Basic Information | |
---|---|
Family ID | F047868 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 149 |
Average Sequence Length | 46 residues |
Representative Sequence | MFAEMPLDNRTVDKFAALAACSGFLRPLETSPRAKRLIVSSRLMVL |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 149 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 82.31 % |
% of genes near scaffold ends (potentially truncated) | 16.11 % |
% of genes from short scaffolds (< 2000 bps) | 84.56 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.30 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (93.289 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (19.463 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.846 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.362 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.62% β-sheet: 0.00% Coil/Unstructured: 78.38% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 149 Family Scaffolds |
---|---|---|
PF12802 | MarR_2 | 48.99 |
PF01063 | Aminotran_4 | 11.41 |
PF00486 | Trans_reg_C | 8.05 |
PF00072 | Response_reg | 5.37 |
PF00672 | HAMP | 0.67 |
PF01609 | DDE_Tnp_1 | 0.67 |
PF14748 | P5CR_dimer | 0.67 |
PF10722 | YbjN | 0.67 |
PF13393 | tRNA-synt_His | 0.67 |
PF02518 | HATPase_c | 0.67 |
COG ID | Name | Functional Category | % Frequency in 149 Family Scaffolds |
---|---|---|---|
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 22.82 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.29 % |
Unclassified | root | N/A | 6.71 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918007|ConsensusfromContig131638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 624 | Open in IMG/M |
2170459005|F1BAP7Q02G5CL5 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 508 | Open in IMG/M |
2170459011|GKWS7RC01D9MMC | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 523 | Open in IMG/M |
3300001086|JGI12709J13192_1003630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium elkanii | 1838 | Open in IMG/M |
3300001593|JGI12635J15846_10141897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 1660 | Open in IMG/M |
3300001661|JGI12053J15887_10380633 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300001661|JGI12053J15887_10552018 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 549 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101842197 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 506 | Open in IMG/M |
3300005172|Ga0066683_10135188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1509 | Open in IMG/M |
3300005177|Ga0066690_10347078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 1006 | Open in IMG/M |
3300005179|Ga0066684_10324854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1026 | Open in IMG/M |
3300005187|Ga0066675_10256384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1251 | Open in IMG/M |
3300005434|Ga0070709_10387281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 1041 | Open in IMG/M |
3300005439|Ga0070711_101172997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 663 | Open in IMG/M |
3300005445|Ga0070708_100575048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1062 | Open in IMG/M |
3300005446|Ga0066686_10637403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 724 | Open in IMG/M |
3300005451|Ga0066681_10065564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 2017 | Open in IMG/M |
3300005471|Ga0070698_101843677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 558 | Open in IMG/M |
3300005554|Ga0066661_10103088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1708 | Open in IMG/M |
3300005555|Ga0066692_10148888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1436 | Open in IMG/M |
3300005556|Ga0066707_10920101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 535 | Open in IMG/M |
3300005574|Ga0066694_10413730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 633 | Open in IMG/M |
3300005899|Ga0075271_10100679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 548 | Open in IMG/M |
3300006047|Ga0075024_100034839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2070 | Open in IMG/M |
3300006173|Ga0070716_100649587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 800 | Open in IMG/M |
3300006175|Ga0070712_100238564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1447 | Open in IMG/M |
3300006638|Ga0075522_10176505 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1094 | Open in IMG/M |
3300006796|Ga0066665_10182056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1618 | Open in IMG/M |
3300006797|Ga0066659_10031352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 3184 | Open in IMG/M |
3300006949|Ga0075528_10118777 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 701 | Open in IMG/M |
3300009012|Ga0066710_104253478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 535 | Open in IMG/M |
3300009029|Ga0066793_10331862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 877 | Open in IMG/M |
3300009038|Ga0099829_10163144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1786 | Open in IMG/M |
3300009088|Ga0099830_10259647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 1377 | Open in IMG/M |
3300009088|Ga0099830_10692059 | Not Available | 839 | Open in IMG/M |
3300009089|Ga0099828_10422773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1202 | Open in IMG/M |
3300009090|Ga0099827_11081030 | Not Available | 696 | Open in IMG/M |
3300009090|Ga0099827_11251875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 645 | Open in IMG/M |
3300009090|Ga0099827_11416732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 605 | Open in IMG/M |
3300010042|Ga0126314_10105372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1921 | Open in IMG/M |
3300010159|Ga0099796_10273629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 708 | Open in IMG/M |
3300010159|Ga0099796_10565951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 511 | Open in IMG/M |
3300010159|Ga0099796_10586174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 502 | Open in IMG/M |
3300010325|Ga0134064_10027623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1649 | Open in IMG/M |
3300010326|Ga0134065_10204428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 716 | Open in IMG/M |
3300010337|Ga0134062_10576540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 576 | Open in IMG/M |
3300010364|Ga0134066_10429361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 511 | Open in IMG/M |
3300011270|Ga0137391_10549492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 973 | Open in IMG/M |
3300012202|Ga0137363_10960996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 725 | Open in IMG/M |
3300012207|Ga0137381_11047508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 703 | Open in IMG/M |
3300012208|Ga0137376_10616515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 938 | Open in IMG/M |
3300012210|Ga0137378_10457943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1181 | Open in IMG/M |
3300012211|Ga0137377_10845691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 847 | Open in IMG/M |
3300012349|Ga0137387_11044496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 584 | Open in IMG/M |
3300012351|Ga0137386_10093949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2115 | Open in IMG/M |
3300012356|Ga0137371_10374459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1105 | Open in IMG/M |
3300012362|Ga0137361_10484767 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
3300012582|Ga0137358_10107611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1890 | Open in IMG/M |
3300012685|Ga0137397_10539875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 868 | Open in IMG/M |
3300012913|Ga0157298_10122396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 739 | Open in IMG/M |
3300012923|Ga0137359_11055557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 696 | Open in IMG/M |
3300012937|Ga0162653_100042183 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 689 | Open in IMG/M |
3300012955|Ga0164298_10530235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 794 | Open in IMG/M |
3300012960|Ga0164301_11248896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 599 | Open in IMG/M |
3300012961|Ga0164302_10214786 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1195 | Open in IMG/M |
3300012961|Ga0164302_10229151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1165 | Open in IMG/M |
3300012964|Ga0153916_10115628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2566 | Open in IMG/M |
3300012977|Ga0134087_10040305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 1805 | Open in IMG/M |
3300014490|Ga0182010_10057345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1870 | Open in IMG/M |
3300014502|Ga0182021_11487044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 816 | Open in IMG/M |
3300014502|Ga0182021_11532142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 803 | Open in IMG/M |
3300015077|Ga0173483_10863126 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 529 | Open in IMG/M |
3300015194|Ga0167666_1093791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 645 | Open in IMG/M |
3300015242|Ga0137412_11022719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 590 | Open in IMG/M |
3300015358|Ga0134089_10144579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 935 | Open in IMG/M |
3300017657|Ga0134074_1230476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 662 | Open in IMG/M |
3300018027|Ga0184605_10111696 | Not Available | 1212 | Open in IMG/M |
3300018028|Ga0184608_10128250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1081 | Open in IMG/M |
3300018061|Ga0184619_10054855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1740 | Open in IMG/M |
3300018433|Ga0066667_10038919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2761 | Open in IMG/M |
3300018468|Ga0066662_10199516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1580 | Open in IMG/M |
3300018469|Ga0190270_11191820 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 799 | Open in IMG/M |
3300018482|Ga0066669_10024469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 3451 | Open in IMG/M |
3300019889|Ga0193743_1046249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1925 | Open in IMG/M |
3300020140|Ga0179590_1163493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 610 | Open in IMG/M |
3300021170|Ga0210400_11103349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 642 | Open in IMG/M |
3300021178|Ga0210408_10033608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 4046 | Open in IMG/M |
3300021180|Ga0210396_11264413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 615 | Open in IMG/M |
3300021413|Ga0193750_1012131 | Not Available | 2160 | Open in IMG/M |
3300021559|Ga0210409_11212201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 630 | Open in IMG/M |
3300021858|Ga0213852_1194033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1220 | Open in IMG/M |
3300024347|Ga0179591_1025670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2265 | Open in IMG/M |
3300025495|Ga0207932_1021946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1718 | Open in IMG/M |
3300025533|Ga0208584_1025060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1610 | Open in IMG/M |
3300025725|Ga0209638_1024501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2801 | Open in IMG/M |
3300025888|Ga0209540_10106841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1712 | Open in IMG/M |
3300025891|Ga0209585_10099449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1101 | Open in IMG/M |
3300025891|Ga0209585_10210809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Enhydrobacter → Enhydrobacter aerosaccus | 763 | Open in IMG/M |
3300025915|Ga0207693_10353074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1150 | Open in IMG/M |
3300026222|Ga0209862_1049521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 760 | Open in IMG/M |
3300026277|Ga0209350_1046598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1262 | Open in IMG/M |
3300026285|Ga0209438_1048266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1405 | Open in IMG/M |
3300026285|Ga0209438_1135943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 657 | Open in IMG/M |
3300026285|Ga0209438_1146880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 622 | Open in IMG/M |
3300026304|Ga0209240_1036164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1877 | Open in IMG/M |
3300026310|Ga0209239_1032418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2474 | Open in IMG/M |
3300026325|Ga0209152_10143398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 909 | Open in IMG/M |
3300026330|Ga0209473_1095525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1244 | Open in IMG/M |
3300026335|Ga0209804_1266335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 613 | Open in IMG/M |
3300026523|Ga0209808_1055668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1784 | Open in IMG/M |
3300026532|Ga0209160_1194001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 801 | Open in IMG/M |
3300026538|Ga0209056_10258796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1232 | Open in IMG/M |
3300026547|Ga0209156_10156533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD0069 | 1103 | Open in IMG/M |
3300026551|Ga0209648_10033926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4447 | Open in IMG/M |
3300027388|Ga0208995_1031717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 925 | Open in IMG/M |
3300027562|Ga0209735_1014493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1563 | Open in IMG/M |
3300027645|Ga0209117_1037846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1478 | Open in IMG/M |
3300027663|Ga0208990_1072289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 993 | Open in IMG/M |
3300027678|Ga0209011_1022627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2031 | Open in IMG/M |
3300027846|Ga0209180_10095372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1691 | Open in IMG/M |
3300027902|Ga0209048_10094170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2318 | Open in IMG/M |
3300027903|Ga0209488_10413940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 996 | Open in IMG/M |
3300027903|Ga0209488_11229056 | Not Available | 503 | Open in IMG/M |
3300028573|Ga0265334_10048929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1627 | Open in IMG/M |
3300028771|Ga0307320_10285616 | Not Available | 654 | Open in IMG/M |
3300028807|Ga0307305_10016582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3285 | Open in IMG/M |
3300028814|Ga0307302_10347524 | Not Available | 731 | Open in IMG/M |
3300028884|Ga0307308_10000689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 12513 | Open in IMG/M |
3300029951|Ga0311371_10235009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2668 | Open in IMG/M |
3300030294|Ga0311349_10778109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 902 | Open in IMG/M |
3300030975|Ga0099845_1513203 | Not Available | 642 | Open in IMG/M |
3300031152|Ga0307501_10017843 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1305 | Open in IMG/M |
3300031170|Ga0307498_10091911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 917 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10176325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 593 | Open in IMG/M |
3300031235|Ga0265330_10055583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1728 | Open in IMG/M |
3300031235|Ga0265330_10090586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1313 | Open in IMG/M |
3300031235|Ga0265330_10195548 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens | 855 | Open in IMG/M |
3300031242|Ga0265329_10071701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1096 | Open in IMG/M |
3300031247|Ga0265340_10004004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 8281 | Open in IMG/M |
3300031344|Ga0265316_10294857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1182 | Open in IMG/M |
3300031712|Ga0265342_10357160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium canariense | 760 | Open in IMG/M |
3300031813|Ga0316217_10131036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1105 | Open in IMG/M |
3300032180|Ga0307471_101071342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 972 | Open in IMG/M |
3300034129|Ga0370493_0008954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2878 | Open in IMG/M |
3300034129|Ga0370493_0012485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. L103C105A0 | 2484 | Open in IMG/M |
3300034195|Ga0370501_0348321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
3300034819|Ga0373958_0093815 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 696 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.75% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.38% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.71% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 5.37% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 5.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.70% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.68% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.01% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 2.01% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.01% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 1.34% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.34% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.67% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.67% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.67% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.67% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.67% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.67% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.67% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.67% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.67% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.67% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.67% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.67% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.67% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.67% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
2170459011 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 indirect Gram positive lysis 0-10cm | Environmental | Open in IMG/M |
3300001086 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005899 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_302 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006949 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021413 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c1 | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Host-Associated | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030975 | Forest soil eukaryotic communities from Alaska, USA, for a soil warming experiment in a boreal forest - Alaskan Soil AK pilot (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Host-Associated | Open in IMG/M |
3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
3300034195 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
A_all_C_02121220 | 2140918007 | Soil | MFAEMPLDNRTVEKFAAVVATSGFLRPFETSPREKRLNVSSRLTVL |
E41_09892270 | 2170459005 | Grass Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLETSLRAKRLIVSSRLMVL |
F64_01497080 | 2170459011 | Grass Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLETSPRAKRLIVSSRLMVL |
JGI12709J13192_10036302 | 3300001086 | Forest Soil | MFADMPLDNRTVGKFAALAATFGFFRPMETSPQTKRPNVSSRLIVL* |
JGI12635J15846_101418971 | 3300001593 | Forest Soil | MFAEMPLDNRTVNKFAALAACFGFLRPLETSPRAKRPIVSLRLIVL* |
JGI12053J15887_103806332 | 3300001661 | Forest Soil | MFAEMPLDNRTVAKFAALTACLGFLKPSETAPRRKRPIISSRVLIL* |
JGI12053J15887_105520181 | 3300001661 | Forest Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEMSPRAKRPIVSLRLIVL* |
JGIcombinedJ26739_1018421971 | 3300002245 | Forest Soil | RKSSMFADMPLDNRTVGKFAALAATFGFFRPLETSPQTKRPNVSSRLIVL* |
Ga0066683_101351881 | 3300005172 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRSKRLIVSSRLMVL* |
Ga0066690_103470782 | 3300005177 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRAKRLIVSSRLMVL* |
Ga0066684_103248542 | 3300005179 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRTKRLIVSSRPMIL* |
Ga0066675_102563843 | 3300005187 | Soil | MFAEMPLDNRTVAKFAALTACLGFLKPPETAPRPERPIISSRARVL* |
Ga0070709_103872811 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MFVEMPLDNRTVDKFAAQAAISGFFRPIETSPPTARLNVSSELIVL* |
Ga0070711_1011729972 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAEMPLDNRTVDKFAALAACLGFLWPLATSPRAKRLIVSPRVMVL* |
Ga0070708_1005750482 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAEMPLDNRTVDKFAALAACFGFLRPLETPPRAKRLIVSPRLMVL* |
Ga0066686_106374032 | 3300005446 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSSRARRPIISPRLMVL* |
Ga0066681_100655642 | 3300005451 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRSKRLIISSRPMVL* |
Ga0070698_1018436771 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAEMPLDNRTVDKFAALAACFGFLRPLETSPRAKRLIVSSRLLVL* |
Ga0066661_101030881 | 3300005554 | Soil | MFAEMPLDNRTVAGFAALAACFGFLRPLETSPPTERPKISSRLIVL* |
Ga0066692_101488883 | 3300005555 | Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLETSPRAKRLIVSSRLMVL* |
Ga0066707_109201011 | 3300005556 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRAKRPIISPWLMVL* |
Ga0066694_104137301 | 3300005574 | Soil | DNRTVDKFAALAACCGFLRPFETSLRTKRLIVSSRLMVL* |
Ga0070762_108108312 | 3300005602 | Soil | DNRTVNKFAAYAAISGLSHPFETLPKTKRSNISS* |
Ga0075271_101006791 | 3300005899 | Rice Paddy Soil | MFVEMPLDNRTVDKFAALAAISGFFRPLETSPRTKRLIVSSWMIVL* |
Ga0075024_1000348394 | 3300006047 | Watersheds | MFAEMPLDNRTVNTFAAMAAISGLFRPPETSPPARRLNVSSGLIVL* |
Ga0070716_1006495872 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MFADMPLDNRTVDKFAAPAAPVGLVGPPEISPRPARLKISPRLIVL* |
Ga0070712_1002385641 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAEMPLDNRTVDKFAALAACLGFLWPLATSPRAIRLIVSPRVMVL* |
Ga0075522_101765052 | 3300006638 | Arctic Peat Soil | MFAEMPLDNRTVNKFAALAAISGLFRPPETSPPAKRLNISPGLIVL* |
Ga0066665_101820562 | 3300006796 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRAKRLIVSSWLMVL* |
Ga0066659_100313524 | 3300006797 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRSKRLIVSSRPMIL* |
Ga0075528_101187771 | 3300006949 | Arctic Peat Soil | MFAEMPLDNRTVNKFATIAAISGLFRPPETSPPAKRLNISSGLIVL* |
Ga0066710_1042534782 | 3300009012 | Grasslands Soil | MPLDNRTVDKFAALAACCGFLRPFETSPRAKRPIISLRLMVL |
Ga0066793_103318622 | 3300009029 | Prmafrost Soil | MFADMPLDNRTVEKFAAVVATSGFLRPFKTSPREKRLNVSSRLTVL* |
Ga0099829_101631443 | 3300009038 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRVKRLIVSARLMVL* |
Ga0099830_102596472 | 3300009088 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRVKRLIVSSRLMVL* |
Ga0099830_106920592 | 3300009088 | Vadose Zone Soil | MFAEVPLDNRTVDKFAALAARFGFLRPLETSPRAKRLIVSSRLMVL* |
Ga0099828_104227732 | 3300009089 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPPAKRLIVSSRLMVL* |
Ga0099827_110810302 | 3300009090 | Vadose Zone Soil | MFAEMPLDNRTVDKFAARAACFGFLRPLDTSPRAKRLIVSSRLMVL* |
Ga0099827_112518751 | 3300009090 | Vadose Zone Soil | MFAEMPLDNRTVDQFAALAAIAGSLRPFEALPQAKRPNVSPWLAVL* |
Ga0099827_114167321 | 3300009090 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRAKRLIVSSRLMVL* |
Ga0126314_101053722 | 3300010042 | Serpentine Soil | MFAEMPLDNRTVAKFATLTACLGFLKPPETAPRPKRPIISSRAAVL* |
Ga0099796_102736291 | 3300010159 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEALPLKKRPFVSPRLMVL* |
Ga0099796_105659512 | 3300010159 | Vadose Zone Soil | MFADMPLDNRTVDQFAALAACLGLLRPLETLPLKKRPFVSLRL |
Ga0099796_105861742 | 3300010159 | Vadose Zone Soil | RKSSMFAEMPLDNRTVDKFAALAACSGFLRPLETSPRAKRLIVSPRVMVL* |
Ga0134064_100276234 | 3300010325 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLWAKRLIVSSRPMVL* |
Ga0134065_102044282 | 3300010326 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRAKRLIVSLRLMVL* |
Ga0134062_105765401 | 3300010337 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLETSPRAKRPIISPQMMVL* |
Ga0134066_104293611 | 3300010364 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRTKRPIISPQMMVL* |
Ga0137391_105494921 | 3300011270 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLETSPRAERLIVSPRLMVL* |
Ga0137363_109609962 | 3300012202 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAARFGFLRPLETSPRAKRLIVSSRLMVL* |
Ga0137381_110475082 | 3300012207 | Vadose Zone Soil | MFADMPLDNRTVDQFAALAAIAGSLRPFEALPQAKRPNVSPWLAVL* |
Ga0137376_106165152 | 3300012208 | Vadose Zone Soil | MFAEMPLDNRTVAKFATLTACLGFLKPPETRAATKRPIISSRAAVL* |
Ga0137378_104579432 | 3300012210 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPLAKRLIVSSWPMVL* |
Ga0137377_108456913 | 3300012211 | Vadose Zone Soil | AEMPLDNRTVDKFAARAACFGFLRPLETSPRAKRLIVSSRLMVL* |
Ga0137387_110444962 | 3300012349 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRAKRLIVSSWPMVL* |
Ga0137386_100939492 | 3300012351 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPLETSPRAKRLIVSSRLVVL* |
Ga0137371_103744593 | 3300012356 | Vadose Zone Soil | MFAEMPLDNRTVDQFAALAACFGFLRPLETSPRAKRLIVSSWLMVL* |
Ga0137361_104847671 | 3300012362 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACSAFLRPLETSPRAKRLIVSSRLMVL* |
Ga0137358_101076112 | 3300012582 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLEASPRAKRLIVSSRLMVL* |
Ga0137397_105398752 | 3300012685 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAAYSGFLRPLETSPRAKRLIVSSRLMVL* |
Ga0157298_101223962 | 3300012913 | Soil | MFAEMPLDNRTVDKFAALAACLPLATSPRTKRLIVSPRVMVL* |
Ga0137359_110555572 | 3300012923 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLETSPRAKRLIVSSWLMVL* |
Ga0162653_1000421832 | 3300012937 | Soil | MFAEMPLDNRTVDQFAALAAIAGSLRPWEALPQAKRRNVSPWLAVL* |
Ga0164298_105302352 | 3300012955 | Soil | MFAEMPLDNRTVDKFAALAACLGFLWPLATSPRAKRLIVSPRAMVL* |
Ga0164301_112488962 | 3300012960 | Soil | MFAEMPLDNRTVDKFAALAACLGFLWPVATSPRAKRLIVSPRVMVL* |
Ga0164302_102147861 | 3300012961 | Soil | RKSSMFAEMPLDNRTVDKFAALAACLGFLWPLATSPRAKRLIVSPRAMVL* |
Ga0164302_102291513 | 3300012961 | Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLGASPRAKRLIVSPRLMVL* |
Ga0153916_101156281 | 3300012964 | Freshwater Wetlands | MFAEMPLDNRTVDKFAAVAASFGFLRPFETSPRAKRLNVS |
Ga0134087_100403051 | 3300012977 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRTKRLIVSSRLMVL* |
Ga0182010_100573451 | 3300014490 | Fen | GHAFAEGGSPVLFADMPLDNRTVNTFAALAAISGLFRPPETSPPARRLNVSSGLIVL* |
Ga0182021_114870442 | 3300014502 | Fen | MFAEMPLDNRTVDKFAAMAAISGLFRPPETSPPARRLNVSSGLIVL* |
Ga0182021_115321422 | 3300014502 | Fen | MFAEMPLDNRTVNRFAALAATSGFIRPFETSPQTKRLNISSGIGVL* |
Ga0173483_108631261 | 3300015077 | Soil | MPLDNRTVDKFAALAACLPLATSPRTKRLIVSPRVMVL* |
Ga0167666_10937911 | 3300015194 | Glacier Forefield Soil | MFARMPLDNRTVNKFAALAATSGFIRPLATSPRTKRLNVSYGLIVL* |
Ga0137412_110227191 | 3300015242 | Vadose Zone Soil | MFADMPLDNRTVDQFAALAACLGLLRPLETLPLKKRPFVSSRLMVL* |
Ga0134089_101445792 | 3300015358 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACSGFLRPFETSPRAKRPIISPRLMVL* |
Ga0134074_12304761 | 3300017657 | Grasslands Soil | RKSSMFAEMPLDNRTVDKFAALAACCGFLRPFETSLRSKRLIISSRPMVL |
Ga0184605_101116961 | 3300018027 | Groundwater Sediment | MFAEMPLDNRTVAKFAALTACLGFLKPPETAPRPKRPIISSRARIL |
Ga0184608_101282501 | 3300018028 | Groundwater Sediment | MFAEMPLDNRTVDKFAALAACFGFLRPLEASPRAKRLIVSPRLMVL |
Ga0184619_100548553 | 3300018061 | Groundwater Sediment | MFAEMPLDNRTVAKFAALTACLGFLKPPETAPRPKRPIISSRAMVL |
Ga0066667_100389191 | 3300018433 | Grasslands Soil | MFAEMPLDNRTVDKFAVLAACCGFLRPFETSLRAKRLIVSSRLIVL |
Ga0066662_101995164 | 3300018468 | Grasslands Soil | SSMFAEMPLDNRTVDKFAVLAACCGFLRPFETSLRAKRLIVSSRLIVL |
Ga0190270_111918202 | 3300018469 | Soil | MFAEMPLDNRTVKILAAVAAASGFLRPFLTAPRTRRFNISPRLTVL |
Ga0066669_100244693 | 3300018482 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRTKRLIVSSRLMVL |
Ga0193743_10462492 | 3300019889 | Soil | MFAEMPLDNRTVDKFAAIAATSGVLRPSSPQAKRLNISSRLTVL |
Ga0179590_11634931 | 3300020140 | Vadose Zone Soil | MFAGMPLDNRTVDKFAALAACSGFLRPLEASPRAKRLIVSSRLMVL |
Ga0210400_111033492 | 3300021170 | Soil | ADMPLDNRTVNTFAALAAISGLFRPPETSFPTRRLNVSSRLIVL |
Ga0210408_100336086 | 3300021178 | Soil | MFAEMPLDNRTVDKFAAAAVISGFLWPLESSSRAKRLNVSSRLIVL |
Ga0210396_112644131 | 3300021180 | Soil | AEGGSPVLFAEMPLDNRTVNTSAALAAISGFFRPPETSPPAIRLNVSSGLIVL |
Ga0193750_10121313 | 3300021413 | Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLETSPRAKRLIVSSWLMVL |
Ga0210409_112122012 | 3300021559 | Soil | LFADMPLDNRTVNTFAALAAICGLFRPPEPSLPTRRLNVSSRLIVL |
Ga0213852_11940333 | 3300021858 | Watersheds | MFAEMPLDNRTVNTFAAMAAISGLFRPPETSPPARRLNVSSGLIVL |
Ga0179591_10256702 | 3300024347 | Vadose Zone Soil | MFAEMPLDNCTVDEFAALAACFGFLGPLETSPRAKRLIVSSQLMVL |
Ga0207932_10219462 | 3300025495 | Arctic Peat Soil | MFAEMPLDNRTVDKFAALAASFGFLRPLETSPRTKRLNISPRLIVL |
Ga0208584_10250602 | 3300025533 | Arctic Peat Soil | MFAEMPLDNRTVNKFATIAAISGLFRPPETSPPAKRLNISSGLIVL |
Ga0209638_10245013 | 3300025725 | Arctic Peat Soil | MFAEMPLDNRTVNKFAALAAISGLFRPPETSPPAKRLNISPGLIVL |
Ga0209540_101068413 | 3300025888 | Arctic Peat Soil | MFAEMPLDNRTVNKFAALAAISGLFRPPETSPPAKRLNISSGLIVL |
Ga0209585_100994492 | 3300025891 | Arctic Peat Soil | MFAEMPLDNRTVDKFAALAASFGFLRPLETSPRTKRPNISPRLIVL |
Ga0209585_102108092 | 3300025891 | Arctic Peat Soil | MFAEMPLDNRTVNKFAALAAISGLFRPPETSPPAKRLNISP |
Ga0207693_103530743 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MFAEMPLDNRTVDKFAALAACLGFLWPLATSPRAIRLIVSPRVMVL |
Ga0209862_10495212 | 3300026222 | Permafrost Soil | LFAEMPLDNRTVDKFAAVAASVGFLRPLETSPRTKRSNISSRVFVL |
Ga0209350_10465981 | 3300026277 | Grasslands Soil | SMFAEMPLDNRTVDKFAALAACCGFLRPFETSLRSKRLIVSSRLMVL |
Ga0209438_10482662 | 3300026285 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEALPLKKRPFVSSRLMVL |
Ga0209438_11359432 | 3300026285 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACFGVLRPLETSPRAKRLIVSPRMMVL |
Ga0209438_11468802 | 3300026285 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLETSPRAKRLIVSLRLMVL |
Ga0209240_10361642 | 3300026304 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACLGFLRPLEASPWAKRRLIVSSRLMVL |
Ga0209239_10324183 | 3300026310 | Grasslands Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRAKRLIVSSRLMVL |
Ga0209152_101433982 | 3300026325 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRAKRLIVSSRLIVL |
Ga0209473_10955253 | 3300026330 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRTKRLIVSSRPMIL |
Ga0209804_12663352 | 3300026335 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRAKRLIVSSRPMVL |
Ga0209808_10556681 | 3300026523 | Soil | MFAEMPLDNRTVDKFAVLAACCGFLRPFETSLRAKRLIVSSRPMVL |
Ga0209160_11940012 | 3300026532 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSLRSKRLIVSSRLMVL |
Ga0209056_102587962 | 3300026538 | Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPRTKRPIISPQMMVL |
Ga0209156_101565333 | 3300026547 | Soil | MFAEMPLDNRTVAKFAALTACLGFLKPPETAPRPERPIISSRARVL |
Ga0209648_100339262 | 3300026551 | Grasslands Soil | MFAEMPLDNRTVDKFAALAASFGFLRPPSPQAKRLNVSSRLIVL |
Ga0208995_10317172 | 3300027388 | Forest Soil | MFAEMPLDNCTVDKFAALAANLGLLRPFETSPPTKRPNISSRLIVL |
Ga0209735_10144934 | 3300027562 | Forest Soil | LFAETPLDNRTVDRFAALAATSGSLRPFEISPRTKRLNVSSRLIVL |
Ga0209117_10378463 | 3300027645 | Forest Soil | MFAEMPLDNRTVNKFAALAACFGFLRPLETSPRAKRPIVSLRLIVL |
Ga0208990_10722892 | 3300027663 | Forest Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEMSPRAKRPIVSLRLIVL |
Ga0209011_10226273 | 3300027678 | Forest Soil | MFAEMPLDNRTVDKFAALAVCFGFLRPLETLPRTQRLIVSSWLMVL |
Ga0209180_100953723 | 3300027846 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACCGFLRPFETSPPAKRLIVSSRLMVL |
Ga0209048_100941704 | 3300027902 | Freshwater Lake Sediment | MFAEMPLDNRTVDKLAAFAATSGFLRPLETSLPTKRLNVSSWLMVL |
Ga0209488_104139402 | 3300027903 | Vadose Zone Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLETSPRAERLIVSPRLMVL |
Ga0209488_112290561 | 3300027903 | Vadose Zone Soil | MFADMPLDNRTVDQFAALAACLGLLRPLETLSLTKRPFVSSRLMVL |
Ga0265334_100489294 | 3300028573 | Rhizosphere | MFAEMPLDNRTVDKFAAQAAISGFFRPPETSPPTARLNVSLELIVL |
Ga0307320_102856162 | 3300028771 | Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEASPRAKLLIVSPRLMVL |
Ga0307305_100165824 | 3300028807 | Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEASPRVKRLIVSPRLMVL |
Ga0307302_103475241 | 3300028814 | Soil | MFAEMPLDNRTVDQFAALAAIAGSLRPYEALPQAKRRNVSPWLAVL |
Ga0307308_1000068913 | 3300028884 | Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLEASPRAKRLIVSSRLMVL |
Ga0311371_102350092 | 3300029951 | Palsa | MFAEMPLDNRTVNKFAAYAAISGLSHPFETLPKTKRSNISS |
Ga0311349_107781091 | 3300030294 | Fen | ADMPLDNRTVNPFAALAASLGSLRPLATSPGTKRLNISSRLAVL |
Ga0311356_103423241 | 3300030617 | Palsa | MFAEMPLDNRTVNKFAAYAAISGLSHPFETLPKTKRS |
Ga0099845_15132031 | 3300030975 | Boreal Forest Soil | MFAEMPLDNRTVDKFAAFAASFGLLRPFETSLRTRRLNV |
Ga0307501_100178432 | 3300031152 | Soil | MFAEMPLDNRTVAKFATLTACLGFLKPPETAPRPKRPIISSRAAVL |
Ga0307498_100919112 | 3300031170 | Soil | MFAEMPLDNRTVDKFAALAACFGFLRPLATSPRAKRLIVSPRVMVL |
(restricted) Ga0255310_101763251 | 3300031197 | Sandy Soil | MFAEMPLDNRTVDKFAALAACFGFLWPLETSPRAKRLIVSLRLMVL |
Ga0265330_100555831 | 3300031235 | Rhizosphere | GHAFAEGRSPVLFADMPLDNRTVNTFAALAAISGLFRPPETSPPAKRLNVSSGLIVL |
Ga0265330_100905862 | 3300031235 | Rhizosphere | MFAEMPLDNRTVVKFAALAATSGFSGRFETSKPTRRLNVSLRLIVL |
Ga0265330_101955481 | 3300031235 | Rhizosphere | MFAEMPLDNRTVNKSAVLTATSGFIRPIETSPPAKRLKVSSRLIVL |
Ga0265329_100717012 | 3300031242 | Rhizosphere | MFAEMPLDNRTVDKFAAMAAISGLFRPPETSPPARRLNVSSGLIVL |
Ga0265340_100040044 | 3300031247 | Rhizosphere | LFADMPLDNRTVNTFAALAAISGLFRPPETSPPAKRLNVSSGLIVL |
Ga0265316_102948572 | 3300031344 | Rhizosphere | MFAEMPLDNRTVNKFAAIAAISGLFRPPETSPPAKRLNISSGLIVS |
Ga0265342_103571602 | 3300031712 | Rhizosphere | RSPVLFADMPLDNRTVNTFAALAAISGLFRPPETSPPAKRLNVSSGLIVL |
Ga0316217_101310362 | 3300031813 | Freshwater | MFAEMPLDNRTVDKFAALAATSGLFKPFPTPPRAKRLNVSPRMILL |
Ga0307471_1010713422 | 3300032180 | Hardwood Forest Soil | MFAEMPLDNRTVDKFAALAACSGFLRPLEASPRAKRLIVSSRLMVL |
Ga0370493_0008954_533_673 | 3300034129 | Untreated Peat Soil | MFADMPLDNRTVNPFAALAASVGFLRPLATSPRTKRLNISSRLTVL |
Ga0370493_0012485_1914_2054 | 3300034129 | Untreated Peat Soil | MFAETPLDNRTVDKFAGIAARVGFLRPLATSPRAKRLYISSRLIVL |
Ga0370501_0348321_20_160 | 3300034195 | Untreated Peat Soil | MFAEMPLDNRTVDKFAGIAACFGFLRPLATSLRSKRLYISSRLFVL |
Ga0373958_0093815_39_179 | 3300034819 | Rhizosphere Soil | MFAEMPLDNRTVDQFAALAARIGLLRPLETLPRAKRPFVSPRLIVL |
⦗Top⦘ |