NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F046622

Metagenome Family F046622

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F046622
Family Type Metagenome
Number of Sequences 151
Average Sequence Length 44 residues
Representative Sequence PEASKRFVAGARAASLLRMKERMEKAGGMENYDRVVQLFTPG
Number of Associated Samples 134
Number of Associated Scaffolds 151

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.67 %
% of genes near scaffold ends (potentially truncated) 96.69 %
% of genes from short scaffolds (< 2000 bps) 90.07 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.675 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(11.258 % of family members)
Environment Ontology (ENVO) Unclassified
(29.139 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(37.086 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.43%    β-sheet: 0.00%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 151 Family Scaffolds
PF04290DctQ 78.15
PF06808DctM 16.56
PF02771Acyl-CoA_dh_N 0.66
PF00106adh_short 0.66
PF00072Response_reg 0.66
PF01970TctA 0.66
PF02738MoCoBD_1 0.66

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 151 Family Scaffolds
COG1784TctA family transporterGeneral function prediction only [R] 0.66
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.66
COG3333TctA family transporterGeneral function prediction only [R] 0.66


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.68 %
UnclassifiedrootN/A1.32 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001850|RCM37_1040847All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria537Open in IMG/M
3300002073|JGI24745J21846_1048874All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria534Open in IMG/M
3300002568|C688J35102_119891357All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria805Open in IMG/M
3300002568|C688J35102_120395195All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1037Open in IMG/M
3300002917|JGI25616J43925_10338057All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria558Open in IMG/M
3300004153|Ga0063455_101709636All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria500Open in IMG/M
3300004157|Ga0062590_102295568All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria567Open in IMG/M
3300004463|Ga0063356_101963740All Organisms → cellular organisms → Bacteria → Proteobacteria884Open in IMG/M
3300004463|Ga0063356_105582649All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria540Open in IMG/M
3300005169|Ga0066810_10177475All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300005174|Ga0066680_10131469All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger bermudensis1556Open in IMG/M
3300005180|Ga0066685_10630074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria738Open in IMG/M
3300005294|Ga0065705_10088037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria529Open in IMG/M
3300005333|Ga0070677_10157701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1062Open in IMG/M
3300005334|Ga0068869_101607097All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria579Open in IMG/M
3300005356|Ga0070674_100755788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae836Open in IMG/M
3300005444|Ga0070694_100129142All Organisms → cellular organisms → Bacteria → Proteobacteria1824Open in IMG/M
3300005454|Ga0066687_10269415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger bermudensis956Open in IMG/M
3300005457|Ga0070662_100898468All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria756Open in IMG/M
3300005537|Ga0070730_10188180All Organisms → cellular organisms → Bacteria → Proteobacteria1382Open in IMG/M
3300005544|Ga0070686_100598216All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria869Open in IMG/M
3300005546|Ga0070696_100420128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1049Open in IMG/M
3300005546|Ga0070696_101238177All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria632Open in IMG/M
3300005552|Ga0066701_10816720All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria555Open in IMG/M
3300005617|Ga0068859_102289640All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria596Open in IMG/M
3300005829|Ga0074479_10818864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Salipiger → Salipiger bermudensis1132Open in IMG/M
3300005840|Ga0068870_11247722All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria540Open in IMG/M
3300006032|Ga0066696_10394676All Organisms → cellular organisms → Bacteria → Proteobacteria903Open in IMG/M
3300006032|Ga0066696_10960404All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria544Open in IMG/M
3300006169|Ga0082029_1244393All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2376Open in IMG/M
3300006173|Ga0070716_100433483All Organisms → cellular organisms → Bacteria → Proteobacteria954Open in IMG/M
3300006755|Ga0079222_11242979All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria672Open in IMG/M
3300006794|Ga0066658_10136028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1223Open in IMG/M
3300006794|Ga0066658_10577256All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria612Open in IMG/M
3300006797|Ga0066659_10875216All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria749Open in IMG/M
3300006800|Ga0066660_10103841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2018Open in IMG/M
3300006806|Ga0079220_10404330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Hoeflea → Hoeflea phototrophica893Open in IMG/M
3300006845|Ga0075421_100557755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1353Open in IMG/M
3300006871|Ga0075434_100042545All Organisms → cellular organisms → Bacteria → Proteobacteria4503Open in IMG/M
3300006871|Ga0075434_101406123All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria708Open in IMG/M
3300006876|Ga0079217_11565080All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300006894|Ga0079215_11047654All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria605Open in IMG/M
3300006904|Ga0075424_100985693All Organisms → cellular organisms → Bacteria → Proteobacteria899Open in IMG/M
3300006954|Ga0079219_11056356All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria682Open in IMG/M
3300006954|Ga0079219_11751654All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria578Open in IMG/M
3300007004|Ga0079218_13272317All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria548Open in IMG/M
3300007265|Ga0099794_10144298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1207Open in IMG/M
3300007790|Ga0105679_10764680All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1007Open in IMG/M
3300009087|Ga0105107_10696069All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria707Open in IMG/M
3300009094|Ga0111539_11731982All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria725Open in IMG/M
3300009148|Ga0105243_12072210All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria604Open in IMG/M
3300009156|Ga0111538_14122978All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria502Open in IMG/M
3300009162|Ga0075423_11809740All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria659Open in IMG/M
3300009176|Ga0105242_10004003All Organisms → cellular organisms → Bacteria → Proteobacteria11452Open in IMG/M
3300010044|Ga0126310_11607890All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria537Open in IMG/M
3300010359|Ga0126376_12853329All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria533Open in IMG/M
3300010364|Ga0134066_10029387All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1287Open in IMG/M
3300010364|Ga0134066_10332533All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria557Open in IMG/M
3300010391|Ga0136847_10393199All Organisms → cellular organisms → Bacteria → Proteobacteria1155Open in IMG/M
3300010403|Ga0134123_10132003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2039Open in IMG/M
3300010403|Ga0134123_11905446All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria650Open in IMG/M
3300011413|Ga0137333_1114962All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria623Open in IMG/M
3300011432|Ga0137428_1205636All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria583Open in IMG/M
3300011440|Ga0137433_1165077All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300011444|Ga0137463_1188595All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria774Open in IMG/M
3300012096|Ga0137389_10333407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1289Open in IMG/M
3300012164|Ga0137352_1033319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae992Open in IMG/M
3300012189|Ga0137388_11627670All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria581Open in IMG/M
3300012203|Ga0137399_10185900All Organisms → cellular organisms → Bacteria → Proteobacteria1680Open in IMG/M
3300012210|Ga0137378_10327714All Organisms → cellular organisms → Bacteria → Proteobacteria1424Open in IMG/M
3300012232|Ga0137435_1143625All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria727Open in IMG/M
3300012349|Ga0137387_11026515All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria591Open in IMG/M
3300012362|Ga0137361_10878743All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria814Open in IMG/M
3300012469|Ga0150984_112068723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria890Open in IMG/M
3300012509|Ga0157334_1023346All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria700Open in IMG/M
3300012519|Ga0157352_1106829All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria504Open in IMG/M
3300012582|Ga0137358_10526146All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria796Open in IMG/M
3300012923|Ga0137359_10785026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae826Open in IMG/M
3300012925|Ga0137419_11293423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria613Open in IMG/M
3300012927|Ga0137416_10807836All Organisms → cellular organisms → Bacteria → Proteobacteria830Open in IMG/M
3300012927|Ga0137416_11607466All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria592Open in IMG/M
3300012930|Ga0137407_10280713All Organisms → cellular organisms → Bacteria → Proteobacteria1518Open in IMG/M
3300012944|Ga0137410_10011559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Polaromonas → unclassified Polaromonas → Polaromonas sp. YR5685983Open in IMG/M
3300012944|Ga0137410_10762471All Organisms → cellular organisms → Bacteria → Proteobacteria810Open in IMG/M
3300012961|Ga0164302_11965059All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria500Open in IMG/M
3300012984|Ga0164309_10155633All Organisms → cellular organisms → Bacteria → Proteobacteria1525Open in IMG/M
3300013297|Ga0157378_11037469All Organisms → cellular organisms → Bacteria → Proteobacteria855Open in IMG/M
3300014488|Ga0182001_10306205All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria645Open in IMG/M
3300014878|Ga0180065_1164552All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria511Open in IMG/M
3300015357|Ga0134072_10480845All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria507Open in IMG/M
3300015358|Ga0134089_10026806All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae2008Open in IMG/M
3300015372|Ga0132256_100118812All Organisms → cellular organisms → Bacteria → Proteobacteria2606Open in IMG/M
3300018000|Ga0184604_10199233All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria685Open in IMG/M
3300018059|Ga0184615_10438494All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria711Open in IMG/M
3300018422|Ga0190265_10090344All Organisms → cellular organisms → Bacteria → Proteobacteria2836Open in IMG/M
3300018422|Ga0190265_11734628All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria734Open in IMG/M
3300018429|Ga0190272_12677465All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria547Open in IMG/M
3300018429|Ga0190272_12788546All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria538Open in IMG/M
3300018433|Ga0066667_10336241All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1193Open in IMG/M
3300018481|Ga0190271_12303041All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria644Open in IMG/M
3300020060|Ga0193717_1169635All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria622Open in IMG/M
3300020074|Ga0194113_11064960All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria536Open in IMG/M
3300020202|Ga0196964_10169049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae999Open in IMG/M
3300020215|Ga0196963_10261119All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria758Open in IMG/M
3300020220|Ga0194119_10099335All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2309Open in IMG/M
3300024182|Ga0247669_1067703All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria595Open in IMG/M
3300024232|Ga0247664_1077377All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria768Open in IMG/M
3300025315|Ga0207697_10177128All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria934Open in IMG/M
3300025936|Ga0207670_11619308All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria551Open in IMG/M
3300026089|Ga0207648_11316086All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria679Open in IMG/M
3300026317|Ga0209154_1042073All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2061Open in IMG/M
3300026328|Ga0209802_1240622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria634Open in IMG/M
3300026332|Ga0209803_1023999All Organisms → cellular organisms → Bacteria → Proteobacteria2971Open in IMG/M
3300026332|Ga0209803_1223416All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria665Open in IMG/M
3300026550|Ga0209474_10553449All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria585Open in IMG/M
3300027381|Ga0208983_1034804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae985Open in IMG/M
3300027471|Ga0209995_1091253All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria524Open in IMG/M
3300027543|Ga0209999_1084477All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria613Open in IMG/M
3300027645|Ga0209117_1198954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300027691|Ga0209485_1335942All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria508Open in IMG/M
3300027748|Ga0209689_1329193All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria586Open in IMG/M
3300027765|Ga0209073_10441958All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria540Open in IMG/M
3300027857|Ga0209166_10114093All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1498Open in IMG/M
3300027903|Ga0209488_11224520All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium504Open in IMG/M
3300028536|Ga0137415_10467642All Organisms → cellular organisms → Bacteria → Proteobacteria1067Open in IMG/M
3300028809|Ga0247824_10670334All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria630Open in IMG/M
3300028812|Ga0247825_10419593All Organisms → cellular organisms → Bacteria → Proteobacteria946Open in IMG/M
3300031538|Ga0310888_10344750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae862Open in IMG/M
3300031538|Ga0310888_10416513All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria791Open in IMG/M
3300031740|Ga0307468_100352320All Organisms → cellular organisms → Bacteria → Proteobacteria1098Open in IMG/M
3300031740|Ga0307468_100911685All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria763Open in IMG/M
3300031943|Ga0310885_10496814All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria664Open in IMG/M
3300032005|Ga0307411_11070323All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria725Open in IMG/M
3300032013|Ga0310906_11383076All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria516Open in IMG/M
3300032017|Ga0310899_10734849All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300032126|Ga0307415_101656426All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria616Open in IMG/M
3300032144|Ga0315910_10591994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae859Open in IMG/M
3300032157|Ga0315912_10964195All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria677Open in IMG/M
3300032163|Ga0315281_10261740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1903Open in IMG/M
3300032174|Ga0307470_10050822All Organisms → cellular organisms → Bacteria → Proteobacteria2122Open in IMG/M
3300032180|Ga0307471_100524563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1335Open in IMG/M
3300032205|Ga0307472_101837879All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria603Open in IMG/M
3300032211|Ga0310896_10887470All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria515Open in IMG/M
3300032892|Ga0335081_12626161All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria516Open in IMG/M
3300033412|Ga0310810_10251249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae1945Open in IMG/M
3300033433|Ga0326726_12281390All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria526Open in IMG/M
3300033550|Ga0247829_10625947All Organisms → cellular organisms → Bacteria → Proteobacteria895Open in IMG/M
3300034113|Ga0364937_005927All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1706Open in IMG/M
3300034354|Ga0364943_0208741All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria720Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil11.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.96%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.64%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.64%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.65%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.65%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.99%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.99%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.32%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.32%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.32%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.32%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.32%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.32%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.32%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.32%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.32%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.32%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.32%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.66%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.66%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.66%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton0.66%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.66%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.66%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.66%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.66%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.66%
Termite NestEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.66%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.66%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.66%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.66%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.66%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.66%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.66%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.66%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001850Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2aEnvironmentalOpen in IMG/M
3300002073Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005333Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006169Termite nest microbial communities from Madurai, IndiaEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007790Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projectsEnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011413Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT231_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011440Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012509Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6EnvironmentalOpen in IMG/M
3300012519Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610EnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300020215Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5EnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300024182Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10EnvironmentalOpen in IMG/M
3300024232Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027381Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027471Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032005Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1Host-AssociatedOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
RCM37_104084723300001850Marine PlanktonVAQSAEASRRFIEGARGASLLRMKERMEKAGGMENYDRMVKLHSGS*
JGI24745J21846_104887413300002073Corn, Switchgrass And Miscanthus RhizosphereIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD*
C688J35102_11989135733300002568SoilEASKRFIAGARAASLARMKERMEKSGGMENYDKVINLFTPG*
C688J35102_12039519533300002568SoilDASRRFIEGARAASLTRMKERMEKSGGLENFEKIVNLFTPGPLPK*
JGI25616J43925_1033805713300002917Grasslands SoilPEASKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD*
Ga0063455_10170963613300004153SoilLQKRGLKTISQSPEASKRFIAGARAASLARMKERMEKSGGMENYDKVINLFTPG*
Ga0062590_10229556813300004157SoilQSPEASKRFYEGARSASLQRMKERMEKAGGMENFERIVQLFTPGPLPK*
Ga0063356_10196374013300004463Arabidopsis Thaliana RhizosphereRGIKTVSQSPEASKRFYEGARAASLARMKERMEKSGGTENFERVVQLFTPGPLPK*
Ga0063356_10558264913300004463Arabidopsis Thaliana RhizosphereKRFYEGARAASLQRMKERMEKAGGMENYEKVIQLFTPGPLPK*
Ga0066810_1017747523300005169SoilSKKFVAGARAASLQRMKERMEKAGGMENYDRVVKLFTPE*
Ga0066680_1013146933300005174SoilSQSSEASKKFVTGARAASLARMKERMEKSGGTENYDRVVQLLTPE*
Ga0066685_1063007413300005180SoilKTVAQSPEASTRFVAGARAASLQRMKERMEKAGGMENYDKVVQLFTPG*
Ga0065705_1008803723300005294Switchgrass RhizosphereTVAQSGDASKRFIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN*
Ga0070677_1015770113300005333Miscanthus RhizosphereKRGIKTVEQSPDASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD*
Ga0068869_10160709713300005334Miscanthus RhizosphereRGIKFLSQSEAASKKFVAGARAASLQRMKERMEKSGGMENYDKVIQLFTPN*
Ga0070674_10075578833300005356Miscanthus RhizosphereSKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD*
Ga0070694_10012914213300005444Corn, Switchgrass And Miscanthus RhizosphereAAQKFVAGARAASLARMKERMEKAGGTDNYDKVVQLFTPN*
Ga0066687_1026941513300005454SoilEASKKFVAGARAASLARMKERMEKAGGTENYDKVVQLLTPE*
Ga0070662_10089846813300005457Corn RhizosphereDASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD*
Ga0070730_1018818033300005537Surface SoilSASLTRMKERMEKSGGMENFEKIINLFTPGPLPK*
Ga0070686_10059821613300005544Switchgrass RhizosphereQSPEASKRFVEGARAASLQRMQESMEKAGGMENFQKVLQLFTPGPLPK*
Ga0070696_10042012833300005546Corn, Switchgrass And Miscanthus RhizosphereEASKRFVEGARSASLARMKERMEKSGGMENFEKIVNLLTPGPLPK*
Ga0070696_10123817723300005546Corn, Switchgrass And Miscanthus RhizosphereEAAQKFVAGARAASLARMKERMEKAGGTDNYDKVVQLFTPN*
Ga0066701_1081672013300005552SoilSEASKKFVAGARAASLARMKERMEKSGGTETYDRVVQLLTPE*
Ga0068859_10228964013300005617Switchgrass RhizosphereRFIAGARAASLARMKERMEKAGGTENYDKVVQLFTPN*
Ga0074479_1081886413300005829Sediment (Intertidal)KRGMKVLSLGPEASKRFIEGARAASLARMKERMEKSGGMENYDRVVKLLSPL*
Ga0068870_1124772223300005840Miscanthus RhizosphereEASKRFVAGARAASLQRMKERMEKSGGMENYDRVVKLFTPE*
Ga0066696_1039467613300006032SoilFVAGARAASLARMKERMEKAGGTENYDRVVQLFTPE*
Ga0066696_1096040413300006032SoilSPEASKKFVAGARAASLARMKERMEKSGGTENYDRVVQLLTPE*
Ga0082029_124439343300006169Termite NestGARTASLQRMKERMDKLGGAENFERVVQLFTPGPLPK*
Ga0070716_10043348313300006173Corn, Switchgrass And Miscanthus RhizosphereSASLARMKERMEKSGGMENFEKIVNLFTPGPLPK*
Ga0079222_1124297913300006755Agricultural SoilQSPEASKRFVEGARSASLARMKERMEKSGGMENFEKIVNLFTPGPLPK*
Ga0066658_1013602813300006794SoilASKKFVAGARAASVARMKERMEKTGGMENYDKVVQLLTPE*
Ga0066658_1057725613300006794SoilPEASRKFVAGARAASLARMKVRMEKSGGVENYDKVVQLLTPE*
Ga0066659_1087521613300006797SoilIKTLSQSPDASKKFVAGARAASLARMKERMEKSGGMENYDKVVQLLTPE*
Ga0066660_1010384133300006800SoilVAGARAASLARMRERMERSGGMDNYDRVVQLFTPD*
Ga0066660_1143278313300006800SoilLEKRGIKTVSQSAEASKKFVAGARAASLARMKERMEKSGGTENYDRVVKLLTPE*
Ga0079220_1040433033300006806Agricultural SoilARSASLARMKERMEKSGGLENFERVVQLFTPGPLPK*
Ga0075421_10055775533300006845Populus RhizosphereAKRGIKTVAQSPDASKRFIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN*
Ga0075434_10004254513300006871Populus RhizosphereFVEGARAASLARMKERMEKSGGMENFEKVVNLFTPGPLPK*
Ga0075434_10140612333300006871Populus RhizosphereFVAGARAASLQRMKERMEKSGGMENYDKVIHLFTPN*
Ga0079217_1156508013300006876Agricultural SoilAQSPDAAKRFAEGARSASLARMKERMQKSGGMENFEKVIQLFTPGPLPK*
Ga0079215_1104765423300006894Agricultural SoilSASASKRFYEGARSASLARMKERMEKAGGMENYDKVIQLFTPGS*
Ga0075424_10098569313300006904Populus RhizosphereASKKFVAGARAASLQRMKERMEKAGGMENYDRVVKLFTPG*
Ga0079219_1105635623300006954Agricultural SoilKTVAQSPEASKRFVEGARSASLARMKERMEKAGGMENFEKVVNLFTPGPLPK*
Ga0079219_1175165423300006954Agricultural SoilVEGARSASLQRMKERMEKAGGMENFEKIIHLFTPGPLPK*
Ga0079218_1327231713300007004Agricultural SoilKTLSQSPEASKKFVAGARTASLQRMRERMEKAGGMENYDKVVKLFTPE*
Ga0099794_1014429813300007265Vadose Zone SoilKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD*
Ga0105679_1076468033300007790SoilSPDAAKRFYAGARSASLARMKERMEKAGGVKNYDKVVQLFTPF*
Ga0105107_1069606923300009087Freshwater SedimentKKRGIKTLSQSPEASKKFVAGARTASLQRMKERMEKAGGMENYDKVVKLFTPD*
Ga0111539_1173198233300009094Populus RhizosphereKKFVAGARAASLQRMKERMEKSGGMENYDKVIQLFTPN*
Ga0105243_1207221013300009148Miscanthus RhizosphereFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD*
Ga0111538_1412297823300009156Populus RhizospherePEAAQKFVAGARAASLARMKERMEKAGGTENYDKVVQLFTPN*
Ga0075423_1180974013300009162Populus RhizosphereVAQSPDASKRFYAGARSASLARMKERMEKSGGMENYDKIVQLFTPF*
Ga0105242_10004003133300009176Miscanthus RhizosphereIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN*
Ga0126310_1160789023300010044Serpentine SoilVAQSPEASRRFYQGARTASLARMKERMEKAGGMENYDKVVQLFTPD*
Ga0126376_1285332913300010359Tropical Forest SoilKKFVAGARAASLQRMKERMEKSGGMENYDKVVHLFSPE*
Ga0134066_1002938733300010364Grasslands SoilEASKRFVEGARSASLTRMKERMEKSGGMENFEKVIQLFTPGPLPK*
Ga0134066_1033253313300010364Grasslands SoilKFVDGARAASLARMKERMEKAGGMENYERVVQLLSPE*
Ga0136847_1039319933300010391Freshwater SedimentSKRFVAGARAASLARMKERMEKSGGMENYDRVVQLLTPG*
Ga0134123_1013200333300010403Terrestrial SoilSPEAAQKFVAGARAASLARMKERMEKAGGTENYDKVVQLFTPN*
Ga0134123_1190544613300010403Terrestrial SoilRYLPQSEAASKKFVAGARAASLQRMKERMEKAGGMENYDKVVKLFTPG*
Ga0137333_111496223300011413SoilRTISQSPEASKRFYEGARAASLTRMKERMEKAGGMENYEKVIQLFTPGPLPK*
Ga0137428_120563623300011432SoilRFYEGARAASLQRMKERMEKAGGLENYEKIIQLFTPGPLPK*
Ga0137433_116507723300011440SoilIKTVSQSPEASKRFYEGARAASLQRMKERMEKAGGMENYDKVVKLFTPG*
Ga0137463_118859533300011444SoilSKKFVAGARAASLQRMKERMEKSGGTENYDKVVKLFTPE*
Ga0137389_1033340733300012096Vadose Zone SoilKRFYEGARSASLTRMKERMEKSSGTENYDRVVKLLTPE*
Ga0137352_103331933300012164SoilFYEGARAASLTRMKERMEKAGGMENYEKVIQLFTPGPLPK*
Ga0137388_1162767013300012189Vadose Zone SoilKTSSQSPEASKRFVAGARAASLARMKERMEKSGGMENYDRVVQLFTPD*
Ga0137399_1018590033300012203Vadose Zone SoilEGARSASLARMKERMEKAGGMENFEKIVQLFTPGPLPK*
Ga0137378_1032771413300012210Vadose Zone SoilLAQRGIKTLAQSPDASRRFVAGARAASLARMKERTEKAGGMENYERVVQLFTPG*
Ga0137435_114362523300012232SoilVSQSAEASKKFVAGARAASLQRMKERMEKSGGTENYDKVVKLFTPE*
Ga0137387_1102651523300012349Vadose Zone SoilKFVAGARAASLARMKERMEKSGGTENYDRVVKLLTPE*
Ga0137361_1087874313300012362Vadose Zone SoilVSQSAEASKKFDAGARAASLQRMKERMGEAGGTENYDRVVQLFTPE*
Ga0150984_11206872313300012469Avena Fatua RhizosphereKKFVAGARAASLQRMKERMEKSGGTENYDRVVKLFTPE*
Ga0157334_102334613300012509SoilAQSGDAAKRFIAGARAASLQRMKERMEKAGGMENYDQVVKLFTPN*
Ga0157352_110682923300012519Unplanted SoilGDASRRFIAGARAASLQRMKERMDKAGGMENYDQVVKLFTPN*
Ga0137358_1052614633300012582Vadose Zone SoilSPEASKRFVEGARSASLARMKERMEKAGGMEHFEKIVQLFTPGPLPK*
Ga0137359_1078502633300012923Vadose Zone SoilSPEASKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD*
Ga0137419_1129342323300012925Vadose Zone SoilSSEASKKFVAGARAASLARMKERMEKSGSTENYDRVVQLLTPE*
Ga0137416_1080783613300012927Vadose Zone SoilSPDASKRFVAGARAASLARMKERTEKAGGMENYDRIVQLFTPG*
Ga0137416_1160746613300012927Vadose Zone SoilQSPDASKRFVAGARAASLARMKERMEKAGGMENYERVVQLFTPG*
Ga0137407_1028071333300012930Vadose Zone SoilPEASKRFVAGARAASLLRMKERMEKAGGMENYDRVVQLFTPG*
Ga0137410_1001155983300012944Vadose Zone SoilAEASKKFVAGARAASLQRMKERMEKSGSAENYDRVVKLFTPE*
Ga0137410_1076247133300012944Vadose Zone SoilGARAASLQRMKERMEKAGGMEHFEKIVQLFTPGPLPK*
Ga0164302_1196505923300012961SoilEGARSASLARMKERMEKSGGMENFEKIVNLFTPGPLPK*
Ga0164309_1015563313300012984SoilKRFIAGARAASLARMKERMEKSGGTENYDKMVKLFTPD*
Ga0157378_1103746933300013297Miscanthus RhizosphereIDGARAASLARSKERMEKSGGTENYDKMVKLFTPD*
Ga0182001_1030620513300014488SoilQSPEASKRFVEGARSASLQRMKDRMQKSGGTENFEKVVQLFTPGPLPK*
Ga0180065_116455223300014878SoilQSDAASKKFVAGARAASLQRMKERMEKSGGMENYDKVIKLFTPG*
Ga0134072_1048084523300015357Grasslands SoilFVAGARAASLARMKERMEKSGGMENYDKVVQLFTPE*
Ga0134089_1002680633300015358Grasslands SoilAQRGIKTLAQSPEASRRFVAGARAASLARMKERTEKAGGMENYERVVQLFTPG*
Ga0132256_10011881243300015372Arabidopsis RhizosphereARAASLARMKERMEKSGGMENFEKVIKLFTPGPLPK*
Ga0184604_1019923323300018000Groundwater SedimentQAPQASRKFVAGARAASLQRMKERMEKAGGMENYDKVIQLFTPG
Ga0184615_1043849413300018059Groundwater SedimentRGIKTLKQGPEASKKFVAGARTASLQRMKERMEKAGGMENYDKVVKLFTPE
Ga0190265_1009034413300018422SoilQSPDASKRFVQGARAASLARMKERMEKAGGMENYDKVVQLFTPG
Ga0190265_1173462833300018422SoilQSPEASKRVCEGARAASLQRMKERMEKAGGLENFEKIVQLFTPGPLPK
Ga0190272_1267746523300018429SoilKTLSQSPEASKKFVAGARTASLQRMRERMEKAGGMENYDKVVKLFTPE
Ga0190272_1278854613300018429SoilPEASKKFIAGARAASLQRMKERMEKAGGMENYDKVVKLFTPD
Ga0066667_1033624113300018433Grasslands SoilQSPDASRRFVAGARAASLARMKERTEKAGGMENYERIVQLFTPG
Ga0190271_1230304113300018481SoilKFVAGARAASLQRMKDRMEKSGGMENYDKVVKLFTPE
Ga0193717_116963513300020060SoilSDAASKKFVDGARAASLQRMKERMEKSGGMENYDKVIKLFTPG
Ga0194113_1106496013300020074Freshwater LakeTVNQAADASRRFSSGARAASLARMKERMEKAGGMENYDRVVQLFTPN
Ga0196964_1016904913300020202SoilRAASLQRMKERMQKAGGTDNFEKVVQLFTPGPLPK
Ga0196963_1026111923300020215SoilEEASKRFVEGARAASLQRMKDRMQKAGGMENFEKVVQLFTPGPLPK
Ga0194119_1009933513300020220Freshwater LakeKTVNQSADASRRFSSGARAASLARMKERMEKAGGMENYDRVVQLFTPN
Ga0247801_103009023300023064SoilQEEFAKRGIKSVAQLPDASKRFIVGARAVSLQRMKERIEKAGGMENYDKVVKLFTPD
Ga0247669_106770313300024182SoilSKRFIEGARAASLQRMKERMEKAGGMENFEKVVNLFTPGPLPK
Ga0247664_107737733300024232SoilTVAQSGDASKRFIAGARAASLQRMKERMEKAGGMENYDKIVQLFTPG
Ga0207697_1017712813300025315Corn, Switchgrass And Miscanthus RhizosphereIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD
Ga0207670_1161930823300025936Switchgrass RhizosphereGARAASLQRMKERMEKAGGMENFEKVVQLFTPGPLPK
Ga0207648_1131608613300026089Miscanthus RhizosphereRFIAGARAASLQRMKERMEKAGGMENFEKIINLFTPGPLPK
Ga0209154_104207343300026317SoilAQSPEASRRFVAGARAASLARMKERTEKVGGMENYERVVQLFTPG
Ga0209802_124062223300026328SoilRRGIKTLSQSSEASKKFVTGARAASLARMKERMEKSGGTENYDRVVQLLTPE
Ga0209803_102399953300026332SoilRGIKTLAQSPDASRRFVAGARAASLARMKERTEKAGGMENYDRIVQLFTPG
Ga0209803_122341613300026332SoilSPEASRRFVAGARAASLARMKERMEKAGGMENYERVVQLFTPG
Ga0209474_1055344923300026550SoilVAGARAASLARMKERVEKAGGMENYDRVVQLLSPE
Ga0208983_103480413300027381Forest SoilLSQSPEASKRFVAGARAASLARMKERMEKSGGMDNYDRVVQLFTPD
Ga0209995_109125313300027471Arabidopsis Thaliana RhizospherePQSDEASKRFVEGARAASLQRMKERIEKAGGMENFQKVVQLLTPGPLPK
Ga0209999_108447723300027543Arabidopsis Thaliana RhizosphereEGARAASLARMKERMEKSGGMENYEKVIQLFTPGPLPK
Ga0209117_119895413300027645Forest SoilSPDASKRFYEGARAASLARMKERMEKSGGMENFEKVIQLFTPGPLPK
Ga0209485_133594223300027691Agricultural SoilYEGARSASLARMKERMEKAGGMENYDKVIQLFTPGS
Ga0209689_132919313300027748SoilEASKRFVAGARTASLARMKERMEKAGGTENYDKVVQLFTPE
Ga0209073_1044195823300027765Agricultural SoilTVAQSPEASKRFVEGARSASLQRMKERMEKAGGMENFEKIIHLFTPGPLPK
Ga0209166_1011409313300027857Surface SoilRFVEGARSASLTRMKERMEKSGGMENFEKIINLFTPGPLPK
Ga0209488_1122452023300027903Vadose Zone SoilGIKTLSQSPEASKRFVAGARAASLARMKERTEKAGGMENYDRVVQLFTPG
Ga0137415_1046764233300028536Vadose Zone SoilASKRFVAGARAASLARMKERTEKAGGMENYDRVVQLFTPG
Ga0247824_1067033413300028809SoilVAQSPEASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD
Ga0247825_1041959333300028812SoilLKTVAQSPEASKRFYEGARSASLARMKERMEKAGGMENYDKVIQLFTPGK
Ga0310888_1034475013300031538SoilQSDEASKRFVAGARAASLQRMKERMEKAGGMENYDKVVKLFTPG
Ga0310888_1041651313300031538SoilVAQSGDASKRFIDGARAASLQRMKERMEKAGGMENYDQVVKLFTPN
Ga0307468_10035232033300031740Hardwood Forest SoilTVSQSPEASKRFVEGARAASLARMKERMEKAGGMENFEKIVQLFTPGPLPK
Ga0307468_10091168533300031740Hardwood Forest SoilDAASKKFVAGARAASLQRMKERMEKSGGMDNYDQVVKLFTPG
Ga0310885_1049681423300031943SoilRQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK
Ga0307411_1107032313300032005RhizosphereKRGIKTLSQSPEASKKFVAGARTASLQRMRERMEKAGGMENYDKVVKLFTPD
Ga0310906_1138307623300032013SoilVEGARQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK
Ga0310899_1073484913300032017SoilIKTIAQSPEASKRFVEGARQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK
Ga0307415_10165642623300032126RhizosphereSEAASKKFVDGARAASLQRMKERMEKAGGMENYDKVVKLFTPD
Ga0315910_1059199433300032144SoilKKFVAGARAASLQRMKDRMEKSGGMENYEKVVKIFTPG
Ga0315912_1096419513300032157SoilDAASKKFVAGARAASLQRMKERMEKSGGMENYDQVVKLFTPG
Ga0315281_1026174033300032163SedimentSADASKRFVAGARAASLQRMKERMEKAGGTENYDKVVQLLSPD
Ga0307470_1005082243300032174Hardwood Forest SoilARAASLARMKERMEKAGGMENFEKIVQLFTPGPLPK
Ga0307471_10052456313300032180Hardwood Forest SoilFVAGARAASLARMKERMEKSGGMENYDRVVQLFTPD
Ga0307472_10183787913300032205Hardwood Forest SoilIKTLEQSAGAAKRFTDGARAASLQRMKERMEKSGGMENYDKVIQLFTPN
Ga0310896_1088747023300032211SoilRFVEGARQASLTRMKERMEKAGGMENFEKIINLFTPGPLPK
Ga0335081_1262616113300032892SoilGMKTLSQSPDASKKFIAGARAASLQRMKERMEKAGGMENYDKVVQLFSPG
Ga0310810_1025124913300033412SoilIKSVAQSPDASKRFIAGARAASLQRMKERIEKAGGMENYDKVVKLFTPD
Ga0326726_1228139013300033433Peat SoilSKRFIAGARAASLARMKERMEKAGGTENYDRVIKLFTPE
Ga0247829_1062594723300033550SoilVAQSPDASKRFYAGARSASLARMKERMEKAGGLENYDKVVTLFTPF
Ga0364937_005927_1560_17003300034113SedimentMAQSADAAKRFNAGARSASLARMKERMEKAGGTENFDRVVQLFTPG
Ga0364943_0208741_571_7113300034354SedimentMAQSADAAKKFNAGARSASLARMKERLEKAGGTENYDRVVQLFTPG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.