Basic Information | |
---|---|
Family ID | F048311 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 148 |
Average Sequence Length | 46 residues |
Representative Sequence | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLEKALKEKNDRE |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 148 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 86.81 % |
% of genes near scaffold ends (potentially truncated) | 27.03 % |
% of genes from short scaffolds (< 2000 bps) | 62.16 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (45.946 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater (18.243 % of family members) |
Environment Ontology (ENVO) | Unclassified (62.162 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (63.514 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 59.21% β-sheet: 0.00% Coil/Unstructured: 40.79% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 148 Family Scaffolds |
---|---|---|
PF00877 | NLPC_P60 | 8.11 |
PF05257 | CHAP | 7.43 |
PF13884 | Peptidase_S74 | 4.73 |
PF01391 | Collagen | 2.70 |
PF00206 | Lyase_1 | 2.03 |
PF05135 | Phage_connect_1 | 1.35 |
PF04860 | Phage_portal | 1.35 |
PF06067 | DUF932 | 1.35 |
PF01061 | ABC2_membrane | 0.68 |
PF00535 | Glycos_transf_2 | 0.68 |
PF13207 | AAA_17 | 0.68 |
PF02223 | Thymidylate_kin | 0.68 |
PF00303 | Thymidylat_synt | 0.68 |
PF05065 | Phage_capsid | 0.68 |
PF02945 | Endonuclease_7 | 0.68 |
PF01464 | SLT | 0.68 |
COG ID | Name | Functional Category | % Frequency in 148 Family Scaffolds |
---|---|---|---|
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 8.11 |
COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.68 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.68 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.14 % |
Unclassified | root | N/A | 39.86 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000405|LV_Brine_h2_0102DRAFT_1004317 | Not Available | 3367 | Open in IMG/M |
3300000525|JGI1221J11331_1033980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1072 | Open in IMG/M |
3300002296|B570J29587_1000014 | All Organisms → cellular organisms → Bacteria | 16283 | Open in IMG/M |
3300002298|B570J29599_1009664 | Not Available | 594 | Open in IMG/M |
3300004240|Ga0007787_10449450 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 643 | Open in IMG/M |
3300004792|Ga0007761_11204944 | Not Available | 598 | Open in IMG/M |
3300005517|Ga0070374_10112563 | Not Available | 1417 | Open in IMG/M |
3300005517|Ga0070374_10470614 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 628 | Open in IMG/M |
3300005527|Ga0068876_10012023 | All Organisms → cellular organisms → Bacteria | 5656 | Open in IMG/M |
3300005528|Ga0068872_10695165 | Not Available | 534 | Open in IMG/M |
3300005528|Ga0068872_10728184 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
3300005581|Ga0049081_10085345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1182 | Open in IMG/M |
3300005581|Ga0049081_10271787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 590 | Open in IMG/M |
3300005582|Ga0049080_10109311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 938 | Open in IMG/M |
3300005758|Ga0078117_1125873 | Not Available | 1549 | Open in IMG/M |
3300006484|Ga0070744_10014191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2363 | Open in IMG/M |
3300006484|Ga0070744_10095828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 858 | Open in IMG/M |
3300006639|Ga0079301_1001315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11496 | Open in IMG/M |
3300008055|Ga0108970_10300154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2013 | Open in IMG/M |
3300008107|Ga0114340_1004329 | Not Available | 7738 | Open in IMG/M |
3300008107|Ga0114340_1021175 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3064 | Open in IMG/M |
3300008107|Ga0114340_1040475 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300008107|Ga0114340_1085267 | All Organisms → cellular organisms → Bacteria | 1871 | Open in IMG/M |
3300008107|Ga0114340_1213705 | Not Available | 631 | Open in IMG/M |
3300008110|Ga0114343_1131490 | Not Available | 824 | Open in IMG/M |
3300008113|Ga0114346_1217197 | Not Available | 1284 | Open in IMG/M |
3300008116|Ga0114350_1006435 | Not Available | 10735 | Open in IMG/M |
3300008116|Ga0114350_1053766 | All Organisms → Viruses → Predicted Viral | 1448 | Open in IMG/M |
3300008116|Ga0114350_1065654 | Not Available | 1258 | Open in IMG/M |
3300008116|Ga0114350_1121614 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 784 | Open in IMG/M |
3300008120|Ga0114355_1160135 | Not Available | 785 | Open in IMG/M |
3300008120|Ga0114355_1194321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 662 | Open in IMG/M |
3300008262|Ga0114337_1042095 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
3300008266|Ga0114363_1019538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3006 | Open in IMG/M |
3300008266|Ga0114363_1036326 | Not Available | 3164 | Open in IMG/M |
3300008266|Ga0114363_1051639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1633 | Open in IMG/M |
3300008266|Ga0114363_1084784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1816 | Open in IMG/M |
3300008266|Ga0114363_1105332 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 1007 | Open in IMG/M |
3300008448|Ga0114876_1228618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 599 | Open in IMG/M |
3300008450|Ga0114880_1005133 | Not Available | 6934 | Open in IMG/M |
3300008450|Ga0114880_1025470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2700 | Open in IMG/M |
3300008450|Ga0114880_1041251 | Not Available | 2002 | Open in IMG/M |
3300008450|Ga0114880_1109517 | Not Available | 1054 | Open in IMG/M |
3300009068|Ga0114973_10052641 | Not Available | 2400 | Open in IMG/M |
3300009152|Ga0114980_10009035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6460 | Open in IMG/M |
3300009152|Ga0114980_10073694 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium | 2053 | Open in IMG/M |
3300009155|Ga0114968_10452250 | Not Available | 695 | Open in IMG/M |
3300009160|Ga0114981_10009115 | All Organisms → cellular organisms → Bacteria | 5958 | Open in IMG/M |
3300009161|Ga0114966_10054248 | All Organisms → Viruses → Predicted Viral | 2835 | Open in IMG/M |
3300009161|Ga0114966_10087501 | Not Available | 2117 | Open in IMG/M |
3300009181|Ga0114969_10066054 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2383 | Open in IMG/M |
3300009183|Ga0114974_10001247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20143 | Open in IMG/M |
3300010885|Ga0133913_13102477 | Not Available | 1103 | Open in IMG/M |
3300011995|Ga0153800_1015190 | Not Available | 771 | Open in IMG/M |
3300012012|Ga0153799_1094880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 532 | Open in IMG/M |
3300013004|Ga0164293_10130516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1891 | Open in IMG/M |
3300013004|Ga0164293_10798695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 598 | Open in IMG/M |
3300013372|Ga0177922_10376075 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 805 | Open in IMG/M |
3300013372|Ga0177922_10810618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium callanderi | 2110 | Open in IMG/M |
3300013372|Ga0177922_11177035 | Not Available | 661 | Open in IMG/M |
3300017774|Ga0181358_1208783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 635 | Open in IMG/M |
3300017780|Ga0181346_1213594 | Not Available | 690 | Open in IMG/M |
3300019783|Ga0181361_109310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 763 | Open in IMG/M |
3300019784|Ga0181359_1034848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1948 | Open in IMG/M |
3300019784|Ga0181359_1126031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 909 | Open in IMG/M |
3300019784|Ga0181359_1159300 | Not Available | 766 | Open in IMG/M |
3300019784|Ga0181359_1200688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300019784|Ga0181359_1246544 | Not Available | 545 | Open in IMG/M |
3300020159|Ga0211734_11212190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10988 | Open in IMG/M |
3300020172|Ga0211729_11413650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 692 | Open in IMG/M |
3300020205|Ga0211731_10897294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 34080 | Open in IMG/M |
3300020498|Ga0208050_1007454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1297 | Open in IMG/M |
3300020527|Ga0208232_1011772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1338 | Open in IMG/M |
3300022190|Ga0181354_1188555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 622 | Open in IMG/M |
3300022407|Ga0181351_1005128 | All Organisms → cellular organisms → Bacteria | 4968 | Open in IMG/M |
3300022407|Ga0181351_1246593 | Not Available | 559 | Open in IMG/M |
3300022752|Ga0214917_10021980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5174 | Open in IMG/M |
3300023174|Ga0214921_10407307 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 691 | Open in IMG/M |
3300023301|Ga0209414_1000496 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 18583 | Open in IMG/M |
3300024346|Ga0244775_10081475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2765 | Open in IMG/M |
3300027114|Ga0208009_1000033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 36863 | Open in IMG/M |
3300027631|Ga0208133_1062432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 890 | Open in IMG/M |
3300027644|Ga0209356_1015488 | Not Available | 2634 | Open in IMG/M |
3300027659|Ga0208975_1067530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1072 | Open in IMG/M |
3300027679|Ga0209769_1040479 | Not Available | 1593 | Open in IMG/M |
(restricted) 3300027728|Ga0247836_1296425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 578 | Open in IMG/M |
3300027732|Ga0209442_1278753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 586 | Open in IMG/M |
3300027744|Ga0209355_1086028 | Not Available | 1446 | Open in IMG/M |
3300027744|Ga0209355_1181585 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 875 | Open in IMG/M |
3300027756|Ga0209444_10028291 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
3300027759|Ga0209296_1001118 | All Organisms → cellular organisms → Bacteria | 21466 | Open in IMG/M |
3300027763|Ga0209088_10000276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 37302 | Open in IMG/M |
3300027763|Ga0209088_10300728 | Not Available | 650 | Open in IMG/M |
3300027816|Ga0209990_10285866 | Not Available | 742 | Open in IMG/M |
3300027963|Ga0209400_1196644 | Not Available | 838 | Open in IMG/M |
3300027971|Ga0209401_1001040 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 18544 | Open in IMG/M |
3300027973|Ga0209298_10010620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4919 | Open in IMG/M |
(restricted) 3300027977|Ga0247834_1003281 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 22292 | Open in IMG/M |
3300028025|Ga0247723_1000375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 30944 | Open in IMG/M |
3300028025|Ga0247723_1001207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15578 | Open in IMG/M |
3300028025|Ga0247723_1043113 | Not Available | 1330 | Open in IMG/M |
3300028025|Ga0247723_1066688 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 980 | Open in IMG/M |
(restricted) 3300028557|Ga0247832_1062935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1814 | Open in IMG/M |
(restricted) 3300028557|Ga0247832_1272428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300031758|Ga0315907_10046304 | All Organisms → cellular organisms → Bacteria | 3842 | Open in IMG/M |
3300031758|Ga0315907_10165194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1869 | Open in IMG/M |
3300031758|Ga0315907_10230372 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1543 | Open in IMG/M |
3300031758|Ga0315907_10854814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300031758|Ga0315907_11176069 | Not Available | 539 | Open in IMG/M |
3300031857|Ga0315909_10007161 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12495 | Open in IMG/M |
3300031857|Ga0315909_10007264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12392 | Open in IMG/M |
3300031857|Ga0315909_10288374 | Not Available | 1235 | Open in IMG/M |
3300031857|Ga0315909_10291961 | Not Available | 1224 | Open in IMG/M |
3300031857|Ga0315909_10949093 | Not Available | 525 | Open in IMG/M |
3300031951|Ga0315904_10103155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2993 | Open in IMG/M |
3300031951|Ga0315904_10310630 | Not Available | 1472 | Open in IMG/M |
3300031951|Ga0315904_10352304 | Not Available | 1354 | Open in IMG/M |
3300031951|Ga0315904_10392490 | Not Available | 1261 | Open in IMG/M |
3300031951|Ga0315904_10420221 | Not Available | 1205 | Open in IMG/M |
3300031951|Ga0315904_10765929 | Not Available | 800 | Open in IMG/M |
3300031951|Ga0315904_10814812 | Not Available | 766 | Open in IMG/M |
3300031951|Ga0315904_10819718 | Not Available | 763 | Open in IMG/M |
3300031951|Ga0315904_11148229 | Not Available | 601 | Open in IMG/M |
3300031963|Ga0315901_10313183 | Not Available | 1295 | Open in IMG/M |
3300031963|Ga0315901_10427819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1053 | Open in IMG/M |
3300031963|Ga0315901_10493576 | Not Available | 956 | Open in IMG/M |
3300032050|Ga0315906_10367729 | Not Available | 1266 | Open in IMG/M |
3300032050|Ga0315906_10420425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1157 | Open in IMG/M |
3300032050|Ga0315906_11117777 | Not Available | 580 | Open in IMG/M |
3300032116|Ga0315903_10223954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1649 | Open in IMG/M |
3300032116|Ga0315903_10906366 | Not Available | 629 | Open in IMG/M |
3300033994|Ga0334996_0231388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 964 | Open in IMG/M |
3300034023|Ga0335021_0001099 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21066 | Open in IMG/M |
3300034062|Ga0334995_0012230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7987 | Open in IMG/M |
3300034062|Ga0334995_0012270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7975 | Open in IMG/M |
3300034062|Ga0334995_0687495 | Not Available | 578 | Open in IMG/M |
3300034066|Ga0335019_0477002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 749 | Open in IMG/M |
3300034071|Ga0335028_0733098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 514 | Open in IMG/M |
3300034082|Ga0335020_0031082 | Not Available | 2926 | Open in IMG/M |
3300034093|Ga0335012_0596951 | Not Available | 511 | Open in IMG/M |
3300034101|Ga0335027_0025056 | Not Available | 5019 | Open in IMG/M |
3300034106|Ga0335036_0004464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11925 | Open in IMG/M |
3300034106|Ga0335036_0016910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5912 | Open in IMG/M |
3300034116|Ga0335068_0137565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1333 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 18.24% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.89% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.86% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 12.84% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.81% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.41% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 4.05% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.70% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.70% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 2.70% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.03% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 2.03% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.35% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.68% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.68% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.68% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.68% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
3300000525 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron | Environmental | Open in IMG/M |
3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300002298 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004792 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005758 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300019783 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027977 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_12m | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028557 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LV_Brine_h2_0102DRAFT_10043173 | 3300000405 | Hypersaline | MDKETELNINLVIASLRDQIGLLALDKAMLAARLAELEVKDTQGDV* |
JGI1221J11331_10339802 | 3300000525 | Hypersaline | MDKETELNINLVIASLRDQIGLLALDKAMLAARLAELEAKDTQGDV* |
B570J29587_100001434 | 3300002296 | Freshwater | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE* |
B570J29599_10096642 | 3300002298 | Freshwater | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEAK |
Ga0007787_104494503 | 3300004240 | Freshwater Lake | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALKEKNDRE* |
Ga0007761_112049441 | 3300004792 | Freshwater Lake | GATMDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE* |
Ga0070374_101125631 | 3300005517 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLE |
Ga0070374_104706142 | 3300005517 | Freshwater Lake | MDNTTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE* |
Ga0068876_100120236 | 3300005527 | Freshwater Lake | MNESTELNINLVIASLREQIGLLALDKAMLTARLQELETEQSTTN* |
Ga0068872_106951653 | 3300005528 | Freshwater Lake | MNESTELNINLVIASLREQIGLLALDKAMLTARLQELET |
Ga0068872_107281841 | 3300005528 | Freshwater Lake | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELEMKLKERDDRE* |
Ga0049081_100853454 | 3300005581 | Freshwater Lentic | MDNATELDINVVIAALREQIGLLALDKAMLAARVGDLELKLKEKNDCE* |
Ga0049081_102717872 | 3300005581 | Freshwater Lentic | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDRE* |
Ga0049080_101093113 | 3300005582 | Freshwater Lentic | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDCE* |
Ga0078117_11258734 | 3300005758 | Lake Water | MDKQTELDINMVIAALREQIGLLSLDKAMLTARIADLESQLKAKE* |
Ga0070744_100141913 | 3300006484 | Estuarine | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE* |
Ga0070744_100958281 | 3300006484 | Estuarine | HVSKHSRGTQMDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDCE* |
Ga0079301_100131518 | 3300006639 | Deep Subsurface | MDNQTELDINVVIAVLREQIGLLALDKAMLTARIGDLETKLKEKNDCE* |
Ga0108970_103001542 | 3300008055 | Estuary | MDSTTELDINIVIAALREQIGLLALDKAMLTARIGDLEAKLKEKNDRE* |
Ga0114340_100432911 | 3300008107 | Freshwater, Plankton | MNENTELNINLVIASLREQIGLLALDKAMLTARLQELETESSTTN* |
Ga0114340_10211755 | 3300008107 | Freshwater, Plankton | MNESTELNINLVIASLREQIGLLALDKAMLTARLQEL |
Ga0114340_10404752 | 3300008107 | Freshwater, Plankton | MNESTELNVNLVIASLREQIGLLALDKAMLTARLQELETEKSTTN* |
Ga0114340_10852673 | 3300008107 | Freshwater, Plankton | MKENTELDINFVIASLREQIGLLALDKAMLTARLQELETESSTTD* |
Ga0114340_12137053 | 3300008107 | Freshwater, Plankton | RMNESTELNINLVIASLREQIGLLALDKAMLTARLQELETEQSTTN* |
Ga0114343_11314902 | 3300008110 | Freshwater, Plankton | MKENTELNINLVIASLREQIGLLALDKAMLTARLQELETESSTTD* |
Ga0114346_12171975 | 3300008113 | Freshwater, Plankton | MNESTELNINLVIASLREQIGLLALDKAMLTARLQELETETSTTN* |
Ga0114350_10064355 | 3300008116 | Freshwater, Plankton | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELESKLKEKDDRE* |
Ga0114350_10537662 | 3300008116 | Freshwater, Plankton | MDSNTELDINMVIAALREQVGLFALDKAMLTARVAELEMKLKERDDRE* |
Ga0114350_10656543 | 3300008116 | Freshwater, Plankton | MDEKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALKEKNDRE* |
Ga0114350_11216142 | 3300008116 | Freshwater, Plankton | MNQTTELDINLVIASLREQIGLLALDKAMLTARLQELENTNDTTA* |
Ga0114355_11601353 | 3300008120 | Freshwater, Plankton | MDKETQLDINIVIAAMREQVGLLALDKAMLTARIEDLEKQLKEKES* |
Ga0114355_11943212 | 3300008120 | Freshwater, Plankton | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLDKALKEKNDRE* |
Ga0114337_10420953 | 3300008262 | Freshwater, Plankton | MNESTELNINLVIASLREQIGLLALDKAMLTARLQELETDHSTTN* |
Ga0114363_10195384 | 3300008266 | Freshwater, Plankton | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKAL |
Ga0114363_10363262 | 3300008266 | Freshwater, Plankton | MDNTTELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE* |
Ga0114363_10516392 | 3300008266 | Freshwater, Plankton | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELEKILKERDDRE* |
Ga0114363_10847843 | 3300008266 | Freshwater, Plankton | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLEKALKEKNDRE* |
Ga0114363_11053322 | 3300008266 | Freshwater, Plankton | MDKETQLDINIVIAAMREQIGLLALDKAMLTARIEDLEKQLKEKES* |
Ga0114876_12286182 | 3300008448 | Freshwater Lake | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELETILKERDDRE* |
Ga0114880_10051337 | 3300008450 | Freshwater Lake | MDKETQLDINTVIAAMREQIGLLALDKAMLTARIQDLEKQLKEKES* |
Ga0114880_10254701 | 3300008450 | Freshwater Lake | MDKETQLDINIVIAAMREQIGLLALDKAMLTARIEDLEKQL |
Ga0114880_10412513 | 3300008450 | Freshwater Lake | MDSNTELDINMVVAALREQIGLFALDKAMLTARVAELEMKLKERDDRE* |
Ga0114880_11095171 | 3300008450 | Freshwater Lake | MEDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKA |
Ga0114880_11240451 | 3300008450 | Freshwater Lake | VVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE* |
Ga0114973_100526416 | 3300009068 | Freshwater Lake | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDRE* |
Ga0114980_1000903510 | 3300009152 | Freshwater Lake | MDNATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDCE* |
Ga0114980_100736944 | 3300009152 | Freshwater Lake | MDNNTELDINIVIAVLREQIGLLALDKAMLTARIGDLEAKLKEKNDCE* |
Ga0114968_104522502 | 3300009155 | Freshwater Lake | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLESKLKEKNDCE* |
Ga0114981_100091154 | 3300009160 | Freshwater Lake | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEIKLKEKNDCE* |
Ga0114966_100542489 | 3300009161 | Freshwater Lake | MNNNTELDINVVIAALREQIGLLALDKAMLTARVGDLERELKEKNDRE* |
Ga0114966_100875013 | 3300009161 | Freshwater Lake | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLERELKEKNDRE* |
Ga0114969_100660544 | 3300009181 | Freshwater Lake | MHNNTELDINVVIAALREQIGLLALDKAMLTARVGDLERELKEKNDRE* |
Ga0114974_1000124717 | 3300009183 | Freshwater Lake | MNENTELNINLVIASLREQIGLLALDKAMLTARLQELENKESTTN* |
Ga0133913_131024773 | 3300010885 | Freshwater Lake | VNESTELNINLVIASLREQIGLLALDKAMLTARLQELEIEKSTTN* |
Ga0153800_10151903 | 3300011995 | Freshwater | MDNNTELDINVVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE* |
Ga0153799_10948802 | 3300012012 | Freshwater | MDNKTELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE* |
Ga0153805_10033171 | 3300012013 | Surface Ice | VVIAALREQIGLLALDKAMLTARVGDLERELKEKNDRE* |
Ga0157498_10227591 | 3300012666 | Freshwater, Surface Ice | AALREQIGLLALDKAMLTARVGDLERELKEKNDRE* |
Ga0164293_101305162 | 3300013004 | Freshwater | MDNTTELDINVVIAALREQIGLLALDKAMLTARIGDLEKALKEKNDRE* |
Ga0164293_107986952 | 3300013004 | Freshwater | MNNNTELDINVVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE* |
Ga0164292_102045843 | 3300013005 | Freshwater | VVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE* |
Ga0177922_103760751 | 3300013372 | Freshwater | TQICQSYSSNGSNKGEQMDNKTELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE* |
Ga0177922_108106183 | 3300013372 | Freshwater | MDSKTELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKND |
Ga0177922_111770351 | 3300013372 | Freshwater | MDDATELDINVVIAVLREQIGLLALDKAMLTARVG |
Ga0181358_12087832 | 3300017774 | Freshwater Lake | MDNNTELDINVVIAALREQIGLLALDKAMLAARVGDLERELKEKNDRE |
Ga0181346_12135941 | 3300017780 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKN |
Ga0181361_1093102 | 3300019783 | Freshwater Lake | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLERELKEKNDRE |
Ga0181359_10348483 | 3300019784 | Freshwater Lake | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLERELKEQNDRE |
Ga0181359_11260313 | 3300019784 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE |
Ga0181359_11593003 | 3300019784 | Freshwater Lake | MDNTTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE |
Ga0181359_12006881 | 3300019784 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDL |
Ga0181359_12465441 | 3300019784 | Freshwater Lake | MDSTELDINIIIASLKDQIGLLSLDKAMLTAKVADLQSKIK |
Ga0211734_1121219015 | 3300020159 | Freshwater | MDNNTELDINVVVSALREQIGLLALEKAMLTARVGDLEAKLKEKNDCE |
Ga0211729_114136503 | 3300020172 | Freshwater | MDNKTELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE |
Ga0211731_1089729414 | 3300020205 | Freshwater | MDNTTELDINVVIAALREQIGLLALDKAMLTARIGDLEKALKEKNDRE |
Ga0208050_10074545 | 3300020498 | Freshwater | MDNSTELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
Ga0208232_10117723 | 3300020527 | Freshwater | MQMDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
Ga0181354_11885552 | 3300022190 | Freshwater Lake | MHNNTELDINVVIAALREQIGLLALDKAMLTARVGDLERELKEKNDRE |
Ga0181351_10051283 | 3300022407 | Freshwater Lake | MKENTELNINLVIASLREQIGLLALDKAMLTARLQELETEKSTTN |
Ga0181351_12465933 | 3300022407 | Freshwater Lake | MDNTTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCEXLGCTYT |
Ga0214917_100219807 | 3300022752 | Freshwater | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALKEKNDRE |
Ga0214921_104073071 | 3300023174 | Freshwater | THVSKHSRGMQMDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEIKLKEKNDCE |
Ga0209414_10004966 | 3300023301 | Hypersaline | MDKETELNINLVIASLRDQIGLLALDKAMLAARLAELEAKDTQGDV |
Ga0244775_100814756 | 3300024346 | Estuarine | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDCE |
Ga0208009_100003345 | 3300027114 | Deep Subsurface | MDNQTELDINVVIAVLREQIGLLALDKAMLTARIGDLETKLKEKNDCE |
Ga0208133_10624321 | 3300027631 | Estuarine | LSKGQNKGKTMDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE |
Ga0209356_10154881 | 3300027644 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEA |
Ga0208975_10675303 | 3300027659 | Freshwater Lentic | MDNATELDINVVIAALREQIGLLALDKAMLAARVGDLELKLKEKNDCE |
Ga0209769_10404791 | 3300027679 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVG |
(restricted) Ga0247836_12964253 | 3300027728 | Freshwater | MDDKTELDINIVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
Ga0209442_12787531 | 3300027732 | Freshwater Lake | GATMDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE |
Ga0209355_10860283 | 3300027744 | Freshwater Lake | MDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQ |
Ga0209355_11815851 | 3300027744 | Freshwater Lake | GTTMDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE |
Ga0209444_100282911 | 3300027756 | Freshwater Lake | TMDNKTELDINIVIAALREQIGLLALDKAMLTARVGDLEAQLKEKNDCE |
Ga0209296_100111811 | 3300027759 | Freshwater Lake | MNENTELNINLVIASLREQIGLLALDKAMLTARLQELENKESTTN |
Ga0209088_1000027638 | 3300027763 | Freshwater Lake | MDNNTELDINIVIAVLREQIGLLALDKAMLTARIGDLEAKLKEKNDCE |
Ga0209088_103007282 | 3300027763 | Freshwater Lake | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEIKLKEKNDCE |
Ga0209990_102858662 | 3300027816 | Freshwater Lake | MNESTELNINLVIASLREQIGLLALDKAMLTARLQELETEQSTTN |
Ga0209400_11966442 | 3300027963 | Freshwater Lake | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLESKLKEKNDCE |
Ga0209401_10010404 | 3300027971 | Freshwater Lake | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDRE |
Ga0209298_100106205 | 3300027973 | Freshwater Lake | MDNATELDINVVIAVLREQIGLLALDKAMLTARVGDLELKLKEKNDCE |
(restricted) Ga0247834_100328113 | 3300027977 | Freshwater | MHDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
Ga0247723_100037520 | 3300028025 | Deep Subsurface Sediment | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELESKLKEKDDRE |
Ga0247723_100120718 | 3300028025 | Deep Subsurface Sediment | MDSTTELDINVVIAALREQIGLLALDKAMLAARVGDLEAKLKEKNDCE |
Ga0247723_10431131 | 3300028025 | Deep Subsurface Sediment | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
Ga0247723_10666881 | 3300028025 | Deep Subsurface Sediment | MDAKTELDVNAVIAALREQIGLLALDKAMLTARMSDLEEKLKEKNDCE |
(restricted) Ga0247832_10629351 | 3300028557 | Freshwater | QMHDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
(restricted) Ga0247832_12724282 | 3300028557 | Freshwater | MNVSKHSRGIQMHDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKE |
Ga0315907_100463046 | 3300031758 | Freshwater | MDKETQLDINIVIAAMREQVGLLALDKAMLTARIEDLEKQLKEKES |
Ga0315907_101651941 | 3300031758 | Freshwater | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGD |
Ga0315907_102303723 | 3300031758 | Freshwater | MDSNTELDINMVIAALREQVGLFALDKAMLTARVAELEMKLKERDDRE |
Ga0315907_108548143 | 3300031758 | Freshwater | MDNTTELDINVVIAVLREQIGLLALDKAMLTARVGDLEAKLKEKNDCE |
Ga0315907_111760693 | 3300031758 | Freshwater | MEDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALKEKNDRE |
Ga0315909_1000716115 | 3300031857 | Freshwater | MDKETQLDINTVIAAMREQIGLLALDKAMLTARIQDLEKQLKEKES |
Ga0315909_1000726426 | 3300031857 | Freshwater | MNQTTELDINLVIASLREQIGLLALDKAMLTARLQELENTNDTTA |
Ga0315909_102883742 | 3300031857 | Freshwater | MNESTELNVNLVIASLREQIGLLALDKAMLTARLQELETEQSTTN |
Ga0315909_102919613 | 3300031857 | Freshwater | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVG |
Ga0315909_109490932 | 3300031857 | Freshwater | MNENTELNVNLVIASLREQIGLLALDKAMLTARLQELETEKSTTN |
Ga0315904_101031551 | 3300031951 | Freshwater | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALKEKN |
Ga0315904_103106302 | 3300031951 | Freshwater | MDKETQLDINIVIAAMREQIGLLALDKAMLTARIEDLEKQLKEKES |
Ga0315904_103523041 | 3300031951 | Freshwater | MDEKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALKEKNDRE |
Ga0315904_103924901 | 3300031951 | Freshwater | MNESTELNVNLVIASLREQIGLLALDKAMLTARLQE |
Ga0315904_104202211 | 3300031951 | Freshwater | MNESTELNVNLVIASLREQIGLLALDKAMLTARLQELETEKST |
Ga0315904_107659292 | 3300031951 | Freshwater | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELEMKLKERDDRE |
Ga0315904_108148123 | 3300031951 | Freshwater | WNEMNESTELNVNLVIASLREQIGLLALDKAMLTARLQELETEKSTTN |
Ga0315904_108197183 | 3300031951 | Freshwater | MDKETELDINIVIAAMREQIGLLALDKAMLVARIEDLEKQLKEKES |
Ga0315904_111482292 | 3300031951 | Freshwater | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLEKALK |
Ga0315901_103131832 | 3300031963 | Freshwater | MNESTELNVNLVIASLREQIGLLALDKAMLTARLQELETEKSTTN |
Ga0315901_104278191 | 3300031963 | Freshwater | MDNTTELDINVVIAVLREQIGLLALDKAMLTARVGDLE |
Ga0315901_104935762 | 3300031963 | Freshwater | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELEKILKERDDRE |
Ga0315906_103677291 | 3300032050 | Freshwater | MDDKTELDINVVIAVLREQIGLLALDKAMLTARVGDLEKALK |
Ga0315906_104204252 | 3300032050 | Freshwater | MDSNTELDINMVVAALREQIGLFALDKAMLTARVAELEMKLKERDDRE |
Ga0315906_111177772 | 3300032050 | Freshwater | MDSNTQLDINMVVAALREQIGLFALDKAMLTARVAELESKLKERDDRE |
Ga0315903_102239543 | 3300032116 | Freshwater | MDNNTELDINVVIAALREQIGLLALDKAMLTARVGDLEKALKEKNDRE |
Ga0315903_109063663 | 3300032116 | Freshwater | MNESTELNINLVIASLREQIGLLALDKAMLTARLQELEIEQSTTN |
Ga0334996_0231388_2_139 | 3300033994 | Freshwater | ATELDINVVIAVLREQIGLLALDKAMLTARVGDLEMKLKEKNDRE |
Ga0335021_0001099_4673_4819 | 3300034023 | Freshwater | MNNNTELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE |
Ga0334995_0012230_1680_1826 | 3300034062 | Freshwater | MDDATELDINVVIAVLREQIGLLALDKAMLTARVGDLEMKLKEKNDRE |
Ga0334995_0012270_3_131 | 3300034062 | Freshwater | MDNTTELDINVVIAALREQIGLLALDKAMLTARIGDLEKALKE |
Ga0334995_0687495_253_390 | 3300034062 | Freshwater | MKETTQLDINLVIASLREQIGLLALDKAMLTARLQELEKTNDTTE |
Ga0335019_0477002_417_563 | 3300034066 | Freshwater | MNKDTELDINVVIAVLREQIGLLALDKAMLTARVGDLEMKLKEKNDRE |
Ga0335028_0733098_98_244 | 3300034071 | Freshwater | MDSTTELDINVVIAALREQIGLLALDKAMLVARVGDLEAKLKEKNDCE |
Ga0335020_0031082_1815_1952 | 3300034082 | Freshwater | MKENTELNINLVIASLREQIGVLALDKAMLTARVQELETETSTTN |
Ga0335012_0596951_378_509 | 3300034093 | Freshwater | ELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE |
Ga0335027_0025056_1720_1860 | 3300034101 | Freshwater | MDKETQLDINVVIGAMREQIGLLALDKAMLTARIEDLEKQLKEKES |
Ga0335036_0004464_8856_9002 | 3300034106 | Freshwater | MDNNTELDINVVIAALREQIGLLALDKAMLTARIGDLEKALKEKNDRE |
Ga0335036_0016910_1479_1625 | 3300034106 | Freshwater | MDNNTQLDINVVVAALREQIGLLALDKAMLTARLTELETKLKERDDRE |
Ga0335068_0137565_224_370 | 3300034116 | Freshwater | MDNNTELDINIVIAALREQIGLLALDKAMLTARIGDLEAELKEKNDRE |
⦗Top⦘ |