Metagenome Family F048377

Basic Information
Family ID	F048377
Family Type	Metagenome
Number of Sequences	148
Average Sequence Length	41 residues
Representative Sequence	VSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Number of Associated Samples	74
Number of Associated Scaffolds	148

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	5.52 %
% of genes near scaffold ends (potentially truncated)	91.89 %
% of genes from short scaffolds (< 2000 bps)	97.30 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.48

Most Common Taxonomy
Group	Eukaryota (81.757 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (85.811 % of family members)
Environment Ontology (ENVO)	Unclassified (86.486 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (86.486 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 54.41% β-sheet: 0.00% Coil/Unstructured: 45.59%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 148 Family Scaffolds
PF03131	bZIP_Maf	2.03

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	81.76 %
Unclassified	root	N/A	18.24 %

Name	Rank	Taxonomy	Distribution
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	81.76 %
Unclassified	root	N/A	18.24 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005334\|Ga0068869_100542997	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	975	Open in IMG/M
3300005338\|Ga0068868_100341563	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1280	Open in IMG/M
3300005338\|Ga0068868_101755774	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	585	Open in IMG/M
3300005354\|Ga0070675_100835602	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	843	Open in IMG/M
3300005459\|Ga0068867_101964040	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	552	Open in IMG/M
3300005718\|Ga0068866_10337334	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	953	Open in IMG/M
3300005719\|Ga0068861_102308701	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	540	Open in IMG/M
3300006237\|Ga0097621_100438751	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1175	Open in IMG/M
3300009148\|Ga0105243_12597459	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	546	Open in IMG/M
3300009148\|Ga0105243_13018490	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	510	Open in IMG/M
3300013296\|Ga0157374_12152023	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	585	Open in IMG/M
3300013296\|Ga0157374_12733825	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	521	Open in IMG/M
3300013297\|Ga0157378_11436563	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	733	Open in IMG/M
3300015267\|Ga0182122_1017143	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	745	Open in IMG/M
3300015267\|Ga0182122_1025600	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	671	Open in IMG/M
3300015267\|Ga0182122_1035328	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	615	Open in IMG/M
3300015267\|Ga0182122_1049556	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	561	Open in IMG/M
3300015274\|Ga0182188_1030119	Not Available	608	Open in IMG/M
3300015275\|Ga0182172_1005427	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1038	Open in IMG/M
3300015275\|Ga0182172_1018061	Not Available	752	Open in IMG/M
3300015275\|Ga0182172_1018296	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	749	Open in IMG/M
3300015275\|Ga0182172_1060129	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	541	Open in IMG/M
3300015276\|Ga0182170_1017906	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	758	Open in IMG/M
3300015276\|Ga0182170_1028035	Not Available	673	Open in IMG/M
3300015276\|Ga0182170_1032537	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	646	Open in IMG/M
3300015277\|Ga0182128_1033312	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	646	Open in IMG/M
3300015279\|Ga0182174_1077334	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	519	Open in IMG/M
3300015281\|Ga0182160_1028416	Not Available	684	Open in IMG/M
3300015281\|Ga0182160_1044068	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	607	Open in IMG/M
3300015282\|Ga0182124_1036261	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	637	Open in IMG/M
3300015282\|Ga0182124_1044274	Not Available	603	Open in IMG/M
3300015283\|Ga0182156_1023109	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	739	Open in IMG/M
3300015283\|Ga0182156_1045939	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	610	Open in IMG/M
3300015286\|Ga0182176_1068006	Not Available	542	Open in IMG/M
3300015287\|Ga0182171_1007396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1002	Open in IMG/M
3300015287\|Ga0182171_1033691	Not Available	666	Open in IMG/M
3300015289\|Ga0182138_1012410	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	875	Open in IMG/M
3300015289\|Ga0182138_1038044	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	646	Open in IMG/M
3300015291\|Ga0182125_1017815	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	811	Open in IMG/M
3300015291\|Ga0182125_1026448	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	728	Open in IMG/M
3300015291\|Ga0182125_1050499	Not Available	607	Open in IMG/M
3300015291\|Ga0182125_1077618	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	534	Open in IMG/M
3300015294\|Ga0182126_1047694	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	619	Open in IMG/M
3300015294\|Ga0182126_1064301	Not Available	568	Open in IMG/M
3300015295\|Ga0182175_1076500	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	544	Open in IMG/M
3300015295\|Ga0182175_1078776	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	539	Open in IMG/M
3300015296\|Ga0182157_1030835	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	718	Open in IMG/M
3300015296\|Ga0182157_1064426	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	582	Open in IMG/M
3300015298\|Ga0182106_1072498	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	560	Open in IMG/M
3300015299\|Ga0182107_1101760	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	506	Open in IMG/M
3300015299\|Ga0182107_1104614	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	502	Open in IMG/M
3300015300\|Ga0182108_1023584	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	786	Open in IMG/M
3300015300\|Ga0182108_1069187	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	576	Open in IMG/M
3300015302\|Ga0182143_1009709	Not Available	991	Open in IMG/M
3300015302\|Ga0182143_1038011	Not Available	680	Open in IMG/M
3300015302\|Ga0182143_1098469	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	512	Open in IMG/M
3300015303\|Ga0182123_1050800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	611	Open in IMG/M
3300015304\|Ga0182112_1052242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	622	Open in IMG/M
3300015304\|Ga0182112_1077892	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	553	Open in IMG/M
3300015305\|Ga0182158_1049857	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	629	Open in IMG/M
3300015305\|Ga0182158_1102250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	506	Open in IMG/M
3300015314\|Ga0182140_1034756	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	723	Open in IMG/M
3300015314\|Ga0182140_1094047	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	537	Open in IMG/M
3300015314\|Ga0182140_1099293	Not Available	528	Open in IMG/M
3300015314\|Ga0182140_1110296	Not Available	511	Open in IMG/M
3300015321\|Ga0182127_1059532	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	635	Open in IMG/M
3300015321\|Ga0182127_1073622	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	596	Open in IMG/M
3300015321\|Ga0182127_1077859	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	585	Open in IMG/M
3300015321\|Ga0182127_1087495	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	564	Open in IMG/M
3300015322\|Ga0182110_1012369	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	996	Open in IMG/M
3300015322\|Ga0182110_1049336	Not Available	670	Open in IMG/M
3300015322\|Ga0182110_1075091	Not Available	590	Open in IMG/M
3300015323\|Ga0182129_1056268	Not Available	626	Open in IMG/M
3300015323\|Ga0182129_1075708	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	574	Open in IMG/M
3300015323\|Ga0182129_1115323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	503	Open in IMG/M
3300015341\|Ga0182187_1075136	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	713	Open in IMG/M
3300015342\|Ga0182109_1165816	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	564	Open in IMG/M
3300015343\|Ga0182155_1089073	Not Available	704	Open in IMG/M
3300015343\|Ga0182155_1091015	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	699	Open in IMG/M
3300015343\|Ga0182155_1149302	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	586	Open in IMG/M
3300015345\|Ga0182111_1130638	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	641	Open in IMG/M
3300015345\|Ga0182111_1229913	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	515	Open in IMG/M
3300015346\|Ga0182139_1116327	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	670	Open in IMG/M
3300015346\|Ga0182139_1134703	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	634	Open in IMG/M
3300015346\|Ga0182139_1180883	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	567	Open in IMG/M
3300015347\|Ga0182177_1138240	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	630	Open in IMG/M
3300015351\|Ga0182161_1201279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	564	Open in IMG/M
3300015351\|Ga0182161_1246366	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	519	Open in IMG/M
3300015355\|Ga0182159_1179368	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	673	Open in IMG/M
3300015355\|Ga0182159_1189604	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	658	Open in IMG/M
3300015355\|Ga0182159_1305219	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	534	Open in IMG/M
3300017404\|Ga0182203_1022942	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	929	Open in IMG/M
3300017404\|Ga0182203_1050862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	733	Open in IMG/M
3300017404\|Ga0182203_1093992	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	604	Open in IMG/M
3300017407\|Ga0182220_1049699	Not Available	627	Open in IMG/M
3300017409\|Ga0182204_1107407	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	520	Open in IMG/M
3300017410\|Ga0182207_1083123	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	648	Open in IMG/M
3300017410\|Ga0182207_1102953	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	604	Open in IMG/M
3300017410\|Ga0182207_1147489	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	535	Open in IMG/M
3300017411\|Ga0182208_1119377	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	516	Open in IMG/M
3300017415\|Ga0182202_1090821	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	578	Open in IMG/M
3300017415\|Ga0182202_1101598	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	557	Open in IMG/M
3300017415\|Ga0182202_1121289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	526	Open in IMG/M
3300017417\|Ga0182230_1089272	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	563	Open in IMG/M
3300017420\|Ga0182228_1044178	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	749	Open in IMG/M
3300017420\|Ga0182228_1064526	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	648	Open in IMG/M
3300017420\|Ga0182228_1086742	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	581	Open in IMG/M
3300017425\|Ga0182224_1075137	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	648	Open in IMG/M
3300017425\|Ga0182224_1077890	Not Available	641	Open in IMG/M
3300017425\|Ga0182224_1159236	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	509	Open in IMG/M
3300017425\|Ga0182224_1166970	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	500	Open in IMG/M
3300017427\|Ga0182190_1116728	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	567	Open in IMG/M
3300017427\|Ga0182190_1118289	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	564	Open in IMG/M
3300017430\|Ga0182192_1127424	Not Available	560	Open in IMG/M
3300017433\|Ga0182206_1091645	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	601	Open in IMG/M
3300017433\|Ga0182206_1094776	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	594	Open in IMG/M
3300017436\|Ga0182209_1083767	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	637	Open in IMG/M
3300017438\|Ga0182191_1091437	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	635	Open in IMG/M
3300017442\|Ga0182221_1166768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	506	Open in IMG/M
3300017443\|Ga0182193_1026113	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	975	Open in IMG/M
3300017680\|Ga0182233_1034661	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	888	Open in IMG/M
3300017680\|Ga0182233_1098795	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	539	Open in IMG/M
3300017681\|Ga0182226_1037980	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	863	Open in IMG/M
3300017681\|Ga0182226_1040415	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	837	Open in IMG/M
3300017681\|Ga0182226_1116603	Not Available	510	Open in IMG/M
3300017682\|Ga0182229_1023157	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1127	Open in IMG/M
3300017682\|Ga0182229_1034800	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	867	Open in IMG/M
3300017682\|Ga0182229_1059162	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	652	Open in IMG/M
3300017683\|Ga0182218_1051184	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	704	Open in IMG/M
3300017683\|Ga0182218_1086539	Not Available	601	Open in IMG/M
3300017685\|Ga0182227_1030715	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	927	Open in IMG/M
3300017685\|Ga0182227_1033597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	889	Open in IMG/M
3300017685\|Ga0182227_1043031	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	793	Open in IMG/M
3300017685\|Ga0182227_1047661	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	758	Open in IMG/M
3300017685\|Ga0182227_1091747	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	583	Open in IMG/M
3300017686\|Ga0182205_1101101	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	602	Open in IMG/M
3300017690\|Ga0182223_1066314	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	599	Open in IMG/M
3300017690\|Ga0182223_1102084	Not Available	532	Open in IMG/M
3300021060\|Ga0182232_1086105	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	509	Open in IMG/M
3300025908\|Ga0207643_10415205	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	852	Open in IMG/M
3300025935\|Ga0207709_11585921	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	544	Open in IMG/M
3300025938\|Ga0207704_11090242	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	678	Open in IMG/M
3300025940\|Ga0207691_10877219	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	752	Open in IMG/M
3300025940\|Ga0207691_11013194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	693	Open in IMG/M
3300025942\|Ga0207689_10135251	Not Available	2029	Open in IMG/M

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	86.49%
Rhizosphere	Host-Associated → Plants → Rhizosphere	6.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.08%
Roots	Host-Associated → Plants → Roots	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	86.49%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	6.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.03%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	86.49%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	6.08%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.03%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.68%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	85.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.41%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.70%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.03%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.03%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.68%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	0.68%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017680	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068869_1005429971	3300005334	Miscanthus Rhizosphere	NDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0068868_1003415631	3300005338	Miscanthus Rhizosphere	EWVMHEEIPEVEETLRVERVAKRLVTEVQVYLALVLDPVV*
Ga0068868_1017557741	3300005338	Miscanthus Rhizosphere	VYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0070675_1008356022	3300005354	Miscanthus Rhizosphere	VSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVVDPVV*
Ga0068867_1019640401	3300005459	Miscanthus Rhizosphere	QHVYVSRRRNDEWVMYEEIPEIEETQKVERAAKRLVTEV*
Ga0068866_103373343	3300005718	Miscanthus Rhizosphere	EIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0068861_1023087012	3300005719	Switchgrass Rhizosphere	KRQHVYVSRWWNDQWVVHEEIPEVEETKKVERAAKRLVTEV*
Ga0097621_1004387512	3300006237	Miscanthus Rhizosphere	VSRRQNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0105243_125974593	3300009148	Miscanthus Rhizosphere	QHVYVSRWRNDHWVVHEEIPEVEETAKVERAAKRLVTEVQVCLA*
Ga0105243_130184902	3300009148	Miscanthus Rhizosphere	YRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0157374_121520231	3300013296	Miscanthus Rhizosphere	RYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0157374_127338251	3300013296	Miscanthus Rhizosphere	VSRLRNDEWVMHEEIPKVEETLRVEWVAKRLVTEVQVCLA*
Ga0157378_114365631	3300013297	Miscanthus Rhizosphere	KGQHVYVSRWRNDQWVVHEEILKVEETQKVERAVKRLVTED*
Ga0157378_130553101	3300013297	Miscanthus Rhizosphere	PQDKQQHVYVSCWRNDQWVVHEEIPEVEETMKVERAVKRLVMEVQVCFA*
Ga0182122_10171431	3300015267	Miscanthus Phyllosphere	NDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0182122_10256002	3300015267	Miscanthus Phyllosphere	VSRYRNDEWVMHEEIPEVEETLRVERAAKRLVSEVQVYLA*
Ga0182122_10353283	3300015267	Miscanthus Phyllosphere	HVYVSRWRDDHWVMHEEILEVEETLKVERAAKRLVTEVQVCLA*
Ga0182122_10495561	3300015267	Miscanthus Phyllosphere	DEWVMHEEIPEVEETLRVERAAKHLVIEVQVCLA*
Ga0182188_10301191	3300015274	Miscanthus Phyllosphere	VYVSRWRNNQWVMHEEIPEVEETMKVERAAKRLVTEVQVCFGFII*
Ga0182172_10054273	3300015275	Miscanthus Phyllosphere	YRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVFLALVLDPVV*
Ga0182172_10180611	3300015275	Miscanthus Phyllosphere	RNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0182172_10182961	3300015275	Miscanthus Phyllosphere	RNDEWVMHEEIPEVKETLRVERAAKRLVTEVQVCLA*
Ga0182172_10601291	3300015275	Miscanthus Phyllosphere	QHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0182170_10179061	3300015276	Miscanthus Phyllosphere	YRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182170_10280352	3300015276	Miscanthus Phyllosphere	VSRWQNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCL
Ga0182170_10325372	3300015276	Miscanthus Phyllosphere	HEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV*
Ga0182128_10333122	3300015277	Miscanthus Phyllosphere	RRRNDEWVMYEEIPEIEETQKVERAAKCLVTEVQVCLA*
Ga0182174_10773342	3300015279	Miscanthus Phyllosphere	EWVMHEEIPEVEETLRVERAAKRLVTEVQVYLVLVLDPVV*
Ga0182160_10284163	3300015281	Miscanthus Phyllosphere	NDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA*
Ga0182160_10440681	3300015281	Miscanthus Phyllosphere	DKRQHVYVSRWRNDQWVVHEEIPEIEETMKVERAAKRLVMEV*
Ga0182124_10362613	3300015282	Miscanthus Phyllosphere	YVSRRWNDEWVMHEEIPEVEETLKVERAAKCLVTEVQVCLA*
Ga0182124_10442741	3300015282	Miscanthus Phyllosphere	VYVSHWRNDQWVVHEEIPEVEETKKVERAAKRLVTE
Ga0182156_10231091	3300015283	Miscanthus Phyllosphere	RRNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA*
Ga0182156_10459392	3300015283	Miscanthus Phyllosphere	WRNDEWVMHEEILEVEETLRVERAAKRLVTEVQVCLA*
Ga0182176_10680062	3300015286	Miscanthus Phyllosphere	VPHWRNDQWVVHEEILEVEETMKVEQAVKQLVMEVQVCFA*
Ga0182171_10073963	3300015287	Miscanthus Phyllosphere	YVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0182171_10336911	3300015287	Miscanthus Phyllosphere	VYVSRWWNNQWVVHEEIPEVEETKKVEWVAKRLVMEV
Ga0182138_10124102	3300015289	Miscanthus Phyllosphere	WRNDEWVMHEEILEVEETLKVERAAKRLVTEVQVCLA*
Ga0182138_10380441	3300015289	Miscanthus Phyllosphere	QHVYVSRYRNDGWVMHEEIPEVKETLRVERAAKRLVTEVQVRLA*
Ga0182125_10178151	3300015291	Miscanthus Phyllosphere	RNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182125_10264482	3300015291	Miscanthus Phyllosphere	HVYVSRWRNDEWVMHEEIPEVEETLRVERAAKHLVIEVQVCLA*
Ga0182125_10504991	3300015291	Miscanthus Phyllosphere	HVYVSRWRNNKWVMHEEILEVKETLKVERAAKRLVTEVQVCLA*
Ga0182125_10776183	3300015291	Miscanthus Phyllosphere	RRRNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVYLA*
Ga0182126_10476941	3300015294	Miscanthus Phyllosphere	PQDKRQHIYVSRWWNDQWVVHEEIPEVEETKKVEQAAKRLVTEV*
Ga0182126_10643011	3300015294	Miscanthus Phyllosphere	MHEEIPEVEETLKVEQAAKCLVTEVHVCLAWPLDPAI*
Ga0182175_10765001	3300015295	Miscanthus Phyllosphere	WRNDEWVMHEEIPEVEETLRVERAAKHLVIEVQVCLA*
Ga0182175_10787761	3300015295	Miscanthus Phyllosphere	VYVSRWWNDVWVMHEEILEVEETLKVERAAKRLVIEV*
Ga0182157_10308353	3300015296	Miscanthus Phyllosphere	VSRWRNDQWVMHEEIPEVEETMKVERAAKRLVMEVQVCLA*
Ga0182157_10644261	3300015296	Miscanthus Phyllosphere	NDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVPDPVV*
Ga0182157_10917381	3300015296	Miscanthus Phyllosphere	VSRWRNDQWVVHEEIPEVEETAKVERAAKRLVTEVQVCLDLPLDST
Ga0182106_10724982	3300015298	Miscanthus Phyllosphere	SRWRNDQWVVHEEIPEVEETMKVERAAKRLVTEVQVCFA*
Ga0182107_11017602	3300015299	Miscanthus Phyllosphere	SRFRNDEWVIHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV*
Ga0182107_11046141	3300015299	Miscanthus Phyllosphere	NDQWVMHEEIPEVEETLKVERAAKRLVMEVQVCLA*
Ga0182108_10235841	3300015300	Miscanthus Phyllosphere	QDKRQHVYVSRWQNDQWVMHEEILEVEETMKVERAAKRLVTEVQVCLA*
Ga0182108_10691871	3300015300	Miscanthus Phyllosphere	NDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182143_10097093	3300015302	Miscanthus Phyllosphere	RNDEWVMHEEILEVEETLKVERAAKCLVTEVQVCLA*
Ga0182143_10380112	3300015302	Miscanthus Phyllosphere	VSRWQNDQWVVHEEIPEIEETMKVERVAKRLVMEVQVCFA*
Ga0182143_10984692	3300015302	Miscanthus Phyllosphere	RQHVYVSRWRNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA*
Ga0182123_10508001	3300015303	Miscanthus Phyllosphere	HVYVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVWLACPLDPVM*
Ga0182112_10522421	3300015304	Miscanthus Phyllosphere	RYRNDGWVMHKEIPEVKETLRVERAAKRLVTEVQVRLA*
Ga0182112_10778921	3300015304	Miscanthus Phyllosphere	VYVSRWRNDQWVMHEEIPEVEETMKVERAAKRLVTEVQVCFA*
Ga0182158_10498572	3300015305	Miscanthus Phyllosphere	WRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182158_11022502	3300015305	Miscanthus Phyllosphere	YVLRRRNDEWVMHEEILEVEETLKVKRAAKHLVTEVQVCLA*
Ga0182140_10347561	3300015314	Miscanthus Phyllosphere	VYVSRWRNDQWVVHEEIPEIEETMKVEQAAKHLVMEVQVCFA*
Ga0182140_10940471	3300015314	Miscanthus Phyllosphere	RWWNDEWVMHEEIPEVEETLKVERAAKRLVIEVQVCLA*
Ga0182140_10992932	3300015314	Miscanthus Phyllosphere	MYVSRWWNDQWVVHEEIPEVKETKKVERAAKRLVTEV*
Ga0182140_11102961	3300015314	Miscanthus Phyllosphere	RNDQWVMHEEIPEVEETMKVERAAKCLVTEVQVCLA*
Ga0182127_10595322	3300015321	Miscanthus Phyllosphere	PQDKRQHVYVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEV*
Ga0182127_10736221	3300015321	Miscanthus Phyllosphere	PQDKRQYVYVSRWRNDQWVMHEEIPEVKETLKVERAAKRLVTEV*
Ga0182127_10778592	3300015321	Miscanthus Phyllosphere	VLRWWNDQWVMHEEILEVEETMKVERAAKHLVMKVQVCLA*
Ga0182127_10874951	3300015321	Miscanthus Phyllosphere	VYVSRWRNDEWVMHEEIPEVEETLKVERAAKCLVIEVQVCLA*
Ga0182110_10123693	3300015322	Miscanthus Phyllosphere	VSRFRNDEWVMHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV*
Ga0182110_10493362	3300015322	Miscanthus Phyllosphere	SRWRNDQWVVHEEIPEVEETMKVERAAKCLVTEVQVCFGFII*
Ga0182110_10750911	3300015322	Miscanthus Phyllosphere	VYVSRWWNDEWVVHEEILEVEETKKVERAAKRLVTEVQVG
Ga0182129_10562681	3300015323	Miscanthus Phyllosphere	MYVSHWQNNQWVVHKEIPEVEETKKVERAVKRLVT
Ga0182129_10757083	3300015323	Miscanthus Phyllosphere	WNDEWVMHEEIPEVEETLKVERAAKHLVTEVQVCLA*
Ga0182129_11153231	3300015323	Miscanthus Phyllosphere	EEIPEVEETLRVERAAKRLVTEVQVYLVLVLDPVV*
Ga0182187_10751362	3300015341	Miscanthus Phyllosphere	VSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182109_11658161	3300015342	Miscanthus Phyllosphere	KRQHVYVSRWRNDQWVVHEEIPEVEETTKVERAAKRLVTEV*
Ga0182155_10890731	3300015343	Miscanthus Phyllosphere	VYVLRWWNDQWVVHEEIPEVKETKKVERAAKRLVLEVQVSFA
Ga0182155_10910152	3300015343	Miscanthus Phyllosphere	WRNNEWVMHEEILEVEETLRVERAAKHLVTEVQVCLA*
Ga0182155_11493023	3300015343	Miscanthus Phyllosphere	DKRQHVYVSRWRNDQWVMHEEILEVKETLKVERAAKRLVAEVQVCLA*
Ga0182111_11306381	3300015345	Miscanthus Phyllosphere	DRRQHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLA*
Ga0182111_12299131	3300015345	Miscanthus Phyllosphere	RWRNDEWVMHKEIPEVEETLRVERAAKRLVTEVQVCLA*
Ga0182139_11163272	3300015346	Miscanthus Phyllosphere	DEWVMHEEIPEVEETLRVERAAKHLVTEVQVYLA*
Ga0182139_11347032	3300015346	Miscanthus Phyllosphere	VSRWRNDEWVMHEEIPEVEETLRVERAAKRLLTEVQVCLA*
Ga0182139_11808833	3300015346	Miscanthus Phyllosphere	VYVSRWRNDEWVMHEEILEVEETLKVERAAKRLVTEVQVCLVWPLDPVM*
Ga0182177_11382403	3300015347	Miscanthus Phyllosphere	VSRWRNDQWIVHEEIPEVEETMKVERAAKCLVMEVQVCFA*
Ga0182161_12012791	3300015351	Miscanthus Phyllosphere	VYVLRRRNAERVMHEEIHEIKETQKVERAAKHLVTEVQVCLS*
Ga0182161_12463663	3300015351	Miscanthus Phyllosphere	RWRNDQWVVHKEIPEVEETAKVERAAKRLVTEVQVCFGFII*
Ga0182159_11793682	3300015355	Miscanthus Phyllosphere	HVYVSRRRNDEWVMYEEIPEIEETQKVERAAKRLVTEVQVCLA*
Ga0182159_11896042	3300015355	Miscanthus Phyllosphere	PKDKRQHVYVSRRRNDEWVMHEEIPEIEETLKVERAAKRLVTEVQVCLA*
Ga0182159_13052191	3300015355	Miscanthus Phyllosphere	PQDKRQHVYVSRWQNDQWVMHEEIPEVEETMKVERVAKRLVMEVQVCLA*
Ga0182203_10229423	3300017404	Miscanthus Phyllosphere	VMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV
Ga0182203_10508621	3300017404	Miscanthus Phyllosphere	AYVSRWRNDQWVMHEEIPEVEETLKVEQAAKRLVTEVQVCLA
Ga0182203_10939921	3300017404	Miscanthus Phyllosphere	HEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPIV
Ga0182203_11632612	3300017404	Miscanthus Phyllosphere	YVSRWRNNQWVVHEEILEVKETAKVERAAKRLVTEVQVCLALPLDPTIQSNRQT
Ga0182220_10496993	3300017407	Miscanthus Phyllosphere	VSRWRNDQWVMHEEIPEVEETMKVERAAKRLVTEVQVCLA
Ga0182204_11074071	3300017409	Miscanthus Phyllosphere	HEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0182207_10831232	3300017410	Miscanthus Phyllosphere	NDEWVMHEEILEVEETLKVERAAKRLVTEVQVCLA
Ga0182207_11029531	3300017410	Miscanthus Phyllosphere	DKRQHVYVSRWQNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Ga0182207_11474893	3300017410	Miscanthus Phyllosphere	RYQNDEWVIHEEILEVKETLRVEWAAKRLVTEVQVRLA
Ga0182208_11193772	3300017411	Miscanthus Phyllosphere	WRNDEWVMHEETPEVEETLKVERAAKRLVTEVQLCLA
Ga0182202_10908213	3300017415	Miscanthus Phyllosphere	VSRWQNDQWVMHEEIPEVEETVKVERAAKRLVMEVQVCLA
Ga0182202_11015982	3300017415	Miscanthus Phyllosphere	RQHVYVSRWRNDQWVMHEEIPEVEETLKVEQAAKRLVTEV
Ga0182202_11212891	3300017415	Miscanthus Phyllosphere	RQHVYVSRRRNDEWVMYEEIPEIEETQKVERAAKHLVAEVQVCLA
Ga0182230_10892723	3300017417	Miscanthus Phyllosphere	NDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVPDPVV
Ga0182228_10441782	3300017420	Miscanthus Phyllosphere	SRYRNDEWVMHEEILEVEETLRVERVAKHLVTEVQVCLA
Ga0182228_10645261	3300017420	Miscanthus Phyllosphere	QHVYVLRWWNDQWVMHEEIPEVEETLKVERAAKRLVMEVQVCLA
Ga0182228_10867421	3300017420	Miscanthus Phyllosphere	NDEWVMHEEILEVEETLKVERAAKHLVIEVQVCLA
Ga0182224_10751371	3300017425	Miscanthus Phyllosphere	RWWNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA
Ga0182224_10778902	3300017425	Miscanthus Phyllosphere	RNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA
Ga0182224_11592362	3300017425	Miscanthus Phyllosphere	SRWQNDEWVMHEEIPEVEETLKVERAAKRLVTEVQVCLA
Ga0182224_11669701	3300017425	Miscanthus Phyllosphere	RWWNDQWVMHEEIPEVEETMKVERAAKRLVTEVQVCFA
Ga0182190_11167281	3300017427	Miscanthus Phyllosphere	HVYVSRWWNDQWVMHEEILEVEETLKVERAAKHLVTEVQVCLA
Ga0182190_11182891	3300017427	Miscanthus Phyllosphere	RPKDKRQHVYVSRWRNDEGVTHEEIPEIEETLKVEQAAKSLVTEVQVRLA
Ga0182192_11274241	3300017430	Miscanthus Phyllosphere	HVYVSRWRNDQWVVHEEIPKVEKTMKVERAVKRLVTEV
Ga0182206_10916451	3300017433	Miscanthus Phyllosphere	WRNDQWVVHEEIPEVEETMKVERAAKRLVTEVQVCFP
Ga0182206_10947761	3300017433	Miscanthus Phyllosphere	EWVMHEEIPEVEETLRVERAAKRLVTEVQVYLVLVLDPVV
Ga0182209_10837672	3300017436	Miscanthus Phyllosphere	MSRWQNDQWVVHEEILEVEETMKVERAAKRLVTEV
Ga0182191_10914372	3300017438	Miscanthus Phyllosphere	VSHWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Ga0182221_11667682	3300017442	Miscanthus Phyllosphere	WRNDEWVMHEETPEVEETLKVERAAKRLVAEVQVCLA
Ga0182193_10261133	3300017443	Miscanthus Phyllosphere	DEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVPDPVV
Ga0182233_10346611	3300017680	Miscanthus Phyllosphere	QHVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEV
Ga0182233_10987951	3300017680	Miscanthus Phyllosphere	QHVYVSRWRNDQWVVHEEIPEVEETMKVERAAKRLVTEVQVCFA
Ga0182226_10379801	3300017681	Miscanthus Phyllosphere	SRFRNDEWVIHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0182226_10404151	3300017681	Miscanthus Phyllosphere	HEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV
Ga0182226_11166032	3300017681	Miscanthus Phyllosphere	VSRRRNNEWVMYEEIPEIEETQKVERAAKRLVIEVQVCLA
Ga0182229_10231574	3300017682	Miscanthus Phyllosphere	PQDKRQHVYVSRWRNDEWVMHEEILEVKETLKVERAAKRLVTEVQVCLA
Ga0182229_10348001	3300017682	Miscanthus Phyllosphere	VYVSRYRNDGWVMHEEIPEVKETLRVEWAAKHLVTEVQVHLA
Ga0182229_10591623	3300017682	Miscanthus Phyllosphere	HEEIPEIEETIRVERAAKRLVTEVQVYLVLVLDPVV
Ga0182218_10511843	3300017683	Miscanthus Phyllosphere	RWRNDQWVVHEEIPEIEETMKVERAAKRLVTEVQVCLA
Ga0182218_10865391	3300017683	Miscanthus Phyllosphere	RYRNDGWVMHEEIPEVEETLRVERAAKRLVTEVQVRLA
Ga0182227_10307153	3300017685	Miscanthus Phyllosphere	RNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVFLA
Ga0182227_10335971	3300017685	Miscanthus Phyllosphere	PQDRRQHVYVSRYRNDGWVMHEEIPEVEETLRVERAAKRLVTEVQVRLA
Ga0182227_10430311	3300017685	Miscanthus Phyllosphere	HVYVSRWRNNQWVVHEEILEVKETAKVERAAKRLVTEV
Ga0182227_10476611	3300017685	Miscanthus Phyllosphere	GPSQHKRQHIYVSRWRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVCLA
Ga0182227_10917473	3300017685	Miscanthus Phyllosphere	QDKRQHVYVSRWRNDQWVVHEEIPEIEETMKVERAAKRLVTEVQVHFA
Ga0182205_11011011	3300017686	Miscanthus Phyllosphere	KRQHVYVSRWRNDEWVMHEEVPEVEETLRVERAAKRLVTEV
Ga0182223_10663141	3300017690	Miscanthus Phyllosphere	PKDKRQHVYVSRWRNDEWVMHEEIPEIEETLKVERAAKRLVTEVQVCLA
Ga0182223_11020842	3300017690	Miscanthus Phyllosphere	VYVSRWRNDQWVMHEEIPEVEETMKVERAAKRLVMEVQVCFGFII
Ga0182232_10861051	3300021060	Phyllosphere	HVYVSRYRNDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV
Ga0207643_104152053	3300025908	Miscanthus Rhizosphere	QDRRQHVYVSRYRNDEWVMHEEIPEVEETLRVKRAAKRLVTEV
Ga0207709_115859212	3300025935	Miscanthus Rhizosphere	HVYVSRFRNDEWVMHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0207704_110902421	3300025938	Miscanthus Rhizosphere	CFWNDEWVMHEEIPEIEETIRVERAAKRLVTEVQVYLALVVDPVV
Ga0207691_108772192	3300025940	Miscanthus Rhizosphere	QHVYVSRYRNDEWVMHEEILEVEETLRVERAAKRLVTEVQVYLA
Ga0207691_110131942	3300025940	Miscanthus Rhizosphere	RQHVHVSRYRNDEWVMHEEIPEVEETLRVEWAAKRLVTEVQVHLA
Ga0207689_101352514	3300025942	Miscanthus Rhizosphere	NDEWVMHEEIPEVEETLRVERAAKRLVTEVQVYLALVLDPVV

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.48
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.48
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F048377

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign