0521354_1_1053300034118FreshwaterMATYSVTFKYLLDNYAVLQLLTPSEIAVGESITVA
Ga0335053_0684392_1_1323300034118FreshwaterMATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGT
Ga0335058_0417983_2_1453300034121FreshwaterMAIYTVTNKYLIDNYAVLQLLTPAELEVGQSITVAGVDATFNGTYTVR
Ga0335049_0026379_3_1073300034272FreshwaterMATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVA
Ga0335052_0018498_4243_43503300034279FreshwaterMAVYTVTEKYLLDNYAVVQLLTPAEIELGASVVIAG
Ga0334997_0826672_449_5563300034280FreshwaterMAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.