NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F047144

Metagenome / Metatranscriptome Family F047144

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F047144
Family Type Metagenome / Metatranscriptome
Number of Sequences 150
Average Sequence Length 47 residues
Representative Sequence AAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA
Number of Associated Samples 127
Number of Associated Scaffolds 150

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.00 %
% of genes near scaffold ends (potentially truncated) 96.67 %
% of genes from short scaffolds (< 2000 bps) 90.67 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (72.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil
(14.000 % of family members)
Environment Ontology (ENVO) Unclassified
(34.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(40.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 28.77%    β-sheet: 0.00%    Coil/Unstructured: 71.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 150 Family Scaffolds
PF04024PspC 19.33
PF04909Amidohydro_2 18.00
PF09922DUF2154 10.00
PF12796Ank_2 7.33
PF12804NTP_transf_3 2.67
PF13192Thioredoxin_3 2.67
PF02074Peptidase_M32 1.33
PF00563EAL 0.67
PF00263Secretin 0.67
PF00941FAD_binding_5 0.67
PF00069Pkinase 0.67
PF10589NADH_4Fe-4S 0.67
PF13515FUSC_2 0.67
PF00512HisKA 0.67
PF00232Glyco_hydro_1 0.67
PF07179SseB 0.67
PF13606Ank_3 0.67
PF00773RNB 0.67

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 150 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.67
COG2317Zn-dependent carboxypeptidase, M32 familyPosttranslational modification, protein turnover, chaperones [O] 1.33
COG0557Exoribonuclease RTranscription [K] 0.67
COG2200EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant)Signal transduction mechanisms [T] 0.67
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 0.67
COG3434c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domainsSignal transduction mechanisms [T] 0.67
COG4776Exoribonuclease IITranscription [K] 0.67
COG4943Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domainsSignal transduction mechanisms [T] 0.67
COG5001Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domainSignal transduction mechanisms [T] 0.67


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms72.00 %
UnclassifiedrootN/A28.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FHA1B5K04XMARZAll Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes507Open in IMG/M
2170459019|G14TP7Y02H5CNANot Available628Open in IMG/M
3300000891|JGI10214J12806_10502098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1041Open in IMG/M
3300002568|C688J35102_118249984Not Available542Open in IMG/M
3300003996|Ga0055467_10278155All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300004157|Ga0062590_102259940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300004643|Ga0062591_102328453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300004779|Ga0062380_10076804Not Available1192Open in IMG/M
3300005339|Ga0070660_100470498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1044Open in IMG/M
3300005344|Ga0070661_101582852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300005356|Ga0070674_101852255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300005364|Ga0070673_100282546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1456Open in IMG/M
3300005406|Ga0070703_10318970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300005457|Ga0070662_101761034All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium535Open in IMG/M
3300005459|Ga0068867_100957599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium774Open in IMG/M
3300005544|Ga0070686_100100180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1956Open in IMG/M
3300005549|Ga0070704_101962166Not Available543Open in IMG/M
3300005564|Ga0070664_100415552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1231Open in IMG/M
3300005564|Ga0070664_101503716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300005578|Ga0068854_100281494Not Available1339Open in IMG/M
3300005615|Ga0070702_100265440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1171Open in IMG/M
3300005617|Ga0068859_101599587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium720Open in IMG/M
3300005937|Ga0081455_10444937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium887Open in IMG/M
3300005937|Ga0081455_10748516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium618Open in IMG/M
3300006237|Ga0097621_100110010All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2328Open in IMG/M
3300007076|Ga0075435_101291426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300009032|Ga0105048_10581996All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300009098|Ga0105245_10055218All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3567Open in IMG/M
3300009148|Ga0105243_10090093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2523Open in IMG/M
3300009868|Ga0130016_10400386Not Available912Open in IMG/M
3300010362|Ga0126377_10093083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2733Open in IMG/M
3300010397|Ga0134124_10716973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium991Open in IMG/M
3300010403|Ga0134123_10570420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1081Open in IMG/M
3300011119|Ga0105246_10675216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300012491|Ga0157329_1008963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium758Open in IMG/M
3300012680|Ga0136612_10045870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2195Open in IMG/M
3300012903|Ga0157289_10048761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1066Open in IMG/M
3300012903|Ga0157289_10280874Not Available580Open in IMG/M
3300012904|Ga0157282_10180688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria667Open in IMG/M
3300012909|Ga0157290_10190490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium689Open in IMG/M
3300012910|Ga0157308_10017847Not Available1552Open in IMG/M
3300012911|Ga0157301_10407761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300012957|Ga0164303_11463026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300012985|Ga0164308_10546627Not Available977Open in IMG/M
3300013102|Ga0157371_11603172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300013297|Ga0157378_12118187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium613Open in IMG/M
3300013306|Ga0163162_10243821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1928Open in IMG/M
3300013307|Ga0157372_11101468All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300014322|Ga0075355_1217070Not Available539Open in IMG/M
3300014325|Ga0163163_12434814Not Available582Open in IMG/M
3300014326|Ga0157380_10506073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1174Open in IMG/M
3300014326|Ga0157380_11905246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium655Open in IMG/M
3300014657|Ga0181522_10632668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300014745|Ga0157377_10487528All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium859Open in IMG/M
3300014969|Ga0157376_12850353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300015077|Ga0173483_10059590All Organisms → cellular organisms → Bacteria1487Open in IMG/M
3300015200|Ga0173480_10886831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300015209|Ga0167629_1021485All Organisms → cellular organisms → Bacteria2355Open in IMG/M
3300015371|Ga0132258_11750448Not Available1567Open in IMG/M
3300015372|Ga0132256_103289998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300015372|Ga0132256_103664050Not Available517Open in IMG/M
3300018083|Ga0184628_10436594Not Available682Open in IMG/M
3300018432|Ga0190275_10341652All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1485Open in IMG/M
3300018469|Ga0190270_10116475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2089Open in IMG/M
3300020082|Ga0206353_10417289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium837Open in IMG/M
3300022226|Ga0224512_10126440All Organisms → cellular organisms → Bacteria → Terrabacteria group1375Open in IMG/M
3300022309|Ga0224510_10471672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria749Open in IMG/M
3300022737|Ga0247747_1014947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium817Open in IMG/M
3300022883|Ga0247786_1007351All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2030Open in IMG/M
3300022901|Ga0247788_1021099All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1140Open in IMG/M
3300022915|Ga0247790_10075408All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium805Open in IMG/M
3300023263|Ga0247800_1036690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium855Open in IMG/M
3300025322|Ga0209641_10057625All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei2993Open in IMG/M
3300025325|Ga0209341_10161696All Organisms → cellular organisms → Bacteria1882Open in IMG/M
3300025796|Ga0210113_1014948All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1615Open in IMG/M
3300025901|Ga0207688_11062834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300025910|Ga0207684_11318725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300025912|Ga0207707_10793687Not Available789Open in IMG/M
3300025919|Ga0207657_10346290All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1172Open in IMG/M
3300025923|Ga0207681_11692271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300025924|Ga0207694_10990747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium711Open in IMG/M
3300025926|Ga0207659_10195223All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1613Open in IMG/M
3300025926|Ga0207659_10239424All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae1467Open in IMG/M
3300025926|Ga0207659_11512325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300025932|Ga0207690_10079478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2285Open in IMG/M
3300025938|Ga0207704_10815500Not Available780Open in IMG/M
3300025940|Ga0207691_10169603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1912Open in IMG/M
3300025941|Ga0207711_10124552All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2304Open in IMG/M
3300025972|Ga0207668_10384141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1183Open in IMG/M
3300025981|Ga0207640_10982616Not Available742Open in IMG/M
3300026009|Ga0208530_1008669All Organisms → cellular organisms → Bacteria → Terrabacteria group746Open in IMG/M
3300026041|Ga0207639_11757890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300026050|Ga0208293_1005163All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium819Open in IMG/M
3300026075|Ga0207708_11580917Not Available576Open in IMG/M
3300026116|Ga0207674_10531113All Organisms → cellular organisms → Bacteria1136Open in IMG/M
3300026121|Ga0207683_10524140Not Available1095Open in IMG/M
3300026121|Ga0207683_11412022Not Available643Open in IMG/M
3300027778|Ga0209464_10323318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300027831|Ga0209797_10249952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium745Open in IMG/M
3300027866|Ga0209813_10425953All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300027876|Ga0209974_10353030All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300027911|Ga0209698_11257628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales543Open in IMG/M
3300027915|Ga0209069_10167301Not Available1103Open in IMG/M
3300028379|Ga0268266_11066124Not Available782Open in IMG/M
3300028380|Ga0268265_12216982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium556Open in IMG/M
3300028587|Ga0247828_10131395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1230Open in IMG/M
3300028587|Ga0247828_10666164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300028589|Ga0247818_10990480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300028592|Ga0247822_10492959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium968Open in IMG/M
3300028592|Ga0247822_11787563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium524Open in IMG/M
3300028608|Ga0247819_10620032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium653Open in IMG/M
3300028802|Ga0307503_10140441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1084Open in IMG/M
3300028810|Ga0307294_10207442Not Available679Open in IMG/M
3300030002|Ga0311350_10305960Not Available1420Open in IMG/M
3300030019|Ga0311348_10626679Not Available802Open in IMG/M
3300030019|Ga0311348_11386759Not Available522Open in IMG/M
3300030336|Ga0247826_10072462All Organisms → cellular organisms → Bacteria2032Open in IMG/M
3300030336|Ga0247826_10375373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1043Open in IMG/M
3300030336|Ga0247826_10934586All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria686Open in IMG/M
3300030336|Ga0247826_11345660All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300031722|Ga0311351_11137330Not Available599Open in IMG/M
3300031771|Ga0318546_10723677Not Available700Open in IMG/M
3300031847|Ga0310907_10783547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300031854|Ga0310904_10264320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1073Open in IMG/M
3300031908|Ga0310900_10115865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1750Open in IMG/M
3300031996|Ga0308176_10924480All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium917Open in IMG/M
3300031997|Ga0315278_12269447Not Available500Open in IMG/M
3300032003|Ga0310897_10421075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300032075|Ga0310890_10072857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2057Open in IMG/M
3300032163|Ga0315281_10438707Not Available1400Open in IMG/M
3300032164|Ga0315283_10682838Not Available1107Open in IMG/M
3300032164|Ga0315283_10702517Not Available1089Open in IMG/M
3300032177|Ga0315276_12574701Not Available508Open in IMG/M
3300032256|Ga0315271_10312832Not Available1294Open in IMG/M
3300032256|Ga0315271_10476605Not Available1055Open in IMG/M
3300032256|Ga0315271_10611369Not Available932Open in IMG/M
3300032256|Ga0315271_10782680Not Available821Open in IMG/M
3300032256|Ga0315271_10828635Not Available797Open in IMG/M
3300032256|Ga0315271_10978715Not Available730Open in IMG/M
3300032275|Ga0315270_10347685Not Available938Open in IMG/M
3300032397|Ga0315287_10376126Not Available1681Open in IMG/M
3300032401|Ga0315275_10483359Not Available1388Open in IMG/M
3300033550|Ga0247829_10061023All Organisms → cellular organisms → Bacteria2699Open in IMG/M
3300033550|Ga0247829_10131804All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1926Open in IMG/M
3300033550|Ga0247829_10920562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300033551|Ga0247830_10464464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium992Open in IMG/M
3300033551|Ga0247830_11329533All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300034268|Ga0372943_0995517All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia559Open in IMG/M
3300034817|Ga0373948_0017544All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300034819|Ga0373958_0143056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil14.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment9.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil9.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.33%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.67%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.67%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.33%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.33%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.33%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.33%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.33%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.33%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.33%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.33%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.33%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.33%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.67%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.67%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.67%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.67%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.67%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.67%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.67%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.67%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.67%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.67%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.67%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.67%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.67%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.67%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.67%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009032Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014322Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022226Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022883Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023263Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025796Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026009Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026050Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027866Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027876Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030019II_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031722II_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M
3300034819Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_059220202070309004Green-Waste CompostMAAGVANIPRELDPDDPLADLPGNPQSAWKRTVLATLVERALAALD
4MG_011944502170459019Switchgrass, Maize And Mischanthus LitterDPSDPLAELPGNPQSAWKRRALATLVERALADVSPAS
JGI10214J12806_1050209813300000891SoilLVAAGVANVPRRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS*
C688J35102_11824998413300002568SoilRRGDEISLAAAGVSNIPRALDPADPLAGLPGHPQSAWKRKVLTTLVERAGAALTG*
Ga0055467_1027815513300003996Natural And Restored WetlandsRRDNDIRLVAAGVANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0062590_10225994023300004157SoilAGIANIPRALDVADPAAGLPGDPQTGWKRRALTTLAERALAAVA*
Ga0062591_10232845313300004643SoilDDTRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLVERATAALA*
Ga0062380_1007680413300004779Wetland SedimentAAGVANVPRAIDPADPLAGLPGHPQSAWKRQVLATLVERAGAALAATAPP*
Ga0070660_10047049813300005339Corn RhizosphereRLVAAGVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVS*
Ga0070661_10158285213300005344Corn RhizosphereGDETRLVAAGVANVPRALDPTDPLAGLPGNPQTAWKRRALETLAERATAALA*
Ga0070674_10185225513300005356Miscanthus RhizosphereRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0070673_10028254623300005364Switchgrass RhizosphereVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVA*
Ga0070703_1031897013300005406Corn, Switchgrass And Miscanthus RhizosphereVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0070662_10176103423300005457Corn RhizosphereAARRGNEVALVASGVANIPRTLDPADPLAGLPGNPQTAWKRHALTTLAERAVAAVS*
Ga0068867_10095759923300005459Miscanthus RhizosphereGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0070686_10010018033300005544Switchgrass RhizosphereRGNDVRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0070704_10196216613300005549Corn, Switchgrass And Miscanthus RhizosphereVAAGVANVPVELDGDDGLAGLPGNPQSAWKRHVLATLVERAREAVA*
Ga0070664_10041555213300005564Corn RhizosphereGNDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0070664_10150371623300005564Corn RhizosphereVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR*
Ga0068854_10028149413300005578Corn RhizosphereTLVAAGVANIPRALDPADPLEGLPGNPQTGWKRTVLATLVERAVAQL*
Ga0070702_10026544023300005615Corn, Switchgrass And Miscanthus RhizosphereRLVATGIANIPRALDQADPLAGLPGNPQSAWKRGALATLAERALAAVA*
Ga0068859_10159958713300005617Switchgrass RhizosphereRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0081455_1044493713300005937Tabebuia Heterophylla RhizosphereARADSETRLVAAGVANVPRALDAADPLAGLPGNPQSAWKRDVLARLVERAKAAVA*
Ga0081455_1074851613300005937Tabebuia Heterophylla RhizosphereRLGAAGVANVPRALDPADPLAGLPGNPQTAWKRRALETLVARATAALG*
Ga0097621_10011001043300006237Miscanthus RhizosphereRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0075435_10129142623300007076Populus RhizosphereAARRGNDVRLVATGIANVPRELDPNDPLADLPGNPQTHWKRQLLATLVERAVASI*
Ga0105048_1058199633300009032FreshwaterVRVVAGGVANIPVALDPADPLADLPGNPQTGWKRDLLATLVARAV
Ga0105245_1005521853300009098Miscanthus RhizosphereVAAARRGNDVRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0105243_1009009343300009148Miscanthus RhizosphereAARRGNDIRLVAAGIANIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0130016_1040038613300009868WastewaterAAGVANVPRALAAADPLAGLPGSPQSAWKRELLRALVERALVAVTPES*
Ga0126377_1009308313300010362Tropical Forest SoilAARRGDDVRMVAAGVANIPRELDASDALAGLPGNPQSEWKARVLATLVERARAALG*
Ga0134124_1071697313300010397Terrestrial SoilRRGNDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0134123_1057042013300010403Terrestrial SoilIPRALDVADPAGGLPGNPQTCWKRRALTTLAERALAAVA*
Ga0105246_1067521623300011119Miscanthus RhizosphereDPADPLAGLPGNPQTGWKRRALETLAERAAAAVA*
Ga0157329_100896323300012491Arabidopsis RhizosphereEETTLVAAGVANVPRRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS*
Ga0136612_1004587013300012680Polar Desert SandVWLVAAGVANIPRAIDPEDPLSGLPGHPQSAWKRQVLSTLVERALAAVDD*
Ga0157289_1004876123300012903SoilGGDIRLVAAGVANIPRALDPADPAAGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0157289_1028087423300012903SoilLDPADPLAGLPGHPQSAWKRTVLATLVERAGVALDTTP*
Ga0157282_1018068813300012904SoilRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS*
Ga0157290_1019049023300012909SoilAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETIAERAAAAVA*
Ga0157308_1001784713300012910SoilTGDGLSLAAAGVANIPRQLDPTDPLAGLPGHPQSAWKRTVLATLVERAGVALDTTP*
Ga0157301_1040776113300012911SoilRRGNDVRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA*
Ga0164303_1146302613300012957SoilPRELDAADPLAGLPGNPQTGWKRRALETLVERATAAVA*
Ga0164308_1054662713300012985SoilPTDPLAGLPGHPQSAWKRTVLATLVERATAALAGR*
Ga0157371_1160317213300013102Corn RhizosphereTRLVAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLAERAAAAVA*
Ga0157378_1211818713300013297Miscanthus RhizosphereGVANIPRELDAADPLAGLPGNPQTGWKRRALETLVERATAAVA*
Ga0163162_1024382113300013306Switchgrass RhizospherePGTIDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA*
Ga0157372_1110146823300013307Corn RhizosphereAVRRGTETRLVAAGVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVS*
Ga0075355_121707023300014322Natural And Restored WetlandsLVAAGVANVPRPLDPADPLEGLPGNPQSAWKRTVLATLVERASATLV*
Ga0163163_1243481413300014325Switchgrass RhizosphereLDPDDPLAWLPGHPQSAWKRTVLATLVERASAALDAGS*
Ga0157380_1050607313300014326Switchgrass RhizosphereGIANIPRALDQADPLAALPGNPQSAWKRGALATLAERALAAVA*
Ga0157380_1190524623300014326Switchgrass RhizosphereVAAARRDDTVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR*
Ga0181522_1063266823300014657BogDGGVRVVAGGVANIPVAVDPEDPLAGLPGNPQTMWKRTVLVTLSQRVVADVAAV*
Ga0157377_1048752823300014745Miscanthus RhizosphereAAARRGDDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0157376_1285035313300014969Miscanthus RhizosphereAAKRGAEIRLVAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLVERAIAAVG*
Ga0173483_1005959013300015077SoilSDIRLVAAGVANIPRALDPADPAAGLPGNPQTGWKRRALTTLAERALAAVA*
Ga0173480_1088683133300015200SoilLDPADPLAGLPGNPQTGWKRRALETLVERATAALA*
Ga0167629_102148513300015209Glacier Forefield SoilFVAAGVANIPRAVDPADPLAGLPGHPQSAWKRQILATLVERATAALAA*
Ga0132258_1175044813300015371Arabidopsis RhizosphereRVGDEVKLVAAGVANVPRALDPADPLADLPGNPQSAWKRTVLATLVERAVAQL*
Ga0132256_10328999813300015372Arabidopsis RhizosphereRLVASGVANVPRELDPADPLAGLPGNPQTRWKLRALETLVERAAAALA*
Ga0132256_10366405013300015372Arabidopsis RhizosphereLDPADPLAGLPGHPQSAWKRTVLATLVERATAALADA*
Ga0184628_1043659413300018083Groundwater SedimentDPADPLAGLPGHPQSAWKRTVLATLVERAGAALDAIP
Ga0190275_1034165233300018432SoilADGVRLVAAGVANIPRALDPDDPLRGLEGHPQTGWKRHLLTTLATRAREAVA
Ga0190270_1011647513300018469SoilVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR
Ga0206353_1041728923300020082Corn, Switchgrass And Miscanthus RhizosphereVAAGIANIPRALDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA
Ga0224512_1012644023300022226SedimentVVAAGVANVPRELDPADPLAGLPGHAQTGWKRDLLAALVERALADVTA
Ga0224510_1047167223300022309SedimentGGGVRLAAAGVANIPRELDPADPLSGLPGHPQTGWKRDLLAALVERALAAV
Ga0247747_101494713300022737SoilPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA
Ga0247786_100735113300022883SoilRLVAAGVANIPRALDPEDPAAGLPGNPQTGWKRRALTTLAERALAAVA
Ga0247788_102109923300022901SoilGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA
Ga0247790_1007540813300022915SoilTLVAAGVANVPRRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS
Ga0247800_103669023300023263SoilALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA
Ga0209641_1005762513300025322SoilVANVPRELDTADPLAGLPGHPQSAWKRDVLATLVERAVAALGEPG
Ga0209341_1016169613300025325SoilPADPLAGLPGHPQSAWKRDVLAALVERAVAALGEPG
Ga0210113_101494833300025796Natural And Restored WetlandsAETRVVAAGIANIPRELDPDDPLAGLKGSPQSAWKRRALQTLVERAAARVA
Ga0207688_1106283423300025901Corn, Switchgrass And Miscanthus RhizosphereTRLVAAGVANVPRALDPTDPLAGLPGNPQTGWKRRALETLAERATAALA
Ga0207684_1131872513300025910Corn, Switchgrass And Miscanthus RhizosphereAGIANIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA
Ga0207707_1079368723300025912Corn RhizosphereMDRDPAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLVERANAAVG
Ga0207657_1034629023300025919Corn RhizosphereVAAVRRGTETRLVAAGVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVS
Ga0207681_1169227113300025923Switchgrass RhizosphereDPADPLAGLPGHPQSAWKRTVLATLVERATAGLQA
Ga0207694_1099074723300025924Corn RhizosphereRGNDIRLVAAGIANIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA
Ga0207659_1019522333300025926Miscanthus RhizosphereALDPTDPLAGLPGNPQTAWKRRALETLAERATAALA
Ga0207659_1023942433300025926Miscanthus RhizosphereIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA
Ga0207659_1151232513300025926Miscanthus RhizosphereARRGNEVALVASGVANIPRRLDPADPLAGLPGNPQTAWKRRALTTLAERAVAAVS
Ga0207690_1007947843300025932Corn RhizosphereIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA
Ga0207704_1081550023300025938Miscanthus RhizosphereGLSLAAAGVANIPRQLDPTDPLAGLPGHPQSAWKRTVLATLVERAGVALDTTP
Ga0207691_1016960313300025940Miscanthus RhizosphereSGVANIPRTLDPADPLAGLPGNPQTAWKRHALATLAERAVAAVS
Ga0207711_1012455243300025941Switchgrass RhizosphereGVANIPRTLDPADPLAGLPGNPQTAWKRHALATLAERAVAAVS
Ga0207668_1038414113300025972Switchgrass RhizosphereARRGDETRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA
Ga0207640_1098261623300025981Corn RhizosphereTLVAAGVANIPRALDPADPLEGLPGNPQTGWKRTVLATLVERAVAQL
Ga0208530_100866923300026009Rice Paddy SoilAAGVANVPRSLDPADPLANLTGNPQTGWKRRALETLVERATAALA
Ga0207639_1175789013300026041Corn RhizosphereIPRRLDPADPLAGLPGNPQTAWKRRALTTLAERAVAAVS
Ga0208293_100516313300026050Natural And Restored WetlandsRLVASGVANVPRELDPADPLAGLDGNPQTGWKRDLLAALVERALTALVR
Ga0207708_1158091713300026075Corn, Switchgrass And Miscanthus RhizosphereDEVTLVAAGVANIPRALDPADPLEGLPGNPQTGWKRTVLATLVERAVAQL
Ga0207674_1053111323300026116Corn RhizosphereVANVPRALDPADPLAGLPGNPQTAWKRRALETLVERATAALA
Ga0207683_1052414023300026121Miscanthus RhizosphereTGDELTLAAAGVANIPRPLDPADPLAGLPGHRQSAWKRTVLATLVERAGAALDAIP
Ga0207683_1141202223300026121Miscanthus RhizosphereIPRSLDPADPLAGLLGHPQSAWKRTVLATLVERATAGLQA
Ga0209464_1032331823300027778Wetland SedimentVPRALDPVDPLEGLPGNPQSAWKREVLAALVERALAELRPGS
Ga0209797_1024995223300027831Wetland SedimentGGARFVAAGVANVPRAIDPADPLAGLPGHPQSAWKRQVLATLVERAGAALAATAPP
Ga0209813_1042595313300027866Populus EndospherePRALDPADPLAGLPGNPQTAWKRRALETLAERATAALA
Ga0209974_1035303013300027876Arabidopsis Thaliana RhizosphereGDDIRLVAAGVANIPRVLDPADPASGLPGNPQTGWKRQALMTLAERALAAVA
Ga0209698_1125762813300027911WatershedsDPDDPLAELPGNPQSAWKRGLLATLVQRALTEIEG
Ga0209069_1016730133300027915WatershedsVANVPRSLDASDPLAALPGHPGSAWKRRLLATLVERALAAIA
Ga0268266_1106612413300028379Switchgrass RhizosphereDGLTLAAAGVANIPRSLDPADPLAGLPGHPQSAWKRTVLATLVERATAALADA
Ga0268265_1221698213300028380Switchgrass RhizospherePRRLDPADPLAGLPGNPQTAWKRRALTTLAERAVAAVS
Ga0247828_1013139513300028587SoilGVVAAARRDDTVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR
Ga0247828_1066616413300028587SoilRGAETHLAAAGVANIPVGLDPSDPLAGLKGSPQSAWKRRALATLVERAVARTA
Ga0247818_1099048023300028589SoilLDPADPLAGLPGNPQTAWKRRALETLVERATAALA
Ga0247822_1049295923300028592SoilAAARRGNEVALVASGVANIPRTLDPADPLAGLPGNPQTAWKRHALTTLAERAVAAVS
Ga0247822_1178756323300028592SoilDTVRLVAAGVANVPRELDPEDPLAGLPGNPQTAWKRTLLATLAGRALDRIR
Ga0247819_1062003213300028608SoilLVSVAAARHDDDTRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALA
Ga0307503_1014044113300028802SoilRGNEVALVASGVANIPRALDPADPLAGLPGNPQTAWKRRALATLAERAVAAVS
Ga0307294_1020744223300028810SoilAAGVANIPRPLDPVDPLAGLPGHPQSAWKRTVLATLVERAGAALDATP
Ga0311350_1030596023300030002FenASRDGELTLAAAGVANIPRALDPADPLAGLPGHPQSAWKRTVLATLVERATAALS
Ga0311348_1062667913300030019FenARRDGATSLVAAGVANVPRALDPQDPLAGLPGNPQSSWKRIVLATLVERATAALA
Ga0311348_1138675923300030019FenRRDGVTSLVAAGVANVPRALDPADPLAGLPGNPQSAWKRTVLATLVERATAALD
Ga0247826_1007246233300030336SoilGEDVRLVAAGVANIPRKLDPADPLAGLPGNPQSAWKRDLLAALAERAVASVTSS
Ga0247826_1037537323300030336SoilDLTLAAAGVGNIPRALDPADPLAGLPGNPQSAWKRDLLAALVERAVAAVTRS
Ga0247826_1093458623300030336SoilGVANVPRALDPDDPLRGLEGNPQTGWKRHLLATLAARAQEAVA
Ga0247826_1134566013300030336SoilANIPRELDAADPLAGLPGNPQTGWKRRALETLVERATAAVA
Ga0311351_1113733013300031722FenVANIPRALDPADPLAGLPGHPQSAWKRTVLATLVERATAALS
Ga0318546_1072367713300031771SoilAAKRGGEVTLAAAGVANIPVGLDPADPLRDLPGNPQSEWKRPVVSALAERAVGALG
Ga0310907_1078354713300031847SoilVAAARRGDETRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA
Ga0310904_1026432023300031854SoilGSETRLVAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLAERAAAAVA
Ga0310900_1011586533300031908SoilNIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA
Ga0308176_1092448013300031996SoilAGVANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA
Ga0315278_1226944723300031997SedimentRRGEDVRLVAAGVANIPRELDPSDPLAGLPGHPQSAWKRQVLAALVERAVTALQ
Ga0310897_1042107523300032003SoilRELDPADPLAGLPGNPQTGWKRRALETIAERAAAAVA
Ga0310890_1007285733300032075SoilIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA
Ga0315281_1043870713300032163SedimentARSGVAITLVAAGIANIPRAIDPADPLAGLPGHPQSAWKRKVLETLVDRAVAAVARL
Ga0315283_1068283813300032164SedimentMLVAAGVANIPRALDPSDPLAGLPGHPGSAWKRQVLATLVERATAAVA
Ga0315283_1070251723300032164SedimentAAARRGDMLTLVAAGIANTPRALDPADPLAGLPGHPQSAWKRTVLVTLVERAVAALA
Ga0315276_1257470123300032177SedimentRRGDVLTLVAAGIANTPRALDPADPLAGLPGHPQSAWKRTVLATLVERAVAAVA
Ga0315271_1031283213300032256SedimentGVANIPRPLDQADPLAGLPGHPQSSWKRKVLETLVERAVASL
Ga0315271_1047660513300032256SedimentAAARRGDALTLVAAGVANIPRALDPADPLAGLPGHPQSAWKRTVLATLVERATAALR
Ga0315271_1061136913300032256SedimentRAIDPADPLAGLPGHPQSAWKRKVLETLVDRAVAAVARL
Ga0315271_1078268023300032256SedimentRALDPADPLAGLPGHPQSAWKRKVLATLVERAAAALHLPA
Ga0315271_1082863523300032256SedimentANIPRAIDPADPLAGLPGHPQSAWKLKVLETLVDRAVAAVARL
Ga0315271_1097871523300032256SedimentPRVLDPSDPLAGLPGHPGSAWKRKVLATLVERATATLHVPPRSRIR
Ga0315270_1034768513300032275SedimentVAAGIANIPRAIDPADPLAGLPGHPQSAWKRKVLETLVDRAVAAVARL
Ga0315287_1037612613300032397SedimentRGDVLTLVAAGIANIPRALDPADPLAGLPGHPQSAWKRTVLVTLVERAVAALA
Ga0315275_1048335923300032401SedimentGVANIPRVLDLSDPLAGLPGHPGSAWKRKVLATLVERATATLHVPPRSRIR
Ga0247829_1006102353300033550SoilALDPADPLAGLPGNPQSAWKRDLLAALVERAVAAV
Ga0247829_1013180433300033550SoilAGRDDTVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR
Ga0247829_1092056223300033550SoilAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA
Ga0247830_1046446413300033551SoilDPADLLAGLPGNPQSAWKRDLLAALVERAVAAVTRS
Ga0247830_1132953323300033551SoilAAARRGNDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA
Ga0372943_0995517_413_5563300034268SoilMAAAGVANIPHWIDPADVLADLPGNEQTGWKRKALETLAERAVARLA
Ga0373948_0017544_1219_13353300034817Rhizosphere SoilPRALDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA
Ga0373958_0143056_2_1423300034819Rhizosphere SoilVAAGIANIPRALDVADPSGGLPGNPQTGWKRRALTTLAERALAAVA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.