NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047197

Metagenome / Metatranscriptome Family F047197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047197
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 40 residues
Representative Sequence EVLADERTRDVKASLSRDHELIYPPIQEFWDAAVTGTS
Number of Associated Samples 137
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.67 %
% of genes near scaffold ends (potentially truncated) 92.00 %
% of genes from short scaffolds (< 2000 bps) 91.33 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (80.667 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(21.333 % of family members)
Environment Ontology (ENVO) Unclassified
(24.667 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.91%    β-sheet: 0.00%    Coil/Unstructured: 59.09%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF01872RibD_C 7.33
PF01810LysE 5.33
PF12680SnoaL_2 4.67
PF07992Pyr_redox_2 4.67
PF00296Bac_luciferase 4.00
PF03625DUF302 4.00
PF12697Abhydrolase_6 2.67
PF07690MFS_1 2.67
PF01252Peptidase_A8 2.67
PF17032zinc_ribbon_15 2.67
PF00583Acetyltransf_1 2.67
PF06736TMEM175 2.00
PF08281Sigma70_r4_2 2.00
PF04542Sigma70_r2 2.00
PF02894GFO_IDH_MocA_C 1.33
PF12681Glyoxalase_2 1.33
PF02594DUF167 1.33
PF13565HTH_32 1.33
PF12399BCA_ABC_TP_C 1.33
PF01569PAP2 1.33
PF00496SBP_bac_5 1.33
PF12833HTH_18 1.33
PF00561Abhydrolase_1 0.67
PF00165HTH_AraC 0.67
PF04116FA_hydroxylase 0.67
PF01553Acyltransferase 0.67
PF04672Methyltransf_19 0.67
PF13460NAD_binding_10 0.67
PF02979NHase_alpha 0.67
PF13419HAD_2 0.67
PF04978DUF664 0.67
PF12146Hydrolase_4 0.67
PF01609DDE_Tnp_1 0.67
PF13302Acetyltransf_3 0.67
PF07885Ion_trans_2 0.67
PF00903Glyoxalase 0.67
PF03483B3_4 0.67
PF13426PAS_9 0.67
PF13561adh_short_C2 0.67
PF03091CutA1 0.67
PF09678Caa3_CtaG 0.67
PF00072Response_reg 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 7.33
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 7.33
COG0597Lipoprotein signal peptidaseCell wall/membrane/envelope biogenesis [M] 5.33
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 4.00
COG3439Uncharacterized conserved protein, DUF302 familyFunction unknown [S] 4.00
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 2.00
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 2.00
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 2.00
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 2.00
COG3548Uncharacterized membrane proteinFunction unknown [S] 2.00
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 1.33
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 1.33
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.67
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.67
COG5421TransposaseMobilome: prophages, transposons [X] 0.67
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.67
COG3293TransposaseMobilome: prophages, transposons [X] 0.67
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.67
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.67
COG1324Divalent cation tolerance protein CutAInorganic ion transport and metabolism [P] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms80.67 %
UnclassifiedrootN/A19.33 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001403|JGI20205J14842_1018431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia772Open in IMG/M
3300001418|JGI20188J14859_1017688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia778Open in IMG/M
3300003505|JGIcombinedJ51221_10076153All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300003505|JGIcombinedJ51221_10305065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia648Open in IMG/M
3300004080|Ga0062385_10091722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1446Open in IMG/M
3300004633|Ga0066395_10758560All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia580Open in IMG/M
3300005332|Ga0066388_101428252All Organisms → cellular organisms → Bacteria1204Open in IMG/M
3300005436|Ga0070713_100199493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1806Open in IMG/M
3300005436|Ga0070713_100344285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1382Open in IMG/M
3300005440|Ga0070705_100691753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales800Open in IMG/M
3300005445|Ga0070708_100515771All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300005546|Ga0070696_101801774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia529Open in IMG/M
3300005564|Ga0070664_100873373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia842Open in IMG/M
3300005577|Ga0068857_100772160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia916Open in IMG/M
3300005591|Ga0070761_10425243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia813Open in IMG/M
3300005614|Ga0068856_101254795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia757Open in IMG/M
3300005952|Ga0080026_10015636All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1808Open in IMG/M
3300005983|Ga0081540_1072379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1588Open in IMG/M
3300005993|Ga0080027_10340656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia600Open in IMG/M
3300006028|Ga0070717_10287378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1459Open in IMG/M
3300006176|Ga0070765_100540854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1096Open in IMG/M
3300006576|Ga0074047_11806488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300006755|Ga0079222_10570315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia854Open in IMG/M
3300006804|Ga0079221_10783253Not Available680Open in IMG/M
3300006847|Ga0075431_101091371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae763Open in IMG/M
3300006914|Ga0075436_100045524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3026Open in IMG/M
3300007982|Ga0102924_1001653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia25395Open in IMG/M
3300009148|Ga0105243_10962818All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia853Open in IMG/M
3300009176|Ga0105242_12755603Not Available542Open in IMG/M
3300009551|Ga0105238_11485256All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia706Open in IMG/M
3300010048|Ga0126373_12596234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.30565Open in IMG/M
3300010154|Ga0127503_10420701Not Available915Open in IMG/M
3300010329|Ga0134111_10404702All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia585Open in IMG/M
3300010343|Ga0074044_11147773All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300010360|Ga0126372_11640017Not Available683Open in IMG/M
3300010362|Ga0126377_12426577All Organisms → cellular organisms → Bacteria600Open in IMG/M
3300010366|Ga0126379_11134386All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia888Open in IMG/M
3300010366|Ga0126379_12545234All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia610Open in IMG/M
3300010376|Ga0126381_104975210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300010398|Ga0126383_10626173All Organisms → cellular organisms → Bacteria1149Open in IMG/M
3300010398|Ga0126383_12421619Not Available610Open in IMG/M
3300012209|Ga0137379_11755937All Organisms → cellular organisms → Bacteria → Terrabacteria group516Open in IMG/M
3300012210|Ga0137378_10086021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2871Open in IMG/M
3300012350|Ga0137372_10510862All Organisms → cellular organisms → Bacteria → Terrabacteria group893Open in IMG/M
3300012903|Ga0157289_10320739Not Available555Open in IMG/M
3300012929|Ga0137404_10791705Not Available861Open in IMG/M
3300012971|Ga0126369_10475547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1303Open in IMG/M
3300012984|Ga0164309_10823094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia749Open in IMG/M
3300013104|Ga0157370_10818929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia847Open in IMG/M
3300013307|Ga0157372_13175132All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300014169|Ga0181531_10264416Not Available1050Open in IMG/M
3300014969|Ga0157376_12446584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300016270|Ga0182036_10562284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300016294|Ga0182041_10556602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_111002Open in IMG/M
3300016341|Ga0182035_11748689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia562Open in IMG/M
3300016357|Ga0182032_12034450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia504Open in IMG/M
3300016422|Ga0182039_11053373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia731Open in IMG/M
3300016445|Ga0182038_11559352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300017657|Ga0134074_1406282Not Available506Open in IMG/M
3300017924|Ga0187820_1265975All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300017928|Ga0187806_1154789All Organisms → cellular organisms → Bacteria → Terrabacteria group758Open in IMG/M
3300017959|Ga0187779_10150273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1435Open in IMG/M
3300017974|Ga0187777_10623076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia761Open in IMG/M
3300017999|Ga0187767_10009716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1858Open in IMG/M
3300018044|Ga0187890_10679433Not Available581Open in IMG/M
3300018058|Ga0187766_10013128All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4737Open in IMG/M
3300018061|Ga0184619_10458566Not Available568Open in IMG/M
3300020581|Ga0210399_11092278Not Available639Open in IMG/M
3300021180|Ga0210396_10304463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1411Open in IMG/M
3300021181|Ga0210388_11414315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria584Open in IMG/M
3300021405|Ga0210387_10272067All Organisms → cellular organisms → Bacteria → Terrabacteria group1486Open in IMG/M
3300021406|Ga0210386_11610686Not Available538Open in IMG/M
3300021420|Ga0210394_11532712All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia563Open in IMG/M
3300021559|Ga0210409_10926873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300021560|Ga0126371_12164722Not Available671Open in IMG/M
3300022557|Ga0212123_10005099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae23749Open in IMG/M
3300022714|Ga0242671_1065536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Iamiaceae → Aquihabitans → unclassified Aquihabitans → Aquihabitans sp. G128633Open in IMG/M
3300024232|Ga0247664_1144455Not Available558Open in IMG/M
3300024254|Ga0247661_1051076All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria758Open in IMG/M
3300025457|Ga0208850_1025533Not Available1035Open in IMG/M
3300025625|Ga0208219_1014205All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2478Open in IMG/M
3300025634|Ga0208589_1108792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium649Open in IMG/M
3300025885|Ga0207653_10442917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300025906|Ga0207699_10366473Not Available1020Open in IMG/M
3300025916|Ga0207663_10097406All Organisms → cellular organisms → Bacteria1967Open in IMG/M
3300025928|Ga0207700_10213274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1633Open in IMG/M
3300025949|Ga0207667_11782624Not Available580Open in IMG/M
3300025981|Ga0207640_10239455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1401Open in IMG/M
3300027768|Ga0209772_10093865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces918Open in IMG/M
3300027895|Ga0209624_11050436All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300028773|Ga0302234_10322187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia663Open in IMG/M
3300028775|Ga0302231_10117429All Organisms → cellular organisms → Bacteria → Terrabacteria group1110Open in IMG/M
3300028789|Ga0302232_10614717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. WAC 01424534Open in IMG/M
3300028881|Ga0307277_10043811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1811Open in IMG/M
3300028906|Ga0308309_11311035Not Available622Open in IMG/M
3300029944|Ga0311352_10806505All Organisms → cellular organisms → Bacteria → Terrabacteria group733Open in IMG/M
3300029951|Ga0311371_12408773Not Available540Open in IMG/M
3300030056|Ga0302181_10425210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300030520|Ga0311372_10869323Not Available1217Open in IMG/M
3300030625|Ga0210259_11967962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae560Open in IMG/M
3300030730|Ga0307482_1096995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales801Open in IMG/M
3300030879|Ga0265765_1012141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Nitriliruptoria → Nitriliruptorales → unclassified Nitriliruptorales → Nitriliruptorales bacterium974Open in IMG/M
3300031090|Ga0265760_10329292All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300031090|Ga0265760_10338313All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales537Open in IMG/M
3300031543|Ga0318516_10212513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1118Open in IMG/M
3300031543|Ga0318516_10309064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11913Open in IMG/M
3300031564|Ga0318573_10019737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3019Open in IMG/M
3300031679|Ga0318561_10730684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium544Open in IMG/M
3300031708|Ga0310686_116151109Not Available539Open in IMG/M
3300031719|Ga0306917_10414627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1053Open in IMG/M
3300031723|Ga0318493_10796981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia532Open in IMG/M
3300031744|Ga0306918_10350887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_111144Open in IMG/M
3300031770|Ga0318521_10585735All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300031781|Ga0318547_10534100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria725Open in IMG/M
3300031795|Ga0318557_10349575All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia679Open in IMG/M
3300031819|Ga0318568_10734920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11613Open in IMG/M
3300031819|Ga0318568_10879922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia554Open in IMG/M
3300031823|Ga0307478_11021159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300031846|Ga0318512_10216049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_11940Open in IMG/M
3300031846|Ga0318512_10372103Not Available716Open in IMG/M
3300031859|Ga0318527_10138678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1016Open in IMG/M
3300031879|Ga0306919_10081346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_71_112234Open in IMG/M
3300031896|Ga0318551_10734085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300031897|Ga0318520_10907868Not Available555Open in IMG/M
3300031910|Ga0306923_12137449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300031910|Ga0306923_12402517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia523Open in IMG/M
3300031954|Ga0306926_11254114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia868Open in IMG/M
3300031954|Ga0306926_11282669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria856Open in IMG/M
3300031962|Ga0307479_10528245Not Available1163Open in IMG/M
3300031981|Ga0318531_10035682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum2061Open in IMG/M
3300032001|Ga0306922_11433097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia693Open in IMG/M
3300032044|Ga0318558_10608827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia546Open in IMG/M
3300032052|Ga0318506_10569119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia502Open in IMG/M
3300032054|Ga0318570_10194703All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia914Open in IMG/M
3300032067|Ga0318524_10161006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1138Open in IMG/M
3300032076|Ga0306924_11806928Not Available637Open in IMG/M
3300032089|Ga0318525_10333442All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium779Open in IMG/M
3300032205|Ga0307472_101964396Not Available585Open in IMG/M
3300032261|Ga0306920_103394008All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300032770|Ga0335085_10409749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1571Open in IMG/M
3300032805|Ga0335078_10027378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales8456Open in IMG/M
3300032805|Ga0335078_10078692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4805Open in IMG/M
3300032805|Ga0335078_10221538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii2606Open in IMG/M
3300032805|Ga0335078_11056447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria955Open in IMG/M
3300032828|Ga0335080_10840190Not Available946Open in IMG/M
3300032829|Ga0335070_10870057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria836Open in IMG/M
3300032892|Ga0335081_11868306All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300032893|Ga0335069_10086004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4005Open in IMG/M
3300032955|Ga0335076_11304301Not Available611Open in IMG/M
3300033158|Ga0335077_10908541All Organisms → cellular organisms → Bacteria886Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil21.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.67%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil7.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.67%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.67%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.67%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.67%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.00%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.33%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.33%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.33%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.33%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.33%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.33%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.67%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.67%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.67%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.67%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.67%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001403Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012EnvironmentalOpen in IMG/M
3300001418Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006576Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007982Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaGEnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300024254Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025634Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028773Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029944II_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030056Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3EnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030625Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO122-ANR120SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030730Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030879Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032829Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI20205J14842_101843123300001403Arctic Peat SoilVLADERTRFVKASLPRDHELIYPPVQEFWDAALKGSP*
JGI20188J14859_101768813300001418Arctic Peat SoilDERTRFVKASLPRDQELIYPPVQEFWDAALKGSP*
JGIcombinedJ51221_1007615313300003505Forest SoilVEVLADERTRSVKASLPRDHELIYPPIQELWDSAFKGAGQDRP*
JGIcombinedJ51221_1030506523300003505Forest SoilVEVLADERTRSVKASLPRDHELIYPPIQELWDSAFKGVSQDRP*
Ga0062385_1009172233300004080Bog Forest SoilVEAGQVEVLADERTRTVKASLSRDHELIYPPVQEFWDEAIKGTAP*
Ga0066395_1075856023300004633Tropical Forest SoilGQVEVLADERSRFVKQSLPRDHELIYPLIEEFWDAAVGGTG*
Ga0066388_10142825213300005332Tropical Forest SoilQFEVLADERSRFVKASLSHDHELIYPPIQEFWDAAVKGAG*
Ga0070713_10019949343300005436Corn, Switchgrass And Miscanthus RhizosphereEAGQIEVLADERSRFVKASLSRDHELIYPPVQEFWDGAISG*
Ga0070713_10034428513300005436Corn, Switchgrass And Miscanthus RhizosphereVEAGQVEVLADERTRAVKAELSRDHELIYPPIQEFWDAAVKDTP*
Ga0070705_10069175313300005440Corn, Switchgrass And Miscanthus RhizosphereDAVEAGQIEVLADQRTRDVKASLSRDHELIYPPIQEFWDAAVTGTS*
Ga0070708_10051577113300005445Corn, Switchgrass And Miscanthus RhizosphereVEAGQVEVLADERSRIIKASLARDHELIYPQVQEFWDALTRGAR*
Ga0070696_10180177423300005546Corn, Switchgrass And Miscanthus RhizosphereQVEVLADERTRTIKAQLSHDHELIYPPVQEFWDSAVAGTS*
Ga0070664_10087337313300005564Corn RhizosphereMVRLPGRVKAKLSRDHGIYPPIQEFWDAAVSGTS*
Ga0068857_10077216013300005577Corn RhizosphereLADERTRTIKAELSRDQELIYPAVQEFWDSAIQGRS*
Ga0070761_1042524323300005591SoilVLADERTRTVKASLSRDHELIYPAVQERWDEALEKSP*
Ga0068856_10125479523300005614Corn RhizosphereADERTRTVKAELSRDHELIYPPIQEFWDAAVKDTP*
Ga0080026_1001563653300005952Permafrost SoilVEAGQVEVLADDRTRQVKAALSRDHELIYPAVQDRWDAARWDAAR*
Ga0081540_107237933300005983Tabebuia Heterophylla RhizosphereVLADERTRTVKASLLRDHDLIYPPVQEFWDAAVAGTS*
Ga0080027_1034065613300005993Prmafrost SoilGQIEVLADERSRTVKASLSRDHELIYPPVQAFWDALLKGAP*
Ga0070717_1028737833300006028Corn, Switchgrass And Miscanthus RhizosphereEVLADERSRFVKASLSRDHELIYPPVQEFWDGAISG*
Ga0070765_10054085413300006176SoilVLADERTRSVKASLPRDHELIYPPIQELWDSAFKSPGEDRS*
Ga0074047_1180648813300006576SoilQIEVLADERTRTVKAELSRDHELIYPPIQEFWDAAVAGTS*
Ga0079222_1057031523300006755Agricultural SoilMVRLPGRVKAKLSRDHELIYPPIQEFWDAAVSGTS*
Ga0079221_1078325313300006804Agricultural SoilDERSRDVKAKLSRDHELIYPPIQEFWDAAVTGTGA*
Ga0075431_10109137113300006847Populus RhizosphereIEVLADERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG*
Ga0075436_10004552443300006914Populus RhizosphereADERSRFVKQSLPRDHELIYAIEEFWDAAMAGTGGGTG*
Ga0102924_100165353300007982Iron-Sulfur Acid SpringVLADERTRFVKASLPRDQELIYPPVQEFWDSAIKGTS*
Ga0105243_1096281813300009148Miscanthus RhizosphereVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS*
Ga0105242_1275560313300009176Miscanthus RhizosphereEAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS*
Ga0105238_1148525623300009551Corn RhizosphereADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS*
Ga0126373_1259623413300010048Tropical Forest SoilDAVEAGQIEVLVGERTRTVKASLSRDHELIYPPIQEFWDAAIQGSQ*
Ga0127503_1042070133300010154SoilVLADERSRFVKASLSRDHELIYPPIQEFWDAAVSGTT*
Ga0134111_1040470213300010329Grasslands SoilEAGRIEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS*
Ga0074044_1114777313300010343Bog Forest SoilEAGQVEVLADERTRTVKASLSRDHELIYPPVQEFWDEAVNGTS*
Ga0126372_1164001723300010360Tropical Forest SoilFDAVENGDIEVLADERSRFIKASLSRDHELIYPPIEEFWTAAVTGTS*
Ga0126377_1242657713300010362Tropical Forest SoilDERTRTVKASLPRDHELIYPPVQEFWDAAVAGTG*
Ga0126379_1113438613300010366Tropical Forest SoilIEVLADERSRTVKAELPRDHELIYPPVQEFWDAAVTGGS*
Ga0126379_1254523413300010366Tropical Forest SoilDERSRTVKQSLPRDHELIYPPIQEFWDAAVTGTG*
Ga0126381_10497521023300010376Tropical Forest SoilEVLADERTRTIKAQLSRDQDLIYPPLQKFWDDALEGGS*
Ga0126383_1062617333300010398Tropical Forest SoilDERTRTVKAQLSRDHELIYPPVQEFWDAAVAGTS*
Ga0126383_1242161923300010398Tropical Forest SoilMTEVLADERTRDVKASLSRDHELIYPPVQEFWDAAVTGSS*
Ga0137379_1175593723300012209Vadose Zone SoilVLADERSRFVKASLSRDHELICPPVQAFWDGALQGSR*
Ga0137378_1008602133300012210Vadose Zone SoilMLLADERTRFIKASLPRDHELIYPPIREFWTAAVTGKG*
Ga0137372_1051086223300012350Vadose Zone SoilGLIEVLADERTRTIKASLSRDHELIYPPVQEFWDAAVKGTG*
Ga0157289_1032073923300012903SoilVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS*
Ga0137404_1079170513300012929Vadose Zone SoilVEAGQVEVLADERTRTVKAQLSRDHELIYPPVQEFWDAAVGGTS*
Ga0126369_1047554733300012971Tropical Forest SoilAGQIEVLADERTRTVKAELSRDQELIYPPVQEFWDAAVKGTG*
Ga0164309_1082309413300012984SoilVLADERSRDVKAKLSRDHELIYLPIQEFWDAAVSGTS*
Ga0157370_1081892913300013104Corn RhizosphereEAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDTAVSGTS*
Ga0157372_1317513213300013307Corn RhizosphereIEVLADERSRFVKASLSRDHELIYPPVQEFWDGATGPG*
Ga0181531_1026441613300014169BogVEAGQAEVLVGERTRSIKASLSRDQELIYPSVQELWDSALKGGS*
Ga0157376_1244658423300014969Miscanthus RhizosphereEVLADERSRFVKASLSRDQELIYPPVQEFWDGAISG*
Ga0182036_1056228423300016270SoilGQVEVLADERTRTVKAELSRDQELIYPAVQKFWDDALKGGG
Ga0182041_1055660223300016294SoilAVEADQVEVLADERTRTVKASLSRDHELIYPPIQEFWDAAVQGTH
Ga0182035_1174868913300016341SoilAVERTRFVKASLPRDHELIYPPIQEFWDAAVQSTG
Ga0182032_1203445023300016357SoilVLADDRSRFVKASLSRDHELIYPDVQAFWDAAIKATG
Ga0182039_1105337313300016422SoilLTDERSRTVKASLPHDHELIYPPIQEFWDAAVGGTG
Ga0182038_1155935213300016445SoilQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVTGTS
Ga0134074_140628213300017657Grasslands SoilDLEAGQVEVLADERSRDIKAKLSRDHELIYPPIQEFWDAAVSGTS
Ga0187820_126597533300017924Freshwater SedimentQAFDAVEAGQVEVLADEQTRTVKAELSRDQELIYPPLQEFWDDAVRGTP
Ga0187806_115478913300017928Freshwater SedimentADEQTRTVKAELSRDQDLIYPPLQEFWDDAVRGTPGTPGR
Ga0187779_1015027333300017959Tropical PeatlandSVVRQALDAVEAGQVEVLADEQTRTVKAEVSRDQELIYPPLQKFWDDAPKGGS
Ga0187777_1062307633300017974Tropical PeatlandGQVEVLADERSRDVKAKLSRDQELIYPPIQEFWDAAVSGTEA
Ga0187767_1000971613300017999Tropical PeatlandEAGRIEVLADERSRTVKAELSRDHELIYPPVQEFWDAAVKGAS
Ga0187890_1067943313300018044PeatlandRRSQEADTAVEVGQIEVLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP
Ga0187766_1001312873300018058Tropical PeatlandGQVEVLADERTRTIKAQLSHDQELIYPPLQKFWDDAPKGGS
Ga0184619_1045856623300018061Groundwater SedimentVEADRIEVLADERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG
Ga0210399_1109227813300020581SoilSVAQQAFDAVEAGQIEVLADQRSRAVKANLSRDHELIYPPIQEFWDAAVSRTS
Ga0210396_1030446343300021180SoilLADERTRTVKAELSRDQELIYPAVQEFWDSALKGPS
Ga0210388_1141431533300021181SoilLAAVEAGQVEVLCDERTRTVKAELSRDQELIYPAVQEFWDSALKGTS
Ga0210387_1027206713300021405SoilEVLCDERTRTVKAELSRDQELIYPPVQKFWDDAIKGSS
Ga0210386_1161068623300021406SoilEVLADERSRFVKASLPRDQELIYPPVQKFWDSALKAHR
Ga0210394_1153271223300021420SoilTRSVKASLPRDHELIYPPIQELWDSAFKGPGQDRP
Ga0210409_1092687313300021559SoilIEVLADERTRFIKASLPRDHELIYPPVQVFWDAAVTES
Ga0126371_1216472213300021560Tropical Forest SoilRAEVLADERSRFVKDSLSRDHELIYPAVQEFWDALLKGS
Ga0212123_1000509953300022557Iron-Sulfur Acid SpringVLADERTRFVKASLPRDQELIYPPVQEFWDSAIKGTS
Ga0242671_106553613300022714SoilQIEVLADERTRTVKASLSRDHELIYPPIQEFWDEAIKGTTP
Ga0247664_114445513300024232SoilFDAVEVGQVEVLADERSRDIKAKLSRDHELIYPPIQEFWDAAVSGTPRD
Ga0247661_105107623300024254SoilQIEVLADERSRFVKASLSRDHELIYPPVQEFWDGATGSG
Ga0208850_102553323300025457Arctic Peat SoilVLADERTRFIKASLPRDQELIYPPVQEFWDAALKGAP
Ga0208219_101420543300025625Arctic Peat SoilEVLADERTRFVKASLPRDQELIYPPVQEFWDAALKGSP
Ga0208589_110879213300025634Arctic Peat SoilEAGQIEVLADERSRFVKESLSRDHELIYPPIQAFWDAAVKGTR
Ga0207653_1044291723300025885Corn, Switchgrass And Miscanthus RhizosphereEVLADERTRDVKASLSRDHELIYPPIQEFWDAAVTGTS
Ga0207699_1036647313300025906Corn, Switchgrass And Miscanthus RhizosphereADQVEVLADERTRTIKAELSRDQELIYPAVQEFWDSAIQGRS
Ga0207663_1009740643300025916Corn, Switchgrass And Miscanthus RhizosphereLADERTRTIKAQLSHDHELIYPPVQEFWDSAVAGTS
Ga0207700_1021327413300025928Corn, Switchgrass And Miscanthus RhizosphereEAGQIEVLADERSRFVKASLSRDHELIYPPVQEFWDGAISG
Ga0207667_1178262413300025949Corn RhizosphereLVDERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG
Ga0207640_1023945533300025981Corn RhizosphereVEAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTPRD
Ga0209772_1009386513300027768Bog Forest SoilVLADERTRTVKASLSRDHELIYPSIQEFWDEAIKGTMP
Ga0209624_1105043613300027895Forest SoilESVAQQTFDAVEAGEIEVLTDKRSKSIKASLSRDHELIYPPLQREFFGAPVDGSA
Ga0302234_1032218723300028773PalsaEVLVDELTRSVKSTLHRDHELIYPAVQRRYDAATQ
Ga0302231_1011742913300028775PalsaVGQIEMLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP
Ga0302232_1061471723300028789PalsaRQAFDAVEAGQAEVLVGERTRSIKASLSRDQELIYPSVQELWDSALKGGS
Ga0307277_1004381133300028881SoilGRIEVLADERSRFIKASLSHDHELIYPPVQEFWDAAVKGTG
Ga0308309_1131103513300028906SoilEVLADERSRFVKASLSRDHELIYPPIEEFWDAAVKSTD
Ga0311352_1080650523300029944PalsaDAVEVGQIEMLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP
Ga0311371_1240877313300029951PalsaEEVLVDELTRSVKSTLHRDHELIYPAVQRRYDAATQ
Ga0302181_1042521013300030056PalsaAVEAGQAEVLVGERTRSIKASLSRDQELIYPSVQELWDSAPKGGS
Ga0311372_1086932313300030520PalsaFDAVEVGQIEMLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP
Ga0210259_1196796223300030625SoilVLADERSRFAKASLSRDHELIYLTIQAFRDAALRGAS
Ga0307482_109699523300030730Hardwood Forest SoilVEVLADERTRTVKASLSRDHELIYPPVQAFWDEAVKGTS
Ga0265765_101214113300030879SoilDERTRSVKASLPRDHELIYPPIQELWDSAFEGPGRGRP
Ga0265760_1032929223300031090SoilADERTRSVKASLPRDHELIYPPIQELWDSAFKGPGRGRP
Ga0265760_1033831313300031090SoilQVEVLADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTS
Ga0318516_1021251313300031543SoilEVLADDRSRFVKASLSRDHELIYPDVQAFWDAAIKATG
Ga0318516_1030906413300031543SoilADERTRTVKASLSHDHELIYPPIQEFWDAAVQGIH
Ga0318573_1001973743300031564SoilEAGQVEVLADERTRTIKAQLSRDQDLIYPPLQKFWDDALKGGS
Ga0318561_1073068423300031679SoilIEVLADERTRTVKASLSRDQELIYPPVQEFWDSITQAH
Ga0310686_11615110913300031708SoilGQVEVLADERTRTVKANLSRDQELIYPGIQEFCDAALAARPG
Ga0306917_1041462713300031719SoilFDAVQSGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS
Ga0318493_1079698113300031723SoilAGQIEVLVDERTRTVKASLSRDHELIYPPVQEFWDAAVQGSR
Ga0306918_1035088713300031744SoilEVLADERTRTVKASLSRDHELIYPPIQEFWDAAVQGTH
Ga0318521_1058573523300031770SoilSGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS
Ga0318547_1053410023300031781SoilIEVLADERTRNVKASLSRDHELIYPPIQEFWDAAVAGAS
Ga0318557_1034957523300031795SoilVEVLTDERSRTVKASLPHDHELIYPPIQEFWDAAVGGTG
Ga0318568_1073492023300031819SoilVAKMAFDAVEAGQIEVLVGERTRTIKASLSRDHELIYPPIQEFWDAAIQGGQ
Ga0318568_1087992213300031819SoilADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTA
Ga0307478_1102115913300031823Hardwood Forest SoilESGQVEVLADQRSRYVKASLPRDHEVIYPPLQESYDSALTGGS
Ga0318512_1021604913300031846SoilEVLADERTRTVKASLSRDHELIYPPIQEFWDAAVQRSH
Ga0318512_1037210313300031846SoilAVEVGQVEVLADERTRTVKAELSRDQELIYPAVQKFWDDALKGGG
Ga0318527_1013867833300031859SoilEAGQIEVLADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTA
Ga0306919_1008134613300031879SoilGQVEVLADERSRFVKQSLPRDHELIYPPIEEFWDAAVGGTG
Ga0318551_1073408513300031896SoilQVEVLADERTRTIKAQLSRDQELIYPPLQKFWDDAVKGGS
Ga0318520_1090786823300031897SoilTRIVKSELSRDHELIYPPIEAFWDAAVSGARSAPVT
Ga0306923_1213744913300031910SoilEVGQVEVLADERTRFVKASLSRDYELIYPTVQEFWDTALKGSG
Ga0306923_1240251723300031910SoilDAVEAGQIEVLADERSRFVKGSLSRDHELIYPAIQQFWDDALAGSQ
Ga0306926_1125411423300031954SoilEAGQVEVLADERTRTVKAQLSRDHELIYPPVQEFWDAAVAGTG
Ga0306926_1128266923300031954SoilAGQVEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVTGTS
Ga0307479_1052824523300031962Hardwood Forest SoilAGQIEVLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGTP
Ga0318531_1003568213300031981SoilVLADERTRTIKAQLSRDQDLIYPPLQKFWDDALKGGS
Ga0306922_1143309713300032001SoilQIEVLADERTRNVKASLSRDHELIYPPIQEFWDAAVAGAS
Ga0318558_1060882713300032044SoilVFDAVEAGQIEVLVDERTRTVKASLSRDHELIYPPVQEFWDAAVQGSR
Ga0318506_1056911923300032052SoilEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTS
Ga0318570_1019470323300032054SoilLADERTRTVKASLSRDHELIYPPIQEFWDEAVKGTA
Ga0318524_1016100613300032067SoilEVLADERSRFVKASLSRDHELIYPDVQAFWDAAIKATG
Ga0306924_1180692813300032076SoilEVGQVEVLADERTRFVKASLSRDHELIYPTVQEFWDTALKGSG
Ga0318525_1033344213300032089SoilVEVLADERTRTIKASLPHDHELIYPQVQEFWDALTRGSG
Ga0307472_10196439613300032205Hardwood Forest SoilVLADERSRAVKAKLSRDHELIYPPIQEFWDAAVGGSG
Ga0306920_10339400813300032261SoilEAGQVEVLADERTRTIKAQLSHDQELIYPPLQKFWDDAPKGGS
Ga0335085_1040974913300032770SoilEAGQIEVLADERTRTVKASLSRDQELIYPPVQEFWDAAVTGNR
Ga0335078_10027378103300032805SoilVAQQVFDAVEAGQAEVLCDERTRTIKAELSRDQELIYPAVQKFWDDAIKGSS
Ga0335078_1007869283300032805SoilVEVLADERTRTIKAELSRDQELIYPAVQEFWDSAIQGGS
Ga0335078_1022153813300032805SoilADERTRTVKASLSRDQELIYPPVQEFWDAAVTGTP
Ga0335078_1105644733300032805SoilLADERTRTVKAQLPRDHELIYPPVQEFWDSAVSGTS
Ga0335080_1084019023300032828SoilLADERTRKVKAELSRDHELIYPPIQEFWDAAVKGTS
Ga0335070_1087005733300032829SoilEARQIEVLADERTRTVKAELSRDHELIYPPVQEFWDAAVRGAP
Ga0335081_1186830613300032892SoilRVEVLADERTRKVKAELSRDHELIYPPIQEFWDAAVKGTS
Ga0335069_1008600413300032893SoilEAGQVEVLADERSRDVKAKLSRDQELIYPPIQEFWDAAVSGTEA
Ga0335076_1130430123300032955SoilEAGQTEVLADERSRDVKAKLSRDHELIYPPIQEFWDAAVSGTPQ
Ga0335077_1090854133300033158SoilADERTRTVKAELSRDHELIYPPVQEFWDAAVGGTP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.