Basic Information | |
---|---|
Family ID | F047144 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 150 |
Average Sequence Length | 47 residues |
Representative Sequence | AAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 150 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 2.00 % |
% of genes near scaffold ends (potentially truncated) | 96.67 % |
% of genes from short scaffolds (< 2000 bps) | 90.67 % |
Associated GOLD sequencing projects | 124 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.58 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (72.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil (14.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (34.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (40.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.77% β-sheet: 0.00% Coil/Unstructured: 71.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 150 Family Scaffolds |
---|---|---|
PF04024 | PspC | 19.33 |
PF04909 | Amidohydro_2 | 18.00 |
PF09922 | DUF2154 | 10.00 |
PF12796 | Ank_2 | 7.33 |
PF12804 | NTP_transf_3 | 2.67 |
PF13192 | Thioredoxin_3 | 2.67 |
PF02074 | Peptidase_M32 | 1.33 |
PF00563 | EAL | 0.67 |
PF00263 | Secretin | 0.67 |
PF00941 | FAD_binding_5 | 0.67 |
PF00069 | Pkinase | 0.67 |
PF10589 | NADH_4Fe-4S | 0.67 |
PF13515 | FUSC_2 | 0.67 |
PF00512 | HisKA | 0.67 |
PF00232 | Glyco_hydro_1 | 0.67 |
PF07179 | SseB | 0.67 |
PF13606 | Ank_3 | 0.67 |
PF00773 | RNB | 0.67 |
COG ID | Name | Functional Category | % Frequency in 150 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.67 |
COG2317 | Zn-dependent carboxypeptidase, M32 family | Posttranslational modification, protein turnover, chaperones [O] | 1.33 |
COG0557 | Exoribonuclease R | Transcription [K] | 0.67 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.67 |
COG2723 | Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase | Carbohydrate transport and metabolism [G] | 0.67 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.67 |
COG4776 | Exoribonuclease II | Transcription [K] | 0.67 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.67 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.67 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 72.00 % |
Unclassified | root | N/A | 28.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2070309004|prs_FHA1B5K04XMARZ | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 507 | Open in IMG/M |
2170459019|G14TP7Y02H5CNA | Not Available | 628 | Open in IMG/M |
3300000891|JGI10214J12806_10502098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
3300002568|C688J35102_118249984 | Not Available | 542 | Open in IMG/M |
3300003996|Ga0055467_10278155 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 532 | Open in IMG/M |
3300004157|Ga0062590_102259940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 571 | Open in IMG/M |
3300004643|Ga0062591_102328453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 560 | Open in IMG/M |
3300004779|Ga0062380_10076804 | Not Available | 1192 | Open in IMG/M |
3300005339|Ga0070660_100470498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1044 | Open in IMG/M |
3300005344|Ga0070661_101582852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 554 | Open in IMG/M |
3300005356|Ga0070674_101852255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
3300005364|Ga0070673_100282546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1456 | Open in IMG/M |
3300005406|Ga0070703_10318970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
3300005457|Ga0070662_101761034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
3300005459|Ga0068867_100957599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 774 | Open in IMG/M |
3300005544|Ga0070686_100100180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1956 | Open in IMG/M |
3300005549|Ga0070704_101962166 | Not Available | 543 | Open in IMG/M |
3300005564|Ga0070664_100415552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1231 | Open in IMG/M |
3300005564|Ga0070664_101503716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 637 | Open in IMG/M |
3300005578|Ga0068854_100281494 | Not Available | 1339 | Open in IMG/M |
3300005615|Ga0070702_100265440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1171 | Open in IMG/M |
3300005617|Ga0068859_101599587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 720 | Open in IMG/M |
3300005937|Ga0081455_10444937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 887 | Open in IMG/M |
3300005937|Ga0081455_10748516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 618 | Open in IMG/M |
3300006237|Ga0097621_100110010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2328 | Open in IMG/M |
3300007076|Ga0075435_101291426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300009032|Ga0105048_10581996 | All Organisms → cellular organisms → Bacteria | 1089 | Open in IMG/M |
3300009098|Ga0105245_10055218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3567 | Open in IMG/M |
3300009148|Ga0105243_10090093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2523 | Open in IMG/M |
3300009868|Ga0130016_10400386 | Not Available | 912 | Open in IMG/M |
3300010362|Ga0126377_10093083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2733 | Open in IMG/M |
3300010397|Ga0134124_10716973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 991 | Open in IMG/M |
3300010403|Ga0134123_10570420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1081 | Open in IMG/M |
3300011119|Ga0105246_10675216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
3300012491|Ga0157329_1008963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 758 | Open in IMG/M |
3300012680|Ga0136612_10045870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2195 | Open in IMG/M |
3300012903|Ga0157289_10048761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1066 | Open in IMG/M |
3300012903|Ga0157289_10280874 | Not Available | 580 | Open in IMG/M |
3300012904|Ga0157282_10180688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
3300012909|Ga0157290_10190490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 689 | Open in IMG/M |
3300012910|Ga0157308_10017847 | Not Available | 1552 | Open in IMG/M |
3300012911|Ga0157301_10407761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300012957|Ga0164303_11463026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
3300012985|Ga0164308_10546627 | Not Available | 977 | Open in IMG/M |
3300013102|Ga0157371_11603172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300013297|Ga0157378_12118187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 613 | Open in IMG/M |
3300013306|Ga0163162_10243821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1928 | Open in IMG/M |
3300013307|Ga0157372_11101468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 919 | Open in IMG/M |
3300014322|Ga0075355_1217070 | Not Available | 539 | Open in IMG/M |
3300014325|Ga0163163_12434814 | Not Available | 582 | Open in IMG/M |
3300014326|Ga0157380_10506073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
3300014326|Ga0157380_11905246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 655 | Open in IMG/M |
3300014657|Ga0181522_10632668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 650 | Open in IMG/M |
3300014745|Ga0157377_10487528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
3300014969|Ga0157376_12850353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
3300015077|Ga0173483_10059590 | All Organisms → cellular organisms → Bacteria | 1487 | Open in IMG/M |
3300015200|Ga0173480_10886831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 578 | Open in IMG/M |
3300015209|Ga0167629_1021485 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
3300015371|Ga0132258_11750448 | Not Available | 1567 | Open in IMG/M |
3300015372|Ga0132256_103289998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 543 | Open in IMG/M |
3300015372|Ga0132256_103664050 | Not Available | 517 | Open in IMG/M |
3300018083|Ga0184628_10436594 | Not Available | 682 | Open in IMG/M |
3300018432|Ga0190275_10341652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
3300018469|Ga0190270_10116475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2089 | Open in IMG/M |
3300020082|Ga0206353_10417289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 837 | Open in IMG/M |
3300022226|Ga0224512_10126440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1375 | Open in IMG/M |
3300022309|Ga0224510_10471672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 749 | Open in IMG/M |
3300022737|Ga0247747_1014947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
3300022883|Ga0247786_1007351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2030 | Open in IMG/M |
3300022901|Ga0247788_1021099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1140 | Open in IMG/M |
3300022915|Ga0247790_10075408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
3300023263|Ga0247800_1036690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 855 | Open in IMG/M |
3300025322|Ga0209641_10057625 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2993 | Open in IMG/M |
3300025325|Ga0209341_10161696 | All Organisms → cellular organisms → Bacteria | 1882 | Open in IMG/M |
3300025796|Ga0210113_1014948 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1615 | Open in IMG/M |
3300025901|Ga0207688_11062834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300025910|Ga0207684_11318725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300025912|Ga0207707_10793687 | Not Available | 789 | Open in IMG/M |
3300025919|Ga0207657_10346290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1172 | Open in IMG/M |
3300025923|Ga0207681_11692271 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300025924|Ga0207694_10990747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
3300025926|Ga0207659_10195223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1613 | Open in IMG/M |
3300025926|Ga0207659_10239424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 1467 | Open in IMG/M |
3300025926|Ga0207659_11512325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300025932|Ga0207690_10079478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2285 | Open in IMG/M |
3300025938|Ga0207704_10815500 | Not Available | 780 | Open in IMG/M |
3300025940|Ga0207691_10169603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1912 | Open in IMG/M |
3300025941|Ga0207711_10124552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2304 | Open in IMG/M |
3300025972|Ga0207668_10384141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1183 | Open in IMG/M |
3300025981|Ga0207640_10982616 | Not Available | 742 | Open in IMG/M |
3300026009|Ga0208530_1008669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 746 | Open in IMG/M |
3300026041|Ga0207639_11757890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
3300026050|Ga0208293_1005163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 819 | Open in IMG/M |
3300026075|Ga0207708_11580917 | Not Available | 576 | Open in IMG/M |
3300026116|Ga0207674_10531113 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
3300026121|Ga0207683_10524140 | Not Available | 1095 | Open in IMG/M |
3300026121|Ga0207683_11412022 | Not Available | 643 | Open in IMG/M |
3300027778|Ga0209464_10323318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300027831|Ga0209797_10249952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
3300027866|Ga0209813_10425953 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
3300027876|Ga0209974_10353030 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300027911|Ga0209698_11257628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 543 | Open in IMG/M |
3300027915|Ga0209069_10167301 | Not Available | 1103 | Open in IMG/M |
3300028379|Ga0268266_11066124 | Not Available | 782 | Open in IMG/M |
3300028380|Ga0268265_12216982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 556 | Open in IMG/M |
3300028587|Ga0247828_10131395 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1230 | Open in IMG/M |
3300028587|Ga0247828_10666164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
3300028589|Ga0247818_10990480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 594 | Open in IMG/M |
3300028592|Ga0247822_10492959 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
3300028592|Ga0247822_11787563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 524 | Open in IMG/M |
3300028608|Ga0247819_10620032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 653 | Open in IMG/M |
3300028802|Ga0307503_10140441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1084 | Open in IMG/M |
3300028810|Ga0307294_10207442 | Not Available | 679 | Open in IMG/M |
3300030002|Ga0311350_10305960 | Not Available | 1420 | Open in IMG/M |
3300030019|Ga0311348_10626679 | Not Available | 802 | Open in IMG/M |
3300030019|Ga0311348_11386759 | Not Available | 522 | Open in IMG/M |
3300030336|Ga0247826_10072462 | All Organisms → cellular organisms → Bacteria | 2032 | Open in IMG/M |
3300030336|Ga0247826_10375373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1043 | Open in IMG/M |
3300030336|Ga0247826_10934586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300030336|Ga0247826_11345660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
3300031722|Ga0311351_11137330 | Not Available | 599 | Open in IMG/M |
3300031771|Ga0318546_10723677 | Not Available | 700 | Open in IMG/M |
3300031847|Ga0310907_10783547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
3300031854|Ga0310904_10264320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1073 | Open in IMG/M |
3300031908|Ga0310900_10115865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1750 | Open in IMG/M |
3300031996|Ga0308176_10924480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 917 | Open in IMG/M |
3300031997|Ga0315278_12269447 | Not Available | 500 | Open in IMG/M |
3300032003|Ga0310897_10421075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
3300032075|Ga0310890_10072857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2057 | Open in IMG/M |
3300032163|Ga0315281_10438707 | Not Available | 1400 | Open in IMG/M |
3300032164|Ga0315283_10682838 | Not Available | 1107 | Open in IMG/M |
3300032164|Ga0315283_10702517 | Not Available | 1089 | Open in IMG/M |
3300032177|Ga0315276_12574701 | Not Available | 508 | Open in IMG/M |
3300032256|Ga0315271_10312832 | Not Available | 1294 | Open in IMG/M |
3300032256|Ga0315271_10476605 | Not Available | 1055 | Open in IMG/M |
3300032256|Ga0315271_10611369 | Not Available | 932 | Open in IMG/M |
3300032256|Ga0315271_10782680 | Not Available | 821 | Open in IMG/M |
3300032256|Ga0315271_10828635 | Not Available | 797 | Open in IMG/M |
3300032256|Ga0315271_10978715 | Not Available | 730 | Open in IMG/M |
3300032275|Ga0315270_10347685 | Not Available | 938 | Open in IMG/M |
3300032397|Ga0315287_10376126 | Not Available | 1681 | Open in IMG/M |
3300032401|Ga0315275_10483359 | Not Available | 1388 | Open in IMG/M |
3300033550|Ga0247829_10061023 | All Organisms → cellular organisms → Bacteria | 2699 | Open in IMG/M |
3300033550|Ga0247829_10131804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1926 | Open in IMG/M |
3300033550|Ga0247829_10920562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
3300033551|Ga0247830_10464464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 992 | Open in IMG/M |
3300033551|Ga0247830_11329533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
3300034268|Ga0372943_0995517 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia | 559 | Open in IMG/M |
3300034817|Ga0373948_0017544 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
3300034819|Ga0373958_0143056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 14.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.33% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.67% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.33% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.33% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.33% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.33% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.33% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.33% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.33% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.33% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.33% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 1.33% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.33% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.67% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.67% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.67% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.67% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.67% |
Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.67% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.67% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.67% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.67% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.67% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.67% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.67% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.67% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.67% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.67% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.67% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.67% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
2170459019 | Litter degradation MG4 | Engineered | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Host-Associated | Open in IMG/M |
3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015209 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022226 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_13 | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
3300022883 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S066-202C-4 | Environmental | Open in IMG/M |
3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025796 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026009 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 (SPAdes) | Environmental | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026050 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
prs_05922020 | 2070309004 | Green-Waste Compost | MAAGVANIPRELDPDDPLADLPGNPQSAWKRTVLATLVERALAALD |
4MG_01194450 | 2170459019 | Switchgrass, Maize And Mischanthus Litter | DPSDPLAELPGNPQSAWKRRALATLVERALADVSPAS |
JGI10214J12806_105020981 | 3300000891 | Soil | LVAAGVANVPRRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS* |
C688J35102_1182499841 | 3300002568 | Soil | RRGDEISLAAAGVSNIPRALDPADPLAGLPGHPQSAWKRKVLTTLVERAGAALTG* |
Ga0055467_102781551 | 3300003996 | Natural And Restored Wetlands | RRDNDIRLVAAGVANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0062590_1022599402 | 3300004157 | Soil | AGIANIPRALDVADPAAGLPGDPQTGWKRRALTTLAERALAAVA* |
Ga0062591_1023284531 | 3300004643 | Soil | DDTRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLVERATAALA* |
Ga0062380_100768041 | 3300004779 | Wetland Sediment | AAGVANVPRAIDPADPLAGLPGHPQSAWKRQVLATLVERAGAALAATAPP* |
Ga0070660_1004704981 | 3300005339 | Corn Rhizosphere | RLVAAGVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVS* |
Ga0070661_1015828521 | 3300005344 | Corn Rhizosphere | GDETRLVAAGVANVPRALDPTDPLAGLPGNPQTAWKRRALETLAERATAALA* |
Ga0070674_1018522551 | 3300005356 | Miscanthus Rhizosphere | RLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0070673_1002825462 | 3300005364 | Switchgrass Rhizosphere | VANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVA* |
Ga0070703_103189701 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0070662_1017610342 | 3300005457 | Corn Rhizosphere | AARRGNEVALVASGVANIPRTLDPADPLAGLPGNPQTAWKRHALTTLAERAVAAVS* |
Ga0068867_1009575992 | 3300005459 | Miscanthus Rhizosphere | GIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0070686_1001001803 | 3300005544 | Switchgrass Rhizosphere | RGNDVRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0070704_1019621661 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGVANVPVELDGDDGLAGLPGNPQSAWKRHVLATLVERAREAVA* |
Ga0070664_1004155521 | 3300005564 | Corn Rhizosphere | GNDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0070664_1015037162 | 3300005564 | Corn Rhizosphere | VRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR* |
Ga0068854_1002814941 | 3300005578 | Corn Rhizosphere | TLVAAGVANIPRALDPADPLEGLPGNPQTGWKRTVLATLVERAVAQL* |
Ga0070702_1002654402 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | RLVATGIANIPRALDQADPLAGLPGNPQSAWKRGALATLAERALAAVA* |
Ga0068859_1015995871 | 3300005617 | Switchgrass Rhizosphere | RALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0081455_104449371 | 3300005937 | Tabebuia Heterophylla Rhizosphere | ARADSETRLVAAGVANVPRALDAADPLAGLPGNPQSAWKRDVLARLVERAKAAVA* |
Ga0081455_107485161 | 3300005937 | Tabebuia Heterophylla Rhizosphere | RLGAAGVANVPRALDPADPLAGLPGNPQTAWKRRALETLVARATAALG* |
Ga0097621_1001100104 | 3300006237 | Miscanthus Rhizosphere | RALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0075435_1012914262 | 3300007076 | Populus Rhizosphere | AARRGNDVRLVATGIANVPRELDPNDPLADLPGNPQTHWKRQLLATLVERAVASI* |
Ga0105048_105819963 | 3300009032 | Freshwater | VRVVAGGVANIPVALDPADPLADLPGNPQTGWKRDLLATLVARAV |
Ga0105245_100552185 | 3300009098 | Miscanthus Rhizosphere | VAAARRGNDVRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0105243_100900934 | 3300009148 | Miscanthus Rhizosphere | AARRGNDIRLVAAGIANIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0130016_104003861 | 3300009868 | Wastewater | AAGVANVPRALAAADPLAGLPGSPQSAWKRELLRALVERALVAVTPES* |
Ga0126377_100930831 | 3300010362 | Tropical Forest Soil | AARRGDDVRMVAAGVANIPRELDASDALAGLPGNPQSEWKARVLATLVERARAALG* |
Ga0134124_107169731 | 3300010397 | Terrestrial Soil | RRGNDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0134123_105704201 | 3300010403 | Terrestrial Soil | IPRALDVADPAGGLPGNPQTCWKRRALTTLAERALAAVA* |
Ga0105246_106752162 | 3300011119 | Miscanthus Rhizosphere | DPADPLAGLPGNPQTGWKRRALETLAERAAAAVA* |
Ga0157329_10089632 | 3300012491 | Arabidopsis Rhizosphere | EETTLVAAGVANVPRRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS* |
Ga0136612_100458701 | 3300012680 | Polar Desert Sand | VWLVAAGVANIPRAIDPEDPLSGLPGHPQSAWKRQVLSTLVERALAAVDD* |
Ga0157289_100487612 | 3300012903 | Soil | GGDIRLVAAGVANIPRALDPADPAAGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0157289_102808742 | 3300012903 | Soil | LDPADPLAGLPGHPQSAWKRTVLATLVERAGVALDTTP* |
Ga0157282_101806881 | 3300012904 | Soil | RLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS* |
Ga0157290_101904902 | 3300012909 | Soil | AAGVANVPRELDPADPLAGLPGNPQTGWKRRALETIAERAAAAVA* |
Ga0157308_100178471 | 3300012910 | Soil | TGDGLSLAAAGVANIPRQLDPTDPLAGLPGHPQSAWKRTVLATLVERAGVALDTTP* |
Ga0157301_104077611 | 3300012911 | Soil | RRGNDVRLVAAGIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA* |
Ga0164303_114630261 | 3300012957 | Soil | PRELDAADPLAGLPGNPQTGWKRRALETLVERATAAVA* |
Ga0164308_105466271 | 3300012985 | Soil | PTDPLAGLPGHPQSAWKRTVLATLVERATAALAGR* |
Ga0157371_116031721 | 3300013102 | Corn Rhizosphere | TRLVAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLAERAAAAVA* |
Ga0157378_121181871 | 3300013297 | Miscanthus Rhizosphere | GVANIPRELDAADPLAGLPGNPQTGWKRRALETLVERATAAVA* |
Ga0163162_102438211 | 3300013306 | Switchgrass Rhizosphere | PGTIDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA* |
Ga0157372_111014682 | 3300013307 | Corn Rhizosphere | AVRRGTETRLVAAGVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVS* |
Ga0075355_12170702 | 3300014322 | Natural And Restored Wetlands | LVAAGVANVPRPLDPADPLEGLPGNPQSAWKRTVLATLVERASATLV* |
Ga0163163_124348141 | 3300014325 | Switchgrass Rhizosphere | LDPDDPLAWLPGHPQSAWKRTVLATLVERASAALDAGS* |
Ga0157380_105060731 | 3300014326 | Switchgrass Rhizosphere | GIANIPRALDQADPLAALPGNPQSAWKRGALATLAERALAAVA* |
Ga0157380_119052462 | 3300014326 | Switchgrass Rhizosphere | VAAARRDDTVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR* |
Ga0181522_106326682 | 3300014657 | Bog | DGGVRVVAGGVANIPVAVDPEDPLAGLPGNPQTMWKRTVLVTLSQRVVADVAAV* |
Ga0157377_104875282 | 3300014745 | Miscanthus Rhizosphere | AAARRGDDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0157376_128503531 | 3300014969 | Miscanthus Rhizosphere | AAKRGAEIRLVAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLVERAIAAVG* |
Ga0173483_100595901 | 3300015077 | Soil | SDIRLVAAGVANIPRALDPADPAAGLPGNPQTGWKRRALTTLAERALAAVA* |
Ga0173480_108868313 | 3300015200 | Soil | LDPADPLAGLPGNPQTGWKRRALETLVERATAALA* |
Ga0167629_10214851 | 3300015209 | Glacier Forefield Soil | FVAAGVANIPRAVDPADPLAGLPGHPQSAWKRQILATLVERATAALAA* |
Ga0132258_117504481 | 3300015371 | Arabidopsis Rhizosphere | RVGDEVKLVAAGVANVPRALDPADPLADLPGNPQSAWKRTVLATLVERAVAQL* |
Ga0132256_1032899981 | 3300015372 | Arabidopsis Rhizosphere | RLVASGVANVPRELDPADPLAGLPGNPQTRWKLRALETLVERAAAALA* |
Ga0132256_1036640501 | 3300015372 | Arabidopsis Rhizosphere | LDPADPLAGLPGHPQSAWKRTVLATLVERATAALADA* |
Ga0184628_104365941 | 3300018083 | Groundwater Sediment | DPADPLAGLPGHPQSAWKRTVLATLVERAGAALDAIP |
Ga0190275_103416523 | 3300018432 | Soil | ADGVRLVAAGVANIPRALDPDDPLRGLEGHPQTGWKRHLLTTLATRAREAVA |
Ga0190270_101164751 | 3300018469 | Soil | VRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR |
Ga0206353_104172892 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VAAGIANIPRALDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA |
Ga0224512_101264402 | 3300022226 | Sediment | VVAAGVANVPRELDPADPLAGLPGHAQTGWKRDLLAALVERALADVTA |
Ga0224510_104716722 | 3300022309 | Sediment | GGGVRLAAAGVANIPRELDPADPLSGLPGHPQTGWKRDLLAALVERALAAV |
Ga0247747_10149471 | 3300022737 | Soil | PRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA |
Ga0247786_10073511 | 3300022883 | Soil | RLVAAGVANIPRALDPEDPAAGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0247788_10210992 | 3300022901 | Soil | GIANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA |
Ga0247790_100754081 | 3300022915 | Soil | TLVAAGVANVPRRLDPSDPLAELPGNPQSAWKRRALATLVERALADVSPGS |
Ga0247800_10366902 | 3300023263 | Soil | ALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA |
Ga0209641_100576251 | 3300025322 | Soil | VANVPRELDTADPLAGLPGHPQSAWKRDVLATLVERAVAALGEPG |
Ga0209341_101616961 | 3300025325 | Soil | PADPLAGLPGHPQSAWKRDVLAALVERAVAALGEPG |
Ga0210113_10149483 | 3300025796 | Natural And Restored Wetlands | AETRVVAAGIANIPRELDPDDPLAGLKGSPQSAWKRRALQTLVERAAARVA |
Ga0207688_110628342 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLVAAGVANVPRALDPTDPLAGLPGNPQTGWKRRALETLAERATAALA |
Ga0207684_113187251 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AGIANIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0207707_107936872 | 3300025912 | Corn Rhizosphere | MDRDPAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLVERANAAVG |
Ga0207657_103462902 | 3300025919 | Corn Rhizosphere | VAAVRRGTETRLVAAGVANIPRELDPVDPLAGLPGNPQTGWKRRALETLVERATAAVS |
Ga0207681_116922711 | 3300025923 | Switchgrass Rhizosphere | DPADPLAGLPGHPQSAWKRTVLATLVERATAGLQA |
Ga0207694_109907472 | 3300025924 | Corn Rhizosphere | RGNDIRLVAAGIANIPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0207659_101952233 | 3300025926 | Miscanthus Rhizosphere | ALDPTDPLAGLPGNPQTAWKRRALETLAERATAALA |
Ga0207659_102394243 | 3300025926 | Miscanthus Rhizosphere | IPRALDVADPAGGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0207659_115123251 | 3300025926 | Miscanthus Rhizosphere | ARRGNEVALVASGVANIPRRLDPADPLAGLPGNPQTAWKRRALTTLAERAVAAVS |
Ga0207690_100794784 | 3300025932 | Corn Rhizosphere | IPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0207704_108155002 | 3300025938 | Miscanthus Rhizosphere | GLSLAAAGVANIPRQLDPTDPLAGLPGHPQSAWKRTVLATLVERAGVALDTTP |
Ga0207691_101696031 | 3300025940 | Miscanthus Rhizosphere | SGVANIPRTLDPADPLAGLPGNPQTAWKRHALATLAERAVAAVS |
Ga0207711_101245524 | 3300025941 | Switchgrass Rhizosphere | GVANIPRTLDPADPLAGLPGNPQTAWKRHALATLAERAVAAVS |
Ga0207668_103841411 | 3300025972 | Switchgrass Rhizosphere | ARRGDETRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA |
Ga0207640_109826162 | 3300025981 | Corn Rhizosphere | TLVAAGVANIPRALDPADPLEGLPGNPQTGWKRTVLATLVERAVAQL |
Ga0208530_10086692 | 3300026009 | Rice Paddy Soil | AAGVANVPRSLDPADPLANLTGNPQTGWKRRALETLVERATAALA |
Ga0207639_117578901 | 3300026041 | Corn Rhizosphere | IPRRLDPADPLAGLPGNPQTAWKRRALTTLAERAVAAVS |
Ga0208293_10051631 | 3300026050 | Natural And Restored Wetlands | RLVASGVANVPRELDPADPLAGLDGNPQTGWKRDLLAALVERALTALVR |
Ga0207708_115809171 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | DEVTLVAAGVANIPRALDPADPLEGLPGNPQTGWKRTVLATLVERAVAQL |
Ga0207674_105311132 | 3300026116 | Corn Rhizosphere | VANVPRALDPADPLAGLPGNPQTAWKRRALETLVERATAALA |
Ga0207683_105241402 | 3300026121 | Miscanthus Rhizosphere | TGDELTLAAAGVANIPRPLDPADPLAGLPGHRQSAWKRTVLATLVERAGAALDAIP |
Ga0207683_114120222 | 3300026121 | Miscanthus Rhizosphere | IPRSLDPADPLAGLLGHPQSAWKRTVLATLVERATAGLQA |
Ga0209464_103233182 | 3300027778 | Wetland Sediment | VPRALDPVDPLEGLPGNPQSAWKREVLAALVERALAELRPGS |
Ga0209797_102499522 | 3300027831 | Wetland Sediment | GGARFVAAGVANVPRAIDPADPLAGLPGHPQSAWKRQVLATLVERAGAALAATAPP |
Ga0209813_104259531 | 3300027866 | Populus Endosphere | PRALDPADPLAGLPGNPQTAWKRRALETLAERATAALA |
Ga0209974_103530301 | 3300027876 | Arabidopsis Thaliana Rhizosphere | GDDIRLVAAGVANIPRVLDPADPASGLPGNPQTGWKRQALMTLAERALAAVA |
Ga0209698_112576281 | 3300027911 | Watersheds | DPDDPLAELPGNPQSAWKRGLLATLVQRALTEIEG |
Ga0209069_101673013 | 3300027915 | Watersheds | VANVPRSLDASDPLAALPGHPGSAWKRRLLATLVERALAAIA |
Ga0268266_110661241 | 3300028379 | Switchgrass Rhizosphere | DGLTLAAAGVANIPRSLDPADPLAGLPGHPQSAWKRTVLATLVERATAALADA |
Ga0268265_122169821 | 3300028380 | Switchgrass Rhizosphere | PRRLDPADPLAGLPGNPQTAWKRRALTTLAERAVAAVS |
Ga0247828_101313951 | 3300028587 | Soil | GVVAAARRDDTVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR |
Ga0247828_106661641 | 3300028587 | Soil | RGAETHLAAAGVANIPVGLDPSDPLAGLKGSPQSAWKRRALATLVERAVARTA |
Ga0247818_109904802 | 3300028589 | Soil | LDPADPLAGLPGNPQTAWKRRALETLVERATAALA |
Ga0247822_104929592 | 3300028592 | Soil | AAARRGNEVALVASGVANIPRTLDPADPLAGLPGNPQTAWKRHALTTLAERAVAAVS |
Ga0247822_117875632 | 3300028592 | Soil | DTVRLVAAGVANVPRELDPEDPLAGLPGNPQTAWKRTLLATLAGRALDRIR |
Ga0247819_106200321 | 3300028608 | Soil | LVSVAAARHDDDTRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALA |
Ga0307503_101404411 | 3300028802 | Soil | RGNEVALVASGVANIPRALDPADPLAGLPGNPQTAWKRRALATLAERAVAAVS |
Ga0307294_102074422 | 3300028810 | Soil | AAGVANIPRPLDPVDPLAGLPGHPQSAWKRTVLATLVERAGAALDATP |
Ga0311350_103059602 | 3300030002 | Fen | ASRDGELTLAAAGVANIPRALDPADPLAGLPGHPQSAWKRTVLATLVERATAALS |
Ga0311348_106266791 | 3300030019 | Fen | ARRDGATSLVAAGVANVPRALDPQDPLAGLPGNPQSSWKRIVLATLVERATAALA |
Ga0311348_113867592 | 3300030019 | Fen | RRDGVTSLVAAGVANVPRALDPADPLAGLPGNPQSAWKRTVLATLVERATAALD |
Ga0247826_100724623 | 3300030336 | Soil | GEDVRLVAAGVANIPRKLDPADPLAGLPGNPQSAWKRDLLAALAERAVASVTSS |
Ga0247826_103753732 | 3300030336 | Soil | DLTLAAAGVGNIPRALDPADPLAGLPGNPQSAWKRDLLAALVERAVAAVTRS |
Ga0247826_109345862 | 3300030336 | Soil | GVANVPRALDPDDPLRGLEGNPQTGWKRHLLATLAARAQEAVA |
Ga0247826_113456601 | 3300030336 | Soil | ANIPRELDAADPLAGLPGNPQTGWKRRALETLVERATAAVA |
Ga0311351_111373301 | 3300031722 | Fen | VANIPRALDPADPLAGLPGHPQSAWKRTVLATLVERATAALS |
Ga0318546_107236771 | 3300031771 | Soil | AAKRGGEVTLAAAGVANIPVGLDPADPLRDLPGNPQSEWKRPVVSALAERAVGALG |
Ga0310907_107835471 | 3300031847 | Soil | VAAARRGDETRLVAAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA |
Ga0310904_102643202 | 3300031854 | Soil | GSETRLVAAGVANVPRELDPADPLAGLPGNPQTGWKRRALETLAERAAAAVA |
Ga0310900_101158653 | 3300031908 | Soil | NIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0308176_109244801 | 3300031996 | Soil | AGVANIPRALDPADPASGLPGNPQTGWKRQALTTLAERALAAVA |
Ga0315278_122694472 | 3300031997 | Sediment | RRGEDVRLVAAGVANIPRELDPSDPLAGLPGHPQSAWKRQVLAALVERAVTALQ |
Ga0310897_104210752 | 3300032003 | Soil | RELDPADPLAGLPGNPQTGWKRRALETIAERAAAAVA |
Ga0310890_100728573 | 3300032075 | Soil | IANIPRALDVADPAAGLPGNPQTGWKRRALTTLAERALAAVA |
Ga0315281_104387071 | 3300032163 | Sediment | ARSGVAITLVAAGIANIPRAIDPADPLAGLPGHPQSAWKRKVLETLVDRAVAAVARL |
Ga0315283_106828381 | 3300032164 | Sediment | MLVAAGVANIPRALDPSDPLAGLPGHPGSAWKRQVLATLVERATAAVA |
Ga0315283_107025172 | 3300032164 | Sediment | AAARRGDMLTLVAAGIANTPRALDPADPLAGLPGHPQSAWKRTVLVTLVERAVAALA |
Ga0315276_125747012 | 3300032177 | Sediment | RRGDVLTLVAAGIANTPRALDPADPLAGLPGHPQSAWKRTVLATLVERAVAAVA |
Ga0315271_103128321 | 3300032256 | Sediment | GVANIPRPLDQADPLAGLPGHPQSSWKRKVLETLVERAVASL |
Ga0315271_104766051 | 3300032256 | Sediment | AAARRGDALTLVAAGVANIPRALDPADPLAGLPGHPQSAWKRTVLATLVERATAALR |
Ga0315271_106113691 | 3300032256 | Sediment | RAIDPADPLAGLPGHPQSAWKRKVLETLVDRAVAAVARL |
Ga0315271_107826802 | 3300032256 | Sediment | RALDPADPLAGLPGHPQSAWKRKVLATLVERAAAALHLPA |
Ga0315271_108286352 | 3300032256 | Sediment | ANIPRAIDPADPLAGLPGHPQSAWKLKVLETLVDRAVAAVARL |
Ga0315271_109787152 | 3300032256 | Sediment | PRVLDPSDPLAGLPGHPGSAWKRKVLATLVERATATLHVPPRSRIR |
Ga0315270_103476851 | 3300032275 | Sediment | VAAGIANIPRAIDPADPLAGLPGHPQSAWKRKVLETLVDRAVAAVARL |
Ga0315287_103761261 | 3300032397 | Sediment | RGDVLTLVAAGIANIPRALDPADPLAGLPGHPQSAWKRTVLVTLVERAVAALA |
Ga0315275_104833592 | 3300032401 | Sediment | GVANIPRVLDLSDPLAGLPGHPGSAWKRKVLATLVERATATLHVPPRSRIR |
Ga0247829_100610235 | 3300033550 | Soil | ALDPADPLAGLPGNPQSAWKRDLLAALVERAVAAV |
Ga0247829_101318043 | 3300033550 | Soil | AGRDDTVRLVAAGVANVPRELDPDDPLAGLPGNPQTAWKRTLLATLAGRALDRVR |
Ga0247829_109205622 | 3300033550 | Soil | AAGVANVPRALDPADPLAGLPGNPQTGWKRRALETLAERATAALA |
Ga0247830_104644641 | 3300033551 | Soil | DPADLLAGLPGNPQSAWKRDLLAALVERAVAAVTRS |
Ga0247830_113295332 | 3300033551 | Soil | AAARRGNDIRLVAAGIANIPRALDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA |
Ga0372943_0995517_413_556 | 3300034268 | Soil | MAAAGVANIPHWIDPADVLADLPGNEQTGWKRKALETLAERAVARLA |
Ga0373948_0017544_1219_1335 | 3300034817 | Rhizosphere Soil | PRALDVADPAAGLPGNPQTGWKQRALTTLAERALAAVA |
Ga0373958_0143056_2_142 | 3300034819 | Rhizosphere Soil | VAAGIANIPRALDVADPSGGLPGNPQTGWKRRALTTLAERALAAVA |
⦗Top⦘ |