Basic Information | |
---|---|
Family ID | F048851 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 147 |
Average Sequence Length | 44 residues |
Representative Sequence | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFNG |
Number of Associated Samples | 115 |
Number of Associated Scaffolds | 147 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 97.93 % |
% of genes near scaffold ends (potentially truncated) | 97.96 % |
% of genes from short scaffolds (< 2000 bps) | 90.48 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (80.952 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (33.333 % of family members) |
Environment Ontology (ENVO) | Unclassified (47.619 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.259 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 21.13% Coil/Unstructured: 78.87% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 147 Family Scaffolds |
---|---|---|
PF04586 | Peptidase_S78 | 8.16 |
PF04860 | Phage_portal | 2.04 |
PF03354 | TerL_ATPase | 1.36 |
COG ID | Name | Functional Category | % Frequency in 147 Family Scaffolds |
---|---|---|---|
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 8.16 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 1.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.63 % |
Unclassified | root | N/A | 18.37 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001963|GOS2229_1002147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1921 | Open in IMG/M |
3300002161|JGI24766J26685_10118685 | Not Available | 559 | Open in IMG/M |
3300002408|B570J29032_109747463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
3300005585|Ga0049084_10284284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 551 | Open in IMG/M |
3300006030|Ga0075470_10018210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2174 | Open in IMG/M |
3300006802|Ga0070749_10103905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Propionibacteriaceae | 1678 | Open in IMG/M |
3300006802|Ga0070749_10165389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1280 | Open in IMG/M |
3300006802|Ga0070749_10181319 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1212 | Open in IMG/M |
3300006805|Ga0075464_10188592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1222 | Open in IMG/M |
3300006805|Ga0075464_10343969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 902 | Open in IMG/M |
3300006805|Ga0075464_10614660 | Not Available | 669 | Open in IMG/M |
3300006805|Ga0075464_10890026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300006875|Ga0075473_10142604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 960 | Open in IMG/M |
3300006917|Ga0075472_10435264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 650 | Open in IMG/M |
3300007540|Ga0099847_1129682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 757 | Open in IMG/M |
3300007541|Ga0099848_1288175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 566 | Open in IMG/M |
3300007542|Ga0099846_1046057 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
3300007542|Ga0099846_1108288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1020 | Open in IMG/M |
3300007542|Ga0099846_1171834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 773 | Open in IMG/M |
3300007559|Ga0102828_1203103 | Not Available | 509 | Open in IMG/M |
3300007960|Ga0099850_1089118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300007973|Ga0105746_1190302 | Not Available | 699 | Open in IMG/M |
3300008450|Ga0114880_1132144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 923 | Open in IMG/M |
3300009165|Ga0105102_10228134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 941 | Open in IMG/M |
3300009185|Ga0114971_10626893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 593 | Open in IMG/M |
3300009469|Ga0127401_1067792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
3300009469|Ga0127401_1168711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
3300010297|Ga0129345_1031078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2076 | Open in IMG/M |
3300010354|Ga0129333_10517737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1044 | Open in IMG/M |
3300010354|Ga0129333_11416062 | Not Available | 571 | Open in IMG/M |
3300010370|Ga0129336_10364222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
3300010370|Ga0129336_10489819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
3300012017|Ga0153801_1058196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 679 | Open in IMG/M |
3300012706|Ga0157627_1106024 | Not Available | 1134 | Open in IMG/M |
3300012706|Ga0157627_1112738 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300012707|Ga0157623_1173455 | Not Available | 529 | Open in IMG/M |
3300012709|Ga0157608_1102283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
3300012709|Ga0157608_1113463 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 518 | Open in IMG/M |
3300012712|Ga0157598_1121374 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1218 | Open in IMG/M |
3300012716|Ga0157605_1254034 | Not Available | 662 | Open in IMG/M |
3300012717|Ga0157609_1112528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1311 | Open in IMG/M |
3300012720|Ga0157613_1242951 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1263 | Open in IMG/M |
3300012722|Ga0157630_1165266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1221 | Open in IMG/M |
3300012723|Ga0157604_1099979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1273 | Open in IMG/M |
3300012724|Ga0157611_1079635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1217 | Open in IMG/M |
3300012725|Ga0157610_1068440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1117 | Open in IMG/M |
3300012725|Ga0157610_1157276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1216 | Open in IMG/M |
3300012726|Ga0157597_1187493 | Not Available | 567 | Open in IMG/M |
3300012729|Ga0157625_1273541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1136 | Open in IMG/M |
3300012733|Ga0157606_1201084 | Not Available | 573 | Open in IMG/M |
3300012733|Ga0157606_1301498 | Not Available | 602 | Open in IMG/M |
3300012734|Ga0157615_1006303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
3300012752|Ga0157629_1011047 | Not Available | 1029 | Open in IMG/M |
3300012759|Ga0157626_1140330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1803 | Open in IMG/M |
3300012764|Ga0157624_1079440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
3300013010|Ga0129327_10807952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300013074|Ga0157618_1112080 | Not Available | 727 | Open in IMG/M |
3300013092|Ga0163199_1109316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1155 | Open in IMG/M |
3300013372|Ga0177922_10098372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300013372|Ga0177922_10438950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 974 | Open in IMG/M |
3300016699|Ga0180058_1208432 | Not Available | 1408 | Open in IMG/M |
3300016699|Ga0180058_1227751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300017701|Ga0181364_1024236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 993 | Open in IMG/M |
3300017701|Ga0181364_1063175 | Not Available | 571 | Open in IMG/M |
3300017736|Ga0181365_1068284 | Not Available | 878 | Open in IMG/M |
3300017747|Ga0181352_1105459 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300017754|Ga0181344_1067141 | Not Available | 1060 | Open in IMG/M |
3300020172|Ga0211729_10308704 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 885 | Open in IMG/M |
3300020549|Ga0207942_1003013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2689 | Open in IMG/M |
3300020560|Ga0208852_1050064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 697 | Open in IMG/M |
3300022063|Ga0212029_1026924 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 795 | Open in IMG/M |
3300022176|Ga0212031_1050499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300022176|Ga0212031_1067262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 608 | Open in IMG/M |
3300022179|Ga0181353_1116460 | Not Available | 643 | Open in IMG/M |
3300022190|Ga0181354_1210896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300022198|Ga0196905_1058586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1080 | Open in IMG/M |
3300024239|Ga0247724_1002278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3361 | Open in IMG/M |
3300024262|Ga0210003_1093846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1380 | Open in IMG/M |
3300024262|Ga0210003_1342574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300024533|Ga0256299_1022482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1206 | Open in IMG/M |
3300024537|Ga0255225_1047986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 720 | Open in IMG/M |
3300024552|Ga0256345_1083631 | Not Available | 612 | Open in IMG/M |
3300024557|Ga0255283_1086012 | Not Available | 677 | Open in IMG/M |
3300024558|Ga0255232_1035421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1021 | Open in IMG/M |
3300024853|Ga0255252_1093646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
3300024862|Ga0256317_1029321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1193 | Open in IMG/M |
3300024863|Ga0255246_1030406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1240 | Open in IMG/M |
3300025075|Ga0209615_107381 | Not Available | 614 | Open in IMG/M |
3300025075|Ga0209615_109964 | Not Available | 525 | Open in IMG/M |
3300025543|Ga0208303_1040950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1174 | Open in IMG/M |
3300025630|Ga0208004_1088585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
3300025646|Ga0208161_1152961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
3300025647|Ga0208160_1166470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300025655|Ga0208795_1052585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1200 | Open in IMG/M |
3300025687|Ga0208019_1094078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 932 | Open in IMG/M |
3300025687|Ga0208019_1127068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 746 | Open in IMG/M |
3300025687|Ga0208019_1131848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
3300025687|Ga0208019_1156331 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300025732|Ga0208784_1070117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1063 | Open in IMG/M |
3300025746|Ga0255241_1047409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 607 | Open in IMG/M |
3300025761|Ga0256310_1034771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 788 | Open in IMG/M |
3300025761|Ga0256310_1074553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 513 | Open in IMG/M |
3300025889|Ga0208644_1236726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300026415|Ga0256298_1044207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 606 | Open in IMG/M |
3300027365|Ga0209300_1050528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 705 | Open in IMG/M |
3300027380|Ga0208432_1052626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
3300027518|Ga0208787_1061589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1007 | Open in IMG/M |
3300027679|Ga0209769_1080007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1072 | Open in IMG/M |
3300027721|Ga0209492_1205377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 676 | Open in IMG/M |
3300027736|Ga0209190_1015493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4391 | Open in IMG/M |
3300027764|Ga0209134_10284589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 563 | Open in IMG/M |
3300027769|Ga0209770_10047970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1819 | Open in IMG/M |
3300027900|Ga0209253_10444774 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 977 | Open in IMG/M |
3300027956|Ga0209820_1002725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4289 | Open in IMG/M |
3300028266|Ga0255227_1067251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 557 | Open in IMG/M |
3300029699|Ga0255233_1076176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 664 | Open in IMG/M |
3300031578|Ga0307376_10429144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300031578|Ga0307376_10435921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 856 | Open in IMG/M |
3300032050|Ga0315906_10637932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 869 | Open in IMG/M |
3300033816|Ga0334980_0039534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2008 | Open in IMG/M |
3300033981|Ga0334982_0508109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300033992|Ga0334992_0405393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 611 | Open in IMG/M |
3300034012|Ga0334986_0209466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1084 | Open in IMG/M |
3300034020|Ga0335002_0263440 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
3300034020|Ga0335002_0286528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300034020|Ga0335002_0398984 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300034061|Ga0334987_0700008 | Not Available | 581 | Open in IMG/M |
3300034062|Ga0334995_0033047 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4418 | Open in IMG/M |
3300034066|Ga0335019_0050817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2839 | Open in IMG/M |
3300034072|Ga0310127_294467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034072|Ga0310127_333227 | Not Available | 509 | Open in IMG/M |
3300034073|Ga0310130_0094688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 895 | Open in IMG/M |
3300034093|Ga0335012_0149750 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1270 | Open in IMG/M |
3300034093|Ga0335012_0161344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1213 | Open in IMG/M |
3300034101|Ga0335027_0071757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2722 | Open in IMG/M |
3300034101|Ga0335027_0662338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 626 | Open in IMG/M |
3300034104|Ga0335031_0757746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
3300034117|Ga0335033_0338967 | Not Available | 759 | Open in IMG/M |
3300034118|Ga0335053_0217844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1244 | Open in IMG/M |
3300034118|Ga0335053_0521354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 697 | Open in IMG/M |
3300034118|Ga0335053_0684392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 579 | Open in IMG/M |
3300034121|Ga0335058_0417983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 767 | Open in IMG/M |
3300034272|Ga0335049_0026379 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4356 | Open in IMG/M |
3300034279|Ga0335052_0018498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4350 | Open in IMG/M |
3300034280|Ga0334997_0826672 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 33.33% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 21.09% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 9.52% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 7.48% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.08% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.40% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.04% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.04% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 2.04% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.36% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.36% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.36% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 1.36% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 1.36% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.68% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.68% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.68% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.68% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.68% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.68% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.68% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.68% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.68% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009469 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 6m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012707 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES154 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012709 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES134 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012712 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES121 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012716 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012726 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES115 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012734 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES144 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012752 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES162 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013092 | Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150m | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300022063 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024533 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024537 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024552 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024557 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024558 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024862 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025746 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025761 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026415 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027380 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300028266 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GOS2229_10021474 | 3300001963 | Marine | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTYTVRALPQYC |
JGI24766J26685_101186852 | 3300002161 | Freshwater And Sediment | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTFTVR |
B570J29032_1097474632 | 3300002408 | Freshwater | MAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGV |
Ga0049084_102842841 | 3300005585 | Freshwater Lentic | MAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAGVDAT |
Ga0075470_100182103 | 3300006030 | Aqueous | MATYSVTHKYLLDNYAVLQLLTPSEIAVGESITVASV |
Ga0070749_101039051 | 3300006802 | Aqueous | MATYTVTNKYLIDNFAVVQLLTAAELELSQSITVAGVGSPFDGSFTVRALPQYRFTG |
Ga0070749_101653892 | 3300006802 | Aqueous | MANYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATF |
Ga0070749_101813191 | 3300006802 | Aqueous | MATYTVTHKYLLDDYAVVQLLTPAELDVGQSMTIGGVDATFN |
Ga0075464_101885922 | 3300006805 | Aqueous | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYTV |
Ga0075464_103439691 | 3300006805 | Aqueous | MAVYSVTQKYLLDNYAVLQSLTPTEIAVGQSITVAS |
Ga0075464_106146602 | 3300006805 | Aqueous | MAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDATF |
Ga0075464_108900261 | 3300006805 | Aqueous | MATYTVTNKYLIDDYALVQLLTPAELELGQSITVSGVD |
Ga0075473_101426041 | 3300006875 | Aqueous | MATYSVTHKYLLDNYAVLQLLTPSEIAVGESITVASVD |
Ga0075472_104352641 | 3300006917 | Aqueous | MATYTVTNKYLVDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYTV |
Ga0099847_11296822 | 3300007540 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTYTVRALPQYLYLGVDTQGDLLY |
Ga0099848_12881751 | 3300007541 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTYTV |
Ga0099846_10460572 | 3300007542 | Aqueous | MATYTVTNKYLIDNFAVVQLLTAAELELSQSITVAGVGSPFDGSFTVRALPQYRFTGVD |
Ga0099846_11082882 | 3300007542 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTF |
Ga0099846_11718342 | 3300007542 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGTYLVRALP |
Ga0102828_12031031 | 3300007559 | Estuarine | MATYTVVEKYLSANFAILQLLTPSEIQIGQSIVVAGVNATFNGTYTVRALPEFLFVGVDTDGD |
Ga0099850_10891181 | 3300007960 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGTYLVRALPQ |
Ga0105746_11903021 | 3300007973 | Estuary Water | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFNGTYT |
Ga0114880_11321441 | 3300008450 | Freshwater Lake | MATYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTNVDATFNGSYTV |
Ga0105102_102281341 | 3300009165 | Freshwater Sediment | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGV |
Ga0114971_106268931 | 3300009185 | Freshwater Lake | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVASVDATFNG |
Ga0127401_10677922 | 3300009469 | Meromictic Pond | MATYTVTHKYLLNDYAVLQLLTPSEIAVGESIVVAGVDATFNGTYS |
Ga0127401_11687112 | 3300009469 | Meromictic Pond | MATYTVTHKYLIDDYAVLQLLTPSEIAVGESIVVAGVDATFNGTYS |
Ga0129345_10310781 | 3300010297 | Freshwater To Marine Saline Gradient | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTYTVR |
Ga0129333_105177371 | 3300010354 | Freshwater To Marine Saline Gradient | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFN |
Ga0129333_114160622 | 3300010354 | Freshwater To Marine Saline Gradient | VAVYQITHKYLLDDYAVVQLLTPGELDVGQSMTIAGVDATF |
Ga0129336_103642221 | 3300010370 | Freshwater To Marine Saline Gradient | MATYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATFNGSYTVYA |
Ga0129336_104898192 | 3300010370 | Freshwater To Marine Saline Gradient | MATYTVTHKYLLDDYAVVQLLTPAELDVGGSITIAGVDATFNGTYTIRALP |
Ga0153801_10581961 | 3300012017 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTY |
Ga0157627_11060241 | 3300012706 | Freshwater | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGESITVASVDATFN |
Ga0157627_11127383 | 3300012706 | Freshwater | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVA |
Ga0157623_11734552 | 3300012707 | Freshwater | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFNG |
Ga0157608_11022831 | 3300012709 | Freshwater | MAAYTVTHKQLIDDYAVLQLLTPAELEVGQSITVTGVDATFNGTYVVY |
Ga0157608_11134632 | 3300012709 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFN |
Ga0157598_11213741 | 3300012712 | Freshwater | MATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDATFNGTYTV |
Ga0157605_12540342 | 3300012716 | Freshwater | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVE |
Ga0157609_11125282 | 3300012717 | Freshwater | MATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDATFN |
Ga0157613_12429512 | 3300012720 | Freshwater | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVA |
Ga0157630_11652662 | 3300012722 | Freshwater | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFN |
Ga0157604_10999791 | 3300012723 | Freshwater | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGTYSVRALPQYLFIG |
Ga0157611_10796352 | 3300012724 | Freshwater | MATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDATFNG |
Ga0157610_10684401 | 3300012725 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFNGSYSVRALP |
Ga0157610_11572762 | 3300012725 | Freshwater | MATYSVTFKSLLDNYAVLQLLTPSEIAVGESIVVTSVDA |
Ga0157597_11874931 | 3300012726 | Freshwater | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVD |
Ga0157625_12735412 | 3300012729 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFNGSYSVRAL |
Ga0157606_12010841 | 3300012733 | Freshwater | MAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDATFND |
Ga0157606_13014981 | 3300012733 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDAT |
Ga0157615_10063031 | 3300012734 | Freshwater | MAVYSVTQKYLIDDYAVLQLLTPSEIAVGQSITVASVDATFN |
Ga0157629_10110472 | 3300012752 | Freshwater | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGSSIVGVDGGVLLA* |
Ga0157626_11403302 | 3300012759 | Freshwater | MATYTVTNKYLIVDFAVLQLLTPSEIAVGQSITVAGVDA |
Ga0157624_10794402 | 3300012764 | Freshwater | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFNGTY |
Ga0129327_108079522 | 3300013010 | Freshwater To Marine Saline Gradient | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDAAIFDGTFVVRA |
Ga0157618_11120802 | 3300013074 | Freshwater | MAVYSVTQKYLIDDYAVLQLLTPSEIAVGQSITVASVDATFNGTYTVRAL |
Ga0163199_11093161 | 3300013092 | Freshwater | MTTYTVVEKYLSANFAVLQLLTPSEIQIGQSIVVAGVDATFNGTYTVRALPEFE |
Ga0177922_100983722 | 3300013372 | Freshwater | MATYSVTNKYLVDNYAVVELLTQADLELGVSVTVAGVDATFNGTYTVRALPQY |
Ga0177922_104389501 | 3300013372 | Freshwater | MAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGVD |
Ga0180058_12084322 | 3300016699 | Freshwater | MAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDATFNGTFTVRALP |
Ga0180058_12277512 | 3300016699 | Freshwater | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFN |
Ga0181364_10242362 | 3300017701 | Freshwater Lake | MAVYSITQKYLIDNYAVVQLLTDAEIELGASVVIAGVDA |
Ga0181364_10631751 | 3300017701 | Freshwater Lake | MAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAGV |
Ga0181365_10682841 | 3300017736 | Freshwater Lake | MAVYSVTQKYLLDDYAVLQLLTPSEISVGQSITVAFL |
Ga0181352_11054592 | 3300017747 | Freshwater Lake | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQYLF |
Ga0181344_10671411 | 3300017754 | Freshwater Lake | MAVYSVTQKYLLDNYAVLQSLTPTEIAVGQSITVASVDATFNGTYTV |
Ga0181346_13237672 | 3300017780 | Freshwater Lake | MATYTVTHKQLLDNYAVLQLLTPTEIEVGQSITVAAVGVPFNGT |
Ga0211734_108271482 | 3300020159 | Freshwater | MATYTVTHKQLLDNYAVLQLLTPTEIEVGQSITVAAVGAPFNGTFTVYDCPE |
Ga0211729_103087042 | 3300020172 | Freshwater | MAVYSVTNKYLIDDFAVLQLLTPTEIAVGESITVAGVDATFNGTYTV |
Ga0207942_10030131 | 3300020549 | Freshwater | MAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGVDATFNG |
Ga0208852_10500642 | 3300020560 | Freshwater | MATYSVTFKSLLDNYAVLQLLTPSEIAVGESITVTSVDATFN |
Ga0212029_10269242 | 3300022063 | Aqueous | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAGVDATFNGS |
Ga0212031_10504991 | 3300022176 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAG |
Ga0212031_10672622 | 3300022176 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTYTVRALP |
Ga0181353_11164602 | 3300022179 | Freshwater Lake | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNG |
Ga0181354_12108961 | 3300022190 | Freshwater Lake | MATYTVTHKYLLDDYAVLQLLTPTELVVGGAITVAGVDATFNGSYTVYA |
Ga0196905_10585861 | 3300022198 | Aqueous | MATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVADVDATFNGTYTVRALPQYLY |
Ga0247724_10022781 | 3300024239 | Deep Subsurface Sediment | MANYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATFN |
Ga0210003_10938462 | 3300024262 | Deep Subsurface | MATYSVTFKYLLDDYAVLQLLTPTEIAVGESITVAGVDATFN |
Ga0210003_13425742 | 3300024262 | Deep Subsurface | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDAAIFDGTFVVR |
Ga0256299_10224821 | 3300024533 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTY |
Ga0255225_10479861 | 3300024537 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVD |
Ga0256345_10836312 | 3300024552 | Freshwater | MATYTVTHKYLVDNYAVLQLLTPSDVVVGGAITVTSVDATFNGSYTVY |
Ga0255283_10860122 | 3300024557 | Freshwater | MATYTVTHKYLVDNYAVLQLLTPSDVVVGGAITVTSVDATFN |
Ga0255232_10354212 | 3300024558 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVD |
Ga0255252_10936461 | 3300024853 | Freshwater | MATYSVTHKYLLNNYAVLQLLTPSEIAVGESITVASVDATFNGSYVVRALPQ |
Ga0256317_10293211 | 3300024862 | Freshwater | MATYSVTHKYLLNDYAVLQLLTPSEIAVGESIVVASVDATFN |
Ga0255246_10304062 | 3300024863 | Freshwater | MATYSVTHKYLLNDYAVLQLLTPSEIAVGESIVVASVDATFNGTYTV |
Ga0209615_1073812 | 3300025075 | Freshwater | MAVYSVTNKYLIDDFAVLQLLTPTELEVGQSITVAGVDATFNGTY |
Ga0209615_1099641 | 3300025075 | Freshwater | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDATFNGTYTV |
Ga0208303_10409501 | 3300025543 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGT |
Ga0208004_10885852 | 3300025630 | Aqueous | MATYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVT |
Ga0208161_11529612 | 3300025646 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVADVDATFNGTY |
Ga0208160_11664701 | 3300025647 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDS |
Ga0208795_10525852 | 3300025655 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDSTFNGTYLVRALPQY |
Ga0208019_10940781 | 3300025687 | Aqueous | MATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVADVDA |
Ga0208019_11270681 | 3300025687 | Aqueous | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAD |
Ga0208019_11318481 | 3300025687 | Aqueous | MATYTVTHKYLLDDYAVLQLLTPSELVVGGAITVAGVDATFNGSYTVYA |
Ga0208019_11563312 | 3300025687 | Aqueous | MATYTVTNKYLLDNYAVVQLLTPAELELGQSITVAGVDATFN |
Ga0208784_10701172 | 3300025732 | Aqueous | MATYSVTHKYLLDNYAVLQLLTPSEIAVGESITVASVDATFN |
Ga0255241_10474091 | 3300025746 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFN |
Ga0256310_10347712 | 3300025761 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPA |
Ga0256310_10745532 | 3300025761 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDA |
Ga0208644_12367261 | 3300025889 | Aqueous | MATYTVTNKYLIDNFAVVQLLTAAELELSQSITVAGVGSPFDGSF |
Ga0256298_10442071 | 3300026415 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALP |
Ga0209300_10505282 | 3300027365 | Deep Subsurface | MAVYPVTHKQRQDDYAVLTLQVPSEVVVGGSITVASVDA |
Ga0208432_10526261 | 3300027380 | Deep Subsurface | MATYTVTNKYLIDNFAVLQLLTPSEIAVGNSITVAGVDATFNGTY |
Ga0208787_10615891 | 3300027518 | Deep Subsurface | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYT |
Ga0209769_10800072 | 3300027679 | Freshwater Lake | MAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAGVD |
Ga0209492_12053771 | 3300027721 | Freshwater Sediment | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDAT |
Ga0209190_10154931 | 3300027736 | Freshwater Lake | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDAT |
Ga0209134_102845891 | 3300027764 | Freshwater Lake | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQY |
Ga0209770_100479701 | 3300027769 | Freshwater Lake | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQ |
Ga0209253_104447741 | 3300027900 | Freshwater Lake Sediment | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGTYSV |
Ga0209820_10027254 | 3300027956 | Freshwater Sediment | MATYTVTNKYLLDNFAVVQLLTAAELELGQSITVAGVDATFNGTFTVRALPQY |
Ga0255227_10672511 | 3300028266 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGT |
Ga0255233_10761762 | 3300029699 | Freshwater | MAVYSVTQKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFN |
Ga0307376_104291442 | 3300031578 | Soil | MATYTVTHKQLLDNYAVLQLLTPTEIEVGQSITVSEIAAP |
Ga0307376_104359211 | 3300031578 | Soil | MATYSVTFKYLLDDYAVLQLLTPTEIAVGESITVAGVDATFNGTYTVRAL |
Ga0315906_106379321 | 3300032050 | Freshwater | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVASVDATFNGTYTV |
Ga0334980_0039534_1852_2007 | 3300033816 | Freshwater | MATYTVTEKYLLDNYAVLQLLTPSEIAVGSSIVVSSVDATFNGTYTVRALPQ |
Ga0334982_0508109_416_532 | 3300033981 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVAGVDA |
Ga0334992_0405393_3_110 | 3300033992 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAG |
Ga0334986_0209466_953_1084 | 3300034012 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSITVAGVDATFNGT |
Ga0335002_0263440_918_1028 | 3300034020 | Freshwater | MATYSVTFKYLLDDYAVLQLLTPTEIAVGESITVTGV |
Ga0335002_0286528_817_969 | 3300034020 | Freshwater | MATYSVTNKYLIDDYAVLQLLTPTELEVGQSITVAGVDATFNGTYTIRALP |
Ga0335002_0398984_1_132 | 3300034020 | Freshwater | MATYQVISKQLTSNYAVLQLLTPAELTVGDSIVVAAVDATFNGS |
Ga0334987_0700008_1_120 | 3300034061 | Freshwater | MAVYSVTQKYLLDDYAVLQLLTPSEIAVGQSITVASVDAT |
Ga0334995_0033047_4279_4416 | 3300034062 | Freshwater | MAVYSITQKYLIDNYAVVQLLTDAEIELGASVVLAGVDATFNGTYT |
Ga0335019_0050817_2732_2839 | 3300034066 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAG |
Ga0310127_294467_407_556 | 3300034072 | Fracking Water | MATYSVTNKYLVDNYAVVELLTQADLELGVTVTVAGVDATFNGTVTVRAL |
Ga0310127_333227_2_118 | 3300034072 | Fracking Water | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVAGVDA |
Ga0310130_0094688_766_894 | 3300034073 | Fracking Water | MANYTVTHKYLLDDYAVLQLLTPSEVVVGGAITVTGVDATFNG |
Ga0335012_0149750_1162_1269 | 3300034093 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGSSIVVAS |
Ga0335012_0161344_1072_1212 | 3300034093 | Freshwater | MATYTVTNKYLIDDFAVLQLLTPTELEVGQSITVAAVDATFNGTYIV |
Ga0335027_0071757_1_138 | 3300034101 | Freshwater | MATYTVTNKYLIDNFAVLQLLTPSEIAVGQSITVAGVDATFNGTYT |
Ga0335027_0662338_452_625 | 3300034101 | Freshwater | MATYTVTNKYLVDNYAVLQLLTPNEIAVGQSITVAGVDATFNGTYSVYALPQYLFMGV |
Ga0335031_0757746_3_116 | 3300034104 | Freshwater | MATYTVTHKYLLDNYAVLQLLTPSEVVVGGAITVTGVD |
Ga0335033_0338967_1_129 | 3300034117 | Freshwater | MAVYSVTNKYLIDDFAVLQLLTPTELEVGQSITVAGVDATFNG |
Ga0335053_0217844_2_106 | 3300034118 | Freshwater | MATYTVTNKYLIDNYAVLQLLTPSEIAVGSSITVA |
Ga0335053_0521354_1_105 | 3300034118 | Freshwater | MATYSVTFKYLLDNYAVLQLLTPSEIAVGESITVA |
Ga0335053_0684392_1_132 | 3300034118 | Freshwater | MATYTVTNKYLIDDFAVLQLLTPSEIAVGQSITVAGVDATFNGT |
Ga0335058_0417983_2_145 | 3300034121 | Freshwater | MAIYTVTNKYLIDNYAVLQLLTPAELEVGQSITVAGVDATFNGTYTVR |
Ga0335049_0026379_3_107 | 3300034272 | Freshwater | MATYSVTNKYLIDNYAVLQLLTPSEIAVGQSITVA |
Ga0335052_0018498_4243_4350 | 3300034279 | Freshwater | MAVYTVTEKYLLDNYAVVQLLTPAEIELGASVVIAG |
Ga0334997_0826672_449_556 | 3300034280 | Freshwater | MAVYSVTQKYLIDNYAVVQLLTDAEIELGASVVLAG |
⦗Top⦘ |