NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F048252

Metagenome / Metatranscriptome Family F048252

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F048252
Family Type Metagenome / Metatranscriptome
Number of Sequences 148
Average Sequence Length 40 residues
Representative Sequence MMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKD
Number of Associated Samples 119
Number of Associated Scaffolds 148

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 98.65 %
% of genes near scaffold ends (potentially truncated) 96.62 %
% of genes from short scaffolds (< 2000 bps) 91.89 %
Associated GOLD sequencing projects 112
AlphaFold2 3D model prediction Yes
3D model pTM-score0.65

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (54.730 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine
(19.595 % of family members)
Environment Ontology (ENVO) Unclassified
(42.568 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(58.108 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.65
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 148 Family Scaffolds
PF02945Endonuclease_7 0.68



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.95 %
UnclassifiedrootN/A29.05 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2035265000|ErSWdraf_F5BXKTZ02HCB3SAll Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300000929|NpDRAFT_10053611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4032792Open in IMG/M
3300001839|RCM40_1060075All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage652Open in IMG/M
3300001850|RCM37_1027347All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage504Open in IMG/M
3300002161|JGI24766J26685_10103782Not Available604Open in IMG/M
3300002835|B570J40625_101541725All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
3300004112|Ga0065166_10428206Not Available555Open in IMG/M
3300004124|Ga0066178_10121622All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage722Open in IMG/M
3300004124|Ga0066178_10163691Not Available630Open in IMG/M
3300005525|Ga0068877_10381714All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage798Open in IMG/M
3300005527|Ga0068876_10779396Not Available506Open in IMG/M
3300005585|Ga0049084_10145103All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage831Open in IMG/M
3300005662|Ga0078894_10187059All Organisms → Viruses → Predicted Viral1872Open in IMG/M
3300005662|Ga0078894_11577002All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage542Open in IMG/M
3300005662|Ga0078894_11595930Not Available538Open in IMG/M
3300005662|Ga0078894_11733636All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300006641|Ga0075471_10329371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage774Open in IMG/M
3300006917|Ga0075472_10281754Not Available819Open in IMG/M
3300006917|Ga0075472_10712858Not Available506Open in IMG/M
3300007162|Ga0079300_10036321All Organisms → Viruses → Predicted Viral1647Open in IMG/M
3300007538|Ga0099851_1105025Not Available1074Open in IMG/M
3300007546|Ga0102874_1165526All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage684Open in IMG/M
3300007546|Ga0102874_1252068All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage534Open in IMG/M
3300007553|Ga0102819_1072386All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage582Open in IMG/M
3300007555|Ga0102817_1043301All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage987Open in IMG/M
3300007560|Ga0102913_1110458All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage890Open in IMG/M
3300007585|Ga0102916_1174997All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage581Open in IMG/M
3300007600|Ga0102920_1024076All Organisms → Viruses → Predicted Viral1842Open in IMG/M
3300007624|Ga0102878_1152582All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage671Open in IMG/M
3300007627|Ga0102869_1111943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage742Open in IMG/M
3300007630|Ga0102903_1204566All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage536Open in IMG/M
3300007632|Ga0102894_1210123All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
3300007637|Ga0102906_1128086All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300007649|Ga0102912_1039842All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1370Open in IMG/M
3300007651|Ga0102900_1030903All Organisms → Viruses → Predicted Viral1118Open in IMG/M
3300007665|Ga0102908_1129756All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage519Open in IMG/M
3300007670|Ga0102862_1040244All Organisms → Viruses → Predicted Viral1122Open in IMG/M
3300008107|Ga0114340_1024723All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage7373Open in IMG/M
3300008107|Ga0114340_1045875All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1935Open in IMG/M
3300008107|Ga0114340_1157024All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage829Open in IMG/M
3300008110|Ga0114343_1226013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage520Open in IMG/M
3300008113|Ga0114346_1235712All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage696Open in IMG/M
3300008116|Ga0114350_1025460All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3582Open in IMG/M
3300008116|Ga0114350_1143479All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage679Open in IMG/M
3300008116|Ga0114350_1159540All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage614Open in IMG/M
3300008117|Ga0114351_1318863All Organisms → Viruses → Predicted Viral1200Open in IMG/M
3300008120|Ga0114355_1220968Not Available586Open in IMG/M
3300008261|Ga0114336_1189111All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage875Open in IMG/M
3300008262|Ga0114337_1031862All Organisms → Viruses → Predicted Viral3001Open in IMG/M
3300008262|Ga0114337_1226125Not Available738Open in IMG/M
3300008962|Ga0104242_1058751All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage645Open in IMG/M
3300009049|Ga0102911_1147278Not Available668Open in IMG/M
3300009059|Ga0102830_1175707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage627Open in IMG/M
3300009079|Ga0102814_10174735All Organisms → Viruses → Predicted Viral1172Open in IMG/M
3300009080|Ga0102815_10656166All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage591Open in IMG/M
3300009152|Ga0114980_10048830Not Available2570Open in IMG/M
3300009158|Ga0114977_10584741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage604Open in IMG/M
3300009183|Ga0114974_10564872All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage631Open in IMG/M
3300009419|Ga0114982_1038419All Organisms → Viruses → Predicted Viral1535Open in IMG/M
3300010354|Ga0129333_10118151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA1022444Open in IMG/M
3300010354|Ga0129333_10755392Not Available832Open in IMG/M
3300010354|Ga0129333_11412140Not Available572Open in IMG/M
3300010885|Ga0133913_11921320All Organisms → Viruses → Predicted Viral1474Open in IMG/M
3300010885|Ga0133913_11962768All Organisms → Viruses → Predicted Viral1456Open in IMG/M
3300011011|Ga0139556_1032525Not Available765Open in IMG/M
3300011011|Ga0139556_1038592All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage703Open in IMG/M
3300012006|Ga0119955_1059792Not Available1158Open in IMG/M
3300012779|Ga0138284_1060432All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage848Open in IMG/M
3300013005|Ga0164292_10656666Not Available673Open in IMG/M
3300013092|Ga0163199_1127929All Organisms → Viruses → Predicted Viral1043Open in IMG/M
(restricted) 3300013126|Ga0172367_10150480Not Available1538Open in IMG/M
(restricted) 3300013126|Ga0172367_10588419Not Available599Open in IMG/M
(restricted) 3300013131|Ga0172373_10476141Not Available764Open in IMG/M
3300013372|Ga0177922_10838235All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage829Open in IMG/M
3300013372|Ga0177922_10991146Not Available641Open in IMG/M
(restricted) 3300014720|Ga0172376_10678005Not Available559Open in IMG/M
3300014819|Ga0119954_1018333All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4031439Open in IMG/M
3300017774|Ga0181358_1104725Not Available1010Open in IMG/M
3300017785|Ga0181355_1208299Not Available765Open in IMG/M
3300019784|Ga0181359_1260262Not Available521Open in IMG/M
3300020161|Ga0211726_10545114Not Available745Open in IMG/M
3300020161|Ga0211726_11021858Not Available719Open in IMG/M
3300020190|Ga0194118_10560063Not Available532Open in IMG/M
3300020205|Ga0211731_11482374Not Available605Open in IMG/M
3300020549|Ga0207942_1022694All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage799Open in IMG/M
3300020553|Ga0208855_1031656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage735Open in IMG/M
3300020554|Ga0208599_1020552All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1064Open in IMG/M
3300020569|Ga0208229_1053732Not Available570Open in IMG/M
3300021961|Ga0222714_10478607Not Available643Open in IMG/M
3300021962|Ga0222713_10032004All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Gaiavirus → Mycobacterium virus Gaia4227Open in IMG/M
3300021962|Ga0222713_10037868All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3801Open in IMG/M
3300021962|Ga0222713_10074056All Organisms → Viruses → Predicted Viral2506Open in IMG/M
3300021962|Ga0222713_10390348All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage859Open in IMG/M
3300022198|Ga0196905_1026857All Organisms → Viruses → Predicted Viral1757Open in IMG/M
3300023179|Ga0214923_10581682All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage533Open in IMG/M
3300024289|Ga0255147_1086852Not Available581Open in IMG/M
3300024346|Ga0244775_11540096All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300024348|Ga0244776_10647859All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage659Open in IMG/M
3300024348|Ga0244776_10706515All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage622Open in IMG/M
3300024352|Ga0255142_1003773All Organisms → Viruses → Predicted Viral2631Open in IMG/M
3300024352|Ga0255142_1040689All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage723Open in IMG/M
3300024480|Ga0255223_1016973All Organisms → Viruses → Predicted Viral1171Open in IMG/M
3300024570|Ga0255276_1193690All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage524Open in IMG/M
3300024571|Ga0256302_1122036All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage613Open in IMG/M
3300024865|Ga0256340_1029718All Organisms → Viruses → Predicted Viral1388Open in IMG/M
3300025585|Ga0208546_1102736Not Available639Open in IMG/M
3300026478|Ga0255156_1088169Not Available547Open in IMG/M
3300027121|Ga0255074_1027452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage710Open in IMG/M
3300027142|Ga0255065_1059757All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage669Open in IMG/M
3300027212|Ga0208554_1067595Not Available554Open in IMG/M
3300027223|Ga0208169_1010630All Organisms → Viruses → Predicted Viral1809Open in IMG/M
3300027231|Ga0208172_1017768All Organisms → Viruses → Predicted Viral1399Open in IMG/M
3300027244|Ga0208173_1018822All Organisms → Viruses → Predicted Viral1365Open in IMG/M
3300027247|Ga0208679_1017008All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1521Open in IMG/M
3300027258|Ga0208558_1051218All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300027418|Ga0208022_1011727All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2113Open in IMG/M
3300027621|Ga0208951_1046548Not Available1275Open in IMG/M
3300027621|Ga0208951_1082844All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage893Open in IMG/M
3300027627|Ga0208942_1115959Not Available748Open in IMG/M
3300027644|Ga0209356_1199947All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage539Open in IMG/M
3300027649|Ga0208960_1176326All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage511Open in IMG/M
3300027759|Ga0209296_1166919All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage973Open in IMG/M
3300027769|Ga0209770_10040913All Organisms → Viruses → Predicted Viral1992Open in IMG/M
3300027772|Ga0209768_10358316All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage594Open in IMG/M
3300027793|Ga0209972_10388952All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage595Open in IMG/M
3300027804|Ga0209358_10406062Not Available641Open in IMG/M
3300027804|Ga0209358_10453257Not Available593Open in IMG/M
3300027805|Ga0209229_10289189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage724Open in IMG/M
3300027805|Ga0209229_10343495All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage653Open in IMG/M
3300027816|Ga0209990_10186780All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage967Open in IMG/M
3300028073|Ga0255180_1079562Not Available599Open in IMG/M
3300028103|Ga0255172_1046437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage801Open in IMG/M
3300028265|Ga0255197_1053313All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300031784|Ga0315899_10302351All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1582Open in IMG/M
3300031857|Ga0315909_10566419All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage767Open in IMG/M
3300031857|Ga0315909_10613159Not Available724Open in IMG/M
3300031857|Ga0315909_10892379All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage549Open in IMG/M
3300031963|Ga0315901_10791994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage688Open in IMG/M
3300033978|Ga0334977_0356452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage691Open in IMG/M
3300033992|Ga0334992_0304409Not Available746Open in IMG/M
3300033992|Ga0334992_0413255All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage603Open in IMG/M
3300034051|Ga0335024_0544964All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage561Open in IMG/M
3300034061|Ga0334987_0619774All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage635Open in IMG/M
3300034066|Ga0335019_0292585All Organisms → Viruses → Predicted Viral1024Open in IMG/M
3300034073|Ga0310130_0033855Not Available1565Open in IMG/M
3300034092|Ga0335010_0046912All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria → unclassified Saccharibacteria → Candidatus Saccharibacteria bacterium3138Open in IMG/M
3300034103|Ga0335030_0423496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage858Open in IMG/M
3300034107|Ga0335037_0096792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1602Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine19.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake12.84%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater10.81%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton8.78%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater8.78%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater6.76%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake4.73%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.05%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic3.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater3.38%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.38%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.70%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment2.03%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.03%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.35%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton1.35%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface1.35%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.68%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.68%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.68%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2035265000Freshwater microbial communities from Swedish Lakes - surface of Lake ErkenEnvironmentalOpen in IMG/M
3300000929Marine plume microbial communities from the Columbia River - 15 PSUEnvironmentalOpen in IMG/M
3300001839Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM40, ROCA_DNA238_2.0um_Ob_C_3bEnvironmentalOpen in IMG/M
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002161Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USAEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300004112Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300005525Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaGEnvironmentalOpen in IMG/M
3300005527Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaGEnvironmentalOpen in IMG/M
3300005585Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007162Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007546Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02EnvironmentalOpen in IMG/M
3300007553Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.689EnvironmentalOpen in IMG/M
3300007555Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555EnvironmentalOpen in IMG/M
3300007560Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02EnvironmentalOpen in IMG/M
3300007585Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007624Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02EnvironmentalOpen in IMG/M
3300007627Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02EnvironmentalOpen in IMG/M
3300007630Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02EnvironmentalOpen in IMG/M
3300007632Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3EnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007649Estuarine microbial communities from the Columbia River estuary - metaG 1560A-3EnvironmentalOpen in IMG/M
3300007651Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3EnvironmentalOpen in IMG/M
3300007665Estuarine microbial communities from the Columbia River estuary - metaG 1557A-3EnvironmentalOpen in IMG/M
3300007670Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3EnvironmentalOpen in IMG/M
3300008107Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NAEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008113Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008117Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NAEnvironmentalOpen in IMG/M
3300008120Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NAEnvironmentalOpen in IMG/M
3300008261Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NAEnvironmentalOpen in IMG/M
3300008262Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NAEnvironmentalOpen in IMG/M
3300008962Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5EnvironmentalOpen in IMG/M
3300009049Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009079Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009152Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaGEnvironmentalOpen in IMG/M
3300009158Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011011Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1mEnvironmentalOpen in IMG/M
3300012006Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101BEnvironmentalOpen in IMG/M
3300012779Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013005Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaGEnvironmentalOpen in IMG/M
3300013092Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_150mEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013131 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300014819Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011AEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020161Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1EnvironmentalOpen in IMG/M
3300020190Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surfaceEnvironmentalOpen in IMG/M
3300020205Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1EnvironmentalOpen in IMG/M
3300020549Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020553Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020554Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020569Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022198Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300024289Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8hEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
33000243480.2um to 3um size fraction coassemblyEnvironmentalOpen in IMG/M
3300024352Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0hEnvironmentalOpen in IMG/M
3300024480Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024570Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024865Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025585Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026478Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8hEnvironmentalOpen in IMG/M
3300027121Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8hEnvironmentalOpen in IMG/M
3300027142Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300027212Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027223Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027231Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027244Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027247Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027258Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027418Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027627Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027649Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027759Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027793Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027804Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027816Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028073Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8dEnvironmentalOpen in IMG/M
3300028103Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8dEnvironmentalOpen in IMG/M
3300028265Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8hEnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031963Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116EnvironmentalOpen in IMG/M
3300033978Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002EnvironmentalOpen in IMG/M
3300033992Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035EnvironmentalOpen in IMG/M
3300034051Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034066Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034103Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119EnvironmentalOpen in IMG/M
3300034107Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Apr2017-rr0133EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ErSWdraft_141212502035265000FreshwaterMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAENVCER
NpDRAFT_1005361153300000929Freshwater And MarineMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEM
RCM40_106007513300001839Marine PlanktonMMTRKDYIATAEILKYASTKTHPAVFSKMVVDFAVMFA
RCM37_102734713300001850Marine PlanktonMMTRKDYIATAEILKYASDKTHPALFSKMVLDFAVMFAKDNP
JGI24766J26685_1010378213300002161Freshwater And SedimentMMTRKDYIATAEILKYVSDKTHPAVFSKMVVDFAEMFAKDN
B570J40625_10154172533300002835FreshwaterMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVDN
Ga0065166_1042820633300004112Freshwater LakeMMTRKDYVAVAEILKYASNKTHPAVFSKMVNDFAEMFAKDNERFD
Ga0066178_1012162243300004124Freshwater LakeMMTRKDYVATAEILKYASNKTHPALFSKIVNDFAEMFAKDN
Ga0066178_1016369113300004124Freshwater LakeMMTRKDYIATAEIMKYISDKIHPAVFSKTVHDFAEMFAKDNE
Ga0068877_1038171443300005525Freshwater LakeMMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEMFAKDN
Ga0068876_1077939613300005527Freshwater LakeMMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAKD
Ga0049084_1014510313300005585Freshwater LenticMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMF
Ga0078894_1018705993300005662Freshwater LakeMMTRKDYIATAEILKYVSNKTHPAVFSKMVNDFAEMFAKDNE
Ga0078894_1157700213300005662Freshwater LakeMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNDRF
Ga0078894_1159593043300005662Freshwater LakeMMTRKDYIATAEILKYASNKTHPALFSKMVNDFAQMFAV
Ga0078894_1173363613300005662Freshwater LakeMMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAK
Ga0075471_1032937113300006641AqueousMMTRKDYIATAEILKYVSDKTHPAVFSKMVVDFAEMF
Ga0075472_1028175413300006917AqueousMMTRKDYVATAEILRYVSDKTHPAIFSKMVVDFALMFAKDNPKFDAN
Ga0075472_1071285843300006917AqueousMTRKDYVATAEILRYASDKTHPALFSKMVVDFALM
Ga0079300_1003632113300007162Deep SubsurfaceMMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFAKDNE
Ga0099851_110502543300007538AqueousMMTRKDYIKTAEILKYVSDKTHPAVFSKMVNDFAE
Ga0102874_116552613300007546EstuarineMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMF
Ga0102874_125206833300007546EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAVDN
Ga0102819_107238633300007553EstuarineMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAE
Ga0102817_104330133300007555EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAVDNERFDVK
Ga0102913_111045843300007560EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAE
Ga0102916_117499743300007585EstuarineMMTRKDYVATAEILKFASDKTHPALFSKIVNDFAEMFAKDNER
Ga0102920_102407673300007600EstuarineMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVD
Ga0102878_115258213300007624EstuarineMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNERFD
Ga0102869_111194333300007627EstuarineMMTRKDYVATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERF
Ga0102903_120456613300007630EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAVDNERFDVKR
Ga0102894_121012313300007632EstuarineMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVDNPR
Ga0102906_112808643300007637EstuarineMTMTRKHFEAIAEILNYNSNKTHPAVFSKMVLDFAE
Ga0102912_103984213300007649EstuarineMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAKDNERFDVN
Ga0102900_103090373300007651EstuarineMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKD
Ga0102908_112975613300007665EstuarineMMTRKDYVATAEILKYASDKTHPVLFSKIVNDFAQMFAVDN
Ga0102862_104024413300007670EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAKDN
Ga0114340_102472313300008107Freshwater, PlanktonMMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMF
Ga0114340_104587583300008107Freshwater, PlanktonMMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFA
Ga0114340_115702463300008107Freshwater, PlanktonMMTRKDYVATAEILNYLSNKVHPAVFSKTVHDFAEMFAKDN
Ga0114343_122601313300008110Freshwater, PlanktonMMTRKDYISTAEILKYASNKTHPALFSKMVNDFAEM
Ga0114346_123571253300008113Freshwater, PlanktonMMTRKDYVATAEILNYMSTKTHPAVFSKVVTDFAE
Ga0114350_102546013300008116Freshwater, PlanktonMMTRKDYIATAEILRYVSDKTHPAVFSKMVNDFAEMFAKDN
Ga0114350_114347913300008116Freshwater, PlanktonMMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFA
Ga0114350_115954043300008116Freshwater, PlanktonMMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFAK
Ga0114351_131886333300008117Freshwater, PlanktonMMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAWL*
Ga0114355_122096843300008120Freshwater, PlanktonMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNPRFDV
Ga0114336_118911113300008261Freshwater, PlanktonMMTRKDYVATAEILKYVSDKTHPAVFSKMVNDFAEMFAKDNE
Ga0114337_1031862123300008262Freshwater, PlanktonMMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEMFAKDNP
Ga0114337_122612553300008262Freshwater, PlanktonMMTRKDYVATAEILNYVSDKTHPAVFSKMVHDFAEMFAKD
Ga0104242_105875143300008962FreshwaterMTMTRKHFEAIAEILNYNANKTHPAVFSKMVLDFSELCAKE
Ga0102911_114727853300009049EstuarineMMTRKHFEATAEILKFASDKTHPAVFSKMVNDFALIFAKENPN
Ga0102830_117570723300009059EstuarineMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNP
Ga0102814_1017473563300009079EstuarineMMTRKDYVATAEILKYVSNKTHPAVFSKMVNDFAEMFAV
Ga0102815_1065616643300009080EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAK
Ga0114980_1004883013300009152Freshwater LakeMTRKDYEATAEILKFMSDKVHPAVFSKVVNDFALIY
Ga0114977_1058474113300009158Freshwater LakeMMTRKDYVATAEILKYASNKTHPAVFSKIVNDFAEMFAVDNERF
Ga0114974_1056487233300009183Freshwater LakeMMTRKDYVATAEILNYVSNKTHPAVFSKMVNDFAEMFALDN
Ga0114982_103841913300009419Deep SubsurfaceMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAQMFAVD
Ga0129333_1011815113300010354Freshwater To Marine Saline GradientMMTRKDYVATAEILRYASDKTHPALFSKMVVDFALM
Ga0129333_1075539253300010354Freshwater To Marine Saline GradientMMTRKDYVATAEILRYASDKTHPALFSKMVVDFALMFAKDN
Ga0129333_1141214013300010354Freshwater To Marine Saline GradientMMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAKDN
Ga0133913_1192132013300010885Freshwater LakeMMTRKDYIATAEILKYISNKTHPAVFSKTVHDFAEMFAKDNERF
Ga0133913_1196276813300010885Freshwater LakeMMTRKDYVATAEILNYASNKTHPALFSKMVNDFAEMFAKDN
Ga0139556_103252543300011011FreshwaterMMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAKD
Ga0139556_103859253300011011FreshwaterMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFA
Ga0119955_105979263300012006FreshwaterMMTRKDYVATAEILKYLSNKTHPAVFSKTVHDFAE
Ga0138284_106043253300012779Freshwater LakeMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFAVDNE
Ga0164292_1065666643300013005FreshwaterMMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFAKDNERFDVK
Ga0163199_112792913300013092FreshwaterMMTRKDYIAVAEILNYASDKTHPALFSKIVNDFAEMFAKDNERFDITRFHK
(restricted) Ga0172367_1015048083300013126FreshwaterMKTKKDYIATAKILKYVSDKTHPAVFSKMVNDFAEMFAK
(restricted) Ga0172367_1058841943300013126FreshwaterMMTRKDYVATAEILRYVSDKTHPAVFSKMVNDFAEMFAKD
(restricted) Ga0172373_1047614143300013131FreshwaterMRKNNYWTNTAEILRYVSDKTHPAVFSKMVNDFAEMFAKDNP
Ga0177922_1083823513300013372FreshwaterMMTRKDYVAVAEILKYASDKTHPALFSKMVNDFAEMFAKDNERF
Ga0177922_1099114643300013372FreshwaterMMTRKDYIATAEILKYISNKTHPAVFSKTVHDFAEMFAKDN
(restricted) Ga0172376_1067800533300014720FreshwaterMMTRKDYVETARILAYVSDKTHPAVFSKMVNDFAEMFAKD
Ga0119954_101833343300014819FreshwaterMMTRKDYIATAEIMKYVSDKTHPALFSKVIVDFALMFAKDNPXXXXIL*
Ga0181358_110472533300017774Freshwater LakeMMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAKDNERFD
Ga0181355_120829953300017785Freshwater LakeMMTRKDYIATAEILKYVSNKTHPAVFSKMVHDFAEMFA
Ga0181359_126026233300019784Freshwater LakeMTRKDYISTAEILKYQSNKIHPAVFSKVVNDFAEMFAKDNPR
Ga0211726_1054511413300020161FreshwaterMMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMF
Ga0211726_1102185853300020161FreshwaterMMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFA
Ga0194118_1056006313300020190Freshwater LakeMMTKKHYIETAKILKYVSDKTHPAVFSKMVNDFAEMFAKDNPRFD
Ga0211731_1148237433300020205FreshwaterMMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERFD
Ga0207942_102269443300020549FreshwaterMMTRKDYVAVAEILNFASDKAHPALFSKIVNDFAVMFAKDNERFDVNRF
Ga0208855_103165613300020553FreshwaterMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFAI
Ga0208599_102055213300020554FreshwaterMMTRKDYVATAEILKYASNKTHPAVFSKMVNDFAEMFAKDNERFD
Ga0208229_105373233300020569FreshwaterMMTRKDYVAVAEILKYASTKTHPALFSKMVNDFAEMFAKDN
Ga0222714_1047860743300021961Estuarine WaterMMTRKDYVATAEILKYASDKTHPAVFSKMVNDFAEMFAKDNERFDVNR
Ga0222713_10032004163300021962Estuarine WaterMMTRKDYVATAEILKYASNKTHPALFSKIVNDFAEMFAKDNP
Ga0222713_1003786813300021962Estuarine WaterMMTRKDYVATAEILRYASDKTHPALFSKIVNDFAEMFAKDN
Ga0222713_10074056123300021962Estuarine WaterMMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAK
Ga0222713_1039034853300021962Estuarine WaterMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFAIDNER
Ga0196905_102685763300022198AqueousMMTRKDYIKTAEILKYVSDKTHPAVFSKMVNDFAEMFAKDNDRFD
Ga0214923_1058168233300023179FreshwaterMMTRKDYVATAEILKYLSNKTHPAVFSKTVHDFAEMFAKDNE
Ga0255147_108685213300024289FreshwaterMMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFAKDNPN
Ga0244775_1154009633300024346EstuarineMMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEMFAKDNERFDV
Ga0244776_1064785933300024348EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEM
Ga0244776_1070651543300024348EstuarineMMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAV
Ga0255142_1003773103300024352FreshwaterMMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFARD
Ga0255142_104068943300024352FreshwaterMMTRKDYIATAEILNYVSDKTHPAVFSKMVIDFAEMF
Ga0255223_101697313300024480FreshwaterMMTRKDYVATAEILKYASNKIHPAVFSKVVNDFAEMFAIDN
Ga0255276_119369033300024570FreshwaterMMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEM
Ga0256302_112203643300024571FreshwaterMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNPRF
Ga0256340_102971863300024865FreshwaterMMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFARDNERFDAT
Ga0208546_110273613300025585AqueousMMTRKDYVATAEILRYVSDKTHPAIFSKMVVDFAL
Ga0255156_108816913300026478FreshwaterMMTRKDYVATAEILRYVSDKTHPAVFSKMVVDFAEMFA
Ga0255074_102745243300027121FreshwaterMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNPR
Ga0255065_105975743300027142FreshwaterMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEM
Ga0208554_106759523300027212EstuarineMMTRKDYIATAEILKYVSDKIHPAVFSKTVHDFAEMFAKDNERFAV
Ga0208169_101063013300027223EstuarineMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNER
Ga0208172_101776813300027231EstuarineMMTRKDYVATAEILKFASDKTHPALFSKIVNDFAE
Ga0208173_101882213300027244EstuarineMMTRKDYVATAEILKFASDKTHPAVFSKIVNDFAEMFAKDNERFDVIRFHE
Ga0208679_101700813300027247EstuarineMMTRKDYVATAEILKFASDKTHPAVFSKIVNDFAEMFAKDNE
Ga0208558_105121843300027258EstuarineMMTRKDYVATAEILKYASDKTHPALFSKMVNDFAEMFAKDNERFDV
Ga0208022_1011727113300027418EstuarineMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEML
Ga0208951_104654813300027621Freshwater LenticMMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAKDNE
Ga0208951_108284473300027621Freshwater LenticMMTRKDYIATAEILKYASDKTHPALFSKIVNDFAE
Ga0208942_111595943300027627Freshwater LenticMMTRKDYIATAEILKYISDKTHPAVFSKTVHDFAEMFAK
Ga0209356_119994713300027644Freshwater LakeMMTRKDYVATAEILKYASNKIHPAVFSKIVNDFAEMFA
Ga0208960_117632623300027649Freshwater LenticMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFAVDNPRF
Ga0209296_116691913300027759Freshwater LakeMMTRKDYIATAEIMKYISDKSHPALFSKVIVDFALMFAKDNPKFDA
Ga0209770_1004091313300027769Freshwater LakeMMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAKDNPR
Ga0209768_1035831643300027772Freshwater LakeMMTRKDYVAVAEILNFASDKTHPAIFSKMVNDFAVMFAKDNDRF
Ga0209972_1038895243300027793Freshwater LakeMMTRKDYVATAEILKFASNKTHPAIFSKIVNDFAEMFAKDNPRF
Ga0209358_1040606243300027804Freshwater LakeMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMF
Ga0209358_1045325743300027804Freshwater LakeMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFA
Ga0209229_1028918913300027805Freshwater And SedimentMMTRKDYVSTAEILKYASDKTHPALFSKIVNDFAEMF
Ga0209229_1034349513300027805Freshwater And SedimentMMTRKDYVSTAEILKYASNKTHPALFSKMVNDFAE
Ga0209990_1018678013300027816Freshwater LakeMMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERFDVK
Ga0255180_107956233300028073FreshwaterMMTRKDYVSTAEILRYTSDKIHPAVFSKIVVDFENT
Ga0255172_104643713300028103FreshwaterMTRKDYVETAKILAYVSDKTHPAVFSKMVVDFAEMFAK
Ga0255197_105331323300028265FreshwaterMMTRKDYVATAEILKFASDKTHPALFSKMVNDFAEMFAKDNDR
Ga0315899_1030235113300031784FreshwaterMMTRKDYISTAEILKYASNKTHPALFSKMVNDFAEMFAKDNE
Ga0315909_1056641913300031857FreshwaterMMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMFAKDNERFDV
Ga0315909_1061315953300031857FreshwaterMTRKDYIATAEILKYASNKTHPALFSKMVNDFAEM
Ga0315909_1089237913300031857FreshwaterMMTRKDYIATAEILNYVSDKTHPAVFSKMVVDFAEMFAKDNP
Ga0315901_1079199433300031963FreshwaterMMTRKDYIATAEILKYASNKTHPALFSKIVNDFAEMF
Ga0334977_0356452_568_6903300033978FreshwaterMMTRKDYVAVAEILKFASDKAHPALFSKMVNDFAEMFAKDN
Ga0334992_0304409_626_7453300033992FreshwaterMTRKDYQATAEILKFMSDKVHPAVFSKVVNDFALIYAKDN
Ga0334992_0413255_469_6033300033992FreshwaterMMTRKDYVATAEILKFASDKTHPALFSKIVNDFAEMFAKDNERFD
Ga0335024_0544964_1_1143300034051FreshwaterMMTRKDYVATAEILKYASDKTHPALFSKIVNDFAEMFA
Ga0334987_0619774_1_1233300034061FreshwaterMMTRKDYIATAEILKYASTKTHPALFSKMVNDFAEMFAKDN
Ga0335019_0292585_896_10243300034066FreshwaterMMTRKDYIATAEILKYASNKTHPAVFSKIVNDFAEMFAKDNER
Ga0310130_0033855_1453_15633300034073Fracking WaterMMTRKDYVETARILAYVSDKTHPAVFSKMVNDFAEMF
Ga0335010_0046912_2_1093300034092FreshwaterMMTRKDYIATAEILKYQSNKIHPAVFSKVVNDFAEM
Ga0335030_0423496_3_1223300034103FreshwaterMMTRKDYIATAEILKYASTKTHPALFSKMVNDFAEMFAKD
Ga0335037_0096792_1_1143300034107FreshwaterMMTRKDYVAVAEILKYASDKTHPALFSKIVNDFAEMFA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.