Basic Information | |
---|---|
Family ID | F046039 |
Family Type | Metagenome |
Number of Sequences | 152 |
Average Sequence Length | 40 residues |
Representative Sequence | MSQLTFNLQPDRRSLTVSELTARIRDLLAKNFTDILVEGE |
Number of Associated Samples | 130 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 64.47 % |
% of genes near scaffold ends (potentially truncated) | 96.71 % |
% of genes from short scaffolds (< 2000 bps) | 86.18 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (80.921 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.632 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.237 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.368 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 22.06% β-sheet: 0.00% Coil/Unstructured: 77.94% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF11146 | DUF2905 | 11.84 |
PF00210 | Ferritin | 6.58 |
PF01546 | Peptidase_M20 | 5.26 |
PF00549 | Ligase_CoA | 1.97 |
PF02652 | Lactate_perm | 1.97 |
PF00334 | NDK | 1.97 |
PF01850 | PIN | 1.97 |
PF00248 | Aldo_ket_red | 1.97 |
PF12704 | MacB_PCD | 1.32 |
PF00288 | GHMP_kinases_N | 0.66 |
PF06827 | zf-FPG_IleRS | 0.66 |
PF13742 | tRNA_anti_2 | 0.66 |
PF08448 | PAS_4 | 0.66 |
PF14534 | DUF4440 | 0.66 |
PF02629 | CoA_binding | 0.66 |
PF00069 | Pkinase | 0.66 |
PF02518 | HATPase_c | 0.66 |
PF04014 | MazE_antitoxin | 0.66 |
PF01047 | MarR | 0.66 |
PF13411 | MerR_1 | 0.66 |
PF01909 | NTP_transf_2 | 0.66 |
PF09335 | SNARE_assoc | 0.66 |
PF07722 | Peptidase_C26 | 0.66 |
PF06831 | H2TH | 0.66 |
PF02601 | Exonuc_VII_L | 0.66 |
PF09278 | MerR-DNA-bind | 0.66 |
PF13458 | Peripla_BP_6 | 0.66 |
PF02604 | PhdYeFM_antitox | 0.66 |
PF00106 | adh_short | 0.66 |
PF00072 | Response_reg | 0.66 |
PF04011 | LemA | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.63 |
COG0045 | Succinyl-CoA synthetase, beta subunit | Energy production and conversion [C] | 1.97 |
COG0074 | Succinyl-CoA synthetase, alpha subunit | Energy production and conversion [C] | 1.97 |
COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 1.97 |
COG1620 | L-lactate permease | Energy production and conversion [C] | 1.97 |
COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.66 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.66 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.66 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.66 |
COG1570 | Exonuclease VII, large subunit | Replication, recombination and repair [L] | 0.66 |
COG1704 | Magnetosome formation protein MamQ, lipoprotein antigen LemA family | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.66 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 80.92 % |
Unclassified | root | N/A | 19.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000559|F14TC_102629558 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
3300000651|AP72_2010_repI_A10DRAFT_1042869 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300000955|JGI1027J12803_100107646 | All Organisms → cellular organisms → Bacteria | 1736 | Open in IMG/M |
3300004092|Ga0062389_102731925 | Not Available | 658 | Open in IMG/M |
3300005167|Ga0066672_10010083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4506 | Open in IMG/M |
3300005445|Ga0070708_102121578 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300005467|Ga0070706_101755149 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
3300005545|Ga0070695_100699464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 804 | Open in IMG/M |
3300005560|Ga0066670_10522274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 728 | Open in IMG/M |
3300005586|Ga0066691_10131975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1426 | Open in IMG/M |
3300005764|Ga0066903_103468457 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300005841|Ga0068863_100040640 | All Organisms → cellular organisms → Bacteria | 4422 | Open in IMG/M |
3300005843|Ga0068860_101684325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
3300006163|Ga0070715_10604782 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
3300006173|Ga0070716_101030999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300006797|Ga0066659_10837193 | Not Available | 764 | Open in IMG/M |
3300006797|Ga0066659_11920972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 503 | Open in IMG/M |
3300007255|Ga0099791_10503987 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300009038|Ga0099829_10571413 | All Organisms → cellular organisms → Bacteria | 940 | Open in IMG/M |
3300009088|Ga0099830_11118193 | Not Available | 653 | Open in IMG/M |
3300009089|Ga0099828_10253501 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
3300009090|Ga0099827_11661386 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 556 | Open in IMG/M |
3300009137|Ga0066709_100854037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1323 | Open in IMG/M |
3300009524|Ga0116225_1522467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 527 | Open in IMG/M |
3300010043|Ga0126380_10497634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
3300010048|Ga0126373_10892529 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300010048|Ga0126373_10919718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
3300010304|Ga0134088_10411383 | Not Available | 660 | Open in IMG/M |
3300010339|Ga0074046_10078039 | All Organisms → cellular organisms → Bacteria | 2155 | Open in IMG/M |
3300010360|Ga0126372_10941836 | All Organisms → cellular organisms → Bacteria | 870 | Open in IMG/M |
3300010361|Ga0126378_10649868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
3300010361|Ga0126378_11528559 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 757 | Open in IMG/M |
3300010376|Ga0126381_102995466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
3300010379|Ga0136449_101549327 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300010398|Ga0126383_10711948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1083 | Open in IMG/M |
3300011270|Ga0137391_10745349 | Not Available | 811 | Open in IMG/M |
3300011270|Ga0137391_10780401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
3300011271|Ga0137393_11181957 | Not Available | 649 | Open in IMG/M |
3300012198|Ga0137364_10622912 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300012198|Ga0137364_11176247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
3300012199|Ga0137383_11351978 | Not Available | 506 | Open in IMG/M |
3300012201|Ga0137365_10610734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300012202|Ga0137363_10124935 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1990 | Open in IMG/M |
3300012210|Ga0137378_11490763 | Not Available | 588 | Open in IMG/M |
3300012349|Ga0137387_10134251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1753 | Open in IMG/M |
3300012351|Ga0137386_10276862 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
3300012351|Ga0137386_10938550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 618 | Open in IMG/M |
3300012356|Ga0137371_11053307 | Not Available | 614 | Open in IMG/M |
3300012357|Ga0137384_10171667 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae | 1815 | Open in IMG/M |
3300012362|Ga0137361_11006612 | Not Available | 753 | Open in IMG/M |
3300012582|Ga0137358_10215899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1308 | Open in IMG/M |
3300012582|Ga0137358_10297222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1096 | Open in IMG/M |
3300012683|Ga0137398_10605788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300012683|Ga0137398_11143217 | Not Available | 534 | Open in IMG/M |
3300012685|Ga0137397_10660122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 777 | Open in IMG/M |
3300012685|Ga0137397_11111727 | Not Available | 575 | Open in IMG/M |
3300012918|Ga0137396_10083169 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300012925|Ga0137419_10611944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
3300012929|Ga0137404_10184448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1759 | Open in IMG/M |
3300012929|Ga0137404_10843126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 834 | Open in IMG/M |
3300012931|Ga0153915_11063177 | Not Available | 944 | Open in IMG/M |
3300012948|Ga0126375_10062481 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
3300012957|Ga0164303_11295926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
3300012971|Ga0126369_10072329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3030 | Open in IMG/M |
3300012971|Ga0126369_10757429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1051 | Open in IMG/M |
3300014154|Ga0134075_10041154 | All Organisms → cellular organisms → Bacteria | 1895 | Open in IMG/M |
3300014169|Ga0181531_10045375 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
3300015053|Ga0137405_1264413 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
3300015054|Ga0137420_1186916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1975 | Open in IMG/M |
3300015241|Ga0137418_10229577 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300015242|Ga0137412_10680732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300015245|Ga0137409_11286850 | Not Available | 573 | Open in IMG/M |
3300015356|Ga0134073_10048749 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1129 | Open in IMG/M |
3300015374|Ga0132255_100213738 | All Organisms → cellular organisms → Bacteria | 2735 | Open in IMG/M |
3300016341|Ga0182035_10081354 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
3300016371|Ga0182034_10753556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 831 | Open in IMG/M |
3300016371|Ga0182034_11436507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300016371|Ga0182034_11942841 | Not Available | 520 | Open in IMG/M |
3300016445|Ga0182038_10401599 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1149 | Open in IMG/M |
3300017822|Ga0187802_10424038 | Not Available | 528 | Open in IMG/M |
3300017933|Ga0187801_10020096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2264 | Open in IMG/M |
3300017972|Ga0187781_10347394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1056 | Open in IMG/M |
3300017995|Ga0187816_10348378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 654 | Open in IMG/M |
3300018086|Ga0187769_10713278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 758 | Open in IMG/M |
3300018433|Ga0066667_10907954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
3300020004|Ga0193755_1006902 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3684 | Open in IMG/M |
3300020579|Ga0210407_11010757 | Not Available | 634 | Open in IMG/M |
3300020579|Ga0210407_11164280 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300020579|Ga0210407_11194667 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
3300020581|Ga0210399_10143897 | All Organisms → cellular organisms → Bacteria | 1969 | Open in IMG/M |
3300020581|Ga0210399_10330264 | Not Available | 1273 | Open in IMG/M |
3300020581|Ga0210399_10332844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 1268 | Open in IMG/M |
3300021088|Ga0210404_10543887 | Not Available | 658 | Open in IMG/M |
3300021168|Ga0210406_10212297 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300021170|Ga0210400_11224546 | Not Available | 604 | Open in IMG/M |
3300021171|Ga0210405_10963461 | Not Available | 645 | Open in IMG/M |
3300021180|Ga0210396_11091824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 672 | Open in IMG/M |
3300021401|Ga0210393_10084375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2519 | Open in IMG/M |
3300021405|Ga0210387_10869553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300021420|Ga0210394_10222966 | All Organisms → cellular organisms → Bacteria | 1647 | Open in IMG/M |
3300021475|Ga0210392_11376249 | Not Available | 528 | Open in IMG/M |
3300021477|Ga0210398_11282267 | Not Available | 576 | Open in IMG/M |
3300021559|Ga0210409_11344491 | Not Available | 590 | Open in IMG/M |
3300024246|Ga0247680_1048247 | Not Available | 618 | Open in IMG/M |
3300024310|Ga0247681_1010923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1234 | Open in IMG/M |
3300024330|Ga0137417_1334062 | Not Available | 3553 | Open in IMG/M |
3300024330|Ga0137417_1360790 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300024331|Ga0247668_1054257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
3300025922|Ga0207646_10159724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2033 | Open in IMG/M |
3300025939|Ga0207665_10681505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
3300026296|Ga0209235_1218850 | Not Available | 620 | Open in IMG/M |
3300026319|Ga0209647_1216110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
3300026322|Ga0209687_1148370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
3300026469|Ga0257169_1029613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
3300026551|Ga0209648_10101833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2351 | Open in IMG/M |
3300026557|Ga0179587_11005710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
3300027045|Ga0207726_1037939 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300027671|Ga0209588_1009170 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
3300027826|Ga0209060_10223267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 865 | Open in IMG/M |
3300027846|Ga0209180_10136149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1412 | Open in IMG/M |
3300027875|Ga0209283_10735471 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300027875|Ga0209283_10887942 | Not Available | 540 | Open in IMG/M |
3300027905|Ga0209415_10068418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4256 | Open in IMG/M |
3300027911|Ga0209698_10799598 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
3300028281|Ga0247689_1070929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300028381|Ga0268264_10362157 | All Organisms → cellular organisms → Bacteria | 1383 | Open in IMG/M |
3300028906|Ga0308309_10310248 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
3300031057|Ga0170834_101839124 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300031128|Ga0170823_15152813 | All Organisms → cellular organisms → Bacteria | 1422 | Open in IMG/M |
3300031231|Ga0170824_109138050 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300031446|Ga0170820_15643872 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
3300031544|Ga0318534_10475938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 714 | Open in IMG/M |
3300031708|Ga0310686_102619035 | Not Available | 548 | Open in IMG/M |
3300031708|Ga0310686_103451522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 777 | Open in IMG/M |
3300031718|Ga0307474_10011357 | All Organisms → cellular organisms → Bacteria | 6452 | Open in IMG/M |
3300031720|Ga0307469_10256551 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
3300031820|Ga0307473_10590672 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
3300031897|Ga0318520_10868444 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300031910|Ga0306923_11048494 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
3300031941|Ga0310912_10475473 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300031941|Ga0310912_11209189 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300031947|Ga0310909_10488481 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
3300031962|Ga0307479_10549931 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300032076|Ga0306924_10742709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1099 | Open in IMG/M |
3300032174|Ga0307470_11918646 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
3300032180|Ga0307471_100483078 | All Organisms → cellular organisms → Bacteria | 1384 | Open in IMG/M |
3300032180|Ga0307471_104328949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
3300032261|Ga0306920_102898201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 650 | Open in IMG/M |
3300032828|Ga0335080_10032891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5677 | Open in IMG/M |
3300032892|Ga0335081_10855975 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_67_21 | 1078 | Open in IMG/M |
3300032893|Ga0335069_10077842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117 | 4246 | Open in IMG/M |
3300033983|Ga0371488_0091581 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.63% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.61% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.61% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.61% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.29% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.97% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.97% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.97% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.32% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.32% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.66% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.66% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.66% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.66% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.66% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.66% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.66% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027045 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TC_1026295581 | 3300000559 | Soil | MSQLTFNLQPERRSLTVSELTARIRDLLARNFIDVLVEGEISN |
AP72_2010_repI_A10DRAFT_10428692 | 3300000651 | Forest Soil | MSQLMFNLQPERRSLTVSELTARIRDLLAKNFVDVLVEGE |
JGI1027J12803_1001076461 | 3300000955 | Soil | MGQLTFNLQPERRSLTVGELTARIRDLLAKNFVDVLVEGEISNCRE |
Ga0062389_1027319251 | 3300004092 | Bog Forest Soil | VSQLQFNLIPEKKIWTVSELTGRIRELLAAAFPGIWVEGE |
Ga0066672_100100831 | 3300005167 | Soil | MTQQLTFNLMPTRHTFTVSELTGKIRDLLAKNFTDISVQGEISNCRA |
Ga0070708_1021215781 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLATMSQLTFNLQPERRSLTVTELTSRIRDLLAKNFTDI |
Ga0070706_1017551492 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHETMSQLTFNLQPERRSLTVTELTSRIRDLLAKNFTDI |
Ga0070695_1006994643 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQLQFNLRPERRIFSVTELTGSIRDLFTRNFTDIFVEGEISNCHAA |
Ga0066670_105222741 | 3300005560 | Soil | MAQLQFNLMPERRVWSVSELTARVRDLLGRSFTDI |
Ga0066691_101319755 | 3300005586 | Soil | MTQQLTFNMMPDRKTWTVSELTGKIRDLLAKNFTDIS |
Ga0066903_1034684571 | 3300005764 | Tropical Forest Soil | MGQLTFNLQPDRRSLTVSELTARIRDLFAKSFVNVLVEGEISNCR |
Ga0068863_1000406405 | 3300005841 | Switchgrass Rhizosphere | MGQLTFNLQPERRSLTVSELTARIRDLLAKNFVDV |
Ga0068860_1016843251 | 3300005843 | Switchgrass Rhizosphere | MSQLTFNLQPERRSLTVSELTARVRDLLAKNFIDVLVE |
Ga0070715_106047822 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQLTFNLQPDRRSLTVSELTARIRDLLAKNFTEIQVEGE |
Ga0070716_1010309991 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEQLTFDLMPERRAWTVSELTLKIRDLLARNFTGI |
Ga0066659_108371933 | 3300006797 | Soil | MTQQLAFNLQPTRHTFTVSELTGKIRDLLAKNFTDISVQGEIS |
Ga0066659_119209721 | 3300006797 | Soil | MTEQLTFNLMPDRKTWTVSELTGKIRDLLAKNFTDISVQGE |
Ga0099791_105039871 | 3300007255 | Vadose Zone Soil | MTQQLTFNLMPDRKTFTVSELTGKIRDLLAKNFTDISVQGEVSNC |
Ga0099829_105714134 | 3300009038 | Vadose Zone Soil | VDGSKTQLTFNLQPERRIYTVSDLTARIRELLAKNFT |
Ga0099830_111181931 | 3300009088 | Vadose Zone Soil | MSQLQFNLMPDRRAFTVTELTAKIRDLFAGNFTDIW |
Ga0099828_102535013 | 3300009089 | Vadose Zone Soil | MTQLTFNLMPEKRIWTVSELTARIRDLLAKNFTDISV |
Ga0099827_116613862 | 3300009090 | Vadose Zone Soil | MTQQLTFNLMPNRKTWTVSELTGKIRDLLVKNFTDIS |
Ga0066709_1008540373 | 3300009137 | Grasslands Soil | MTQQLSFNLMPGRKTFTVSELTGKIRDLLAKNFTDISVQGEISNCR* |
Ga0116225_15224671 | 3300009524 | Peatlands Soil | MDQLQLNLQPERRVFTVSDLTARIRDLLAKNFTDISV |
Ga0126380_104976341 | 3300010043 | Tropical Forest Soil | MGQLTFNLQPERRSITVSELTARIRDLLARNFVDVL |
Ga0126373_108925291 | 3300010048 | Tropical Forest Soil | MGQLTFNLQPERRMYTVSDLTARIRELLAKNFTDVTVQGEISNCR |
Ga0126373_109197181 | 3300010048 | Tropical Forest Soil | MSTQFQLNLMPERRVWTVTELTGRIRDLFTRNFTDIWVE |
Ga0134088_104113832 | 3300010304 | Grasslands Soil | MTRQLTFNLMPDRKTWTVSELTGKIRDLLAKNFTDISVQ |
Ga0074046_100780391 | 3300010339 | Bog Forest Soil | MDQLQLNLQPERRVFTVSDLTARIRDLLAKNFTDI |
Ga0126372_109418362 | 3300010360 | Tropical Forest Soil | MSQLTFNLQPTRTVLTVSELTARVRDLLAKNFFDIFVQGE |
Ga0126378_106498682 | 3300010361 | Tropical Forest Soil | MSQLTFNLQPTRTVLTVSELTARIRDLLARNFTDIFVQGEI |
Ga0126378_115285592 | 3300010361 | Tropical Forest Soil | VDISNAQLTFNLQPERRVYTVSDLTARLRDLLAKNFT |
Ga0126381_1029954661 | 3300010376 | Tropical Forest Soil | MSQLTFNLQPARRSLTVGELTARIRDLLVKNFADVLVEGEVSNCREAQ |
Ga0136449_1015493273 | 3300010379 | Peatlands Soil | MSQLTFNLQPEKRIYTVSDLTARIRDLLAKNFTDINVQGEIS |
Ga0126383_107119482 | 3300010398 | Tropical Forest Soil | MSQLTFNLQPTRQILTVSELTGRIRDLLARNFTDIFVQGEI |
Ga0137391_107453491 | 3300011270 | Vadose Zone Soil | MTEQLTFNLMPDRKTWTVSELTARIRDLLAKNFTDISVQGE |
Ga0137391_107804012 | 3300011270 | Vadose Zone Soil | MSQLTFNLQPDRRSLTVSELTAQLRDLLAKNFTDILVEGEIS |
Ga0137393_111819572 | 3300011271 | Vadose Zone Soil | MTQLQFNLMPDRRAFTVSELTAKIRDLFARNFTDIWVTGEIS |
Ga0137364_106229122 | 3300012198 | Vadose Zone Soil | LTQQLTFNLMPDRKTWTVSELTAKIRDLLSKNFTDISVQGE |
Ga0137364_111762472 | 3300012198 | Vadose Zone Soil | MTQQLTFNLMPDRKTWTVSELTAKIRDLLSKNFTDISVQGE |
Ga0137383_113519781 | 3300012199 | Vadose Zone Soil | MTQQLTFNLLPTRPVWTVSELTARIRDLLAKNFTDIS |
Ga0137365_106107341 | 3300012201 | Vadose Zone Soil | MRHATMSQLTFNLQPERRSLTVTELTSRIRDLLAKNFTEIL |
Ga0137363_101249352 | 3300012202 | Vadose Zone Soil | MSQLQFNLMPDRRAFTVTELTAKIRDLFARNFTDIWVT |
Ga0137378_114907631 | 3300012210 | Vadose Zone Soil | MTQQLTFNLLPTRPVWTVSELTARIRDLLAKNFTDISVQGEIS |
Ga0137387_101342511 | 3300012349 | Vadose Zone Soil | MTEQLTFNLMPDRKTWTVSELTGKIRDLLAKNFTDISVQGEI |
Ga0137386_102768621 | 3300012351 | Vadose Zone Soil | MTQQLTFNLMPDRKIWTVSELTAKIRDLLSKNFTDISVQGEISN |
Ga0137386_109385501 | 3300012351 | Vadose Zone Soil | MTQQLTFNLLPTRPVWTVSELTARIRDLLAKNFTDISVQGEMSKCREA |
Ga0137371_110533071 | 3300012356 | Vadose Zone Soil | MTQQLTFNLLPTRPVWTVSELTARIRDLLAKNFTDI |
Ga0137384_101716671 | 3300012357 | Vadose Zone Soil | MTRQLTFNLMPTRKTFTVSELTAKIRDLLAKNFTDISVQGEV |
Ga0137361_110066122 | 3300012362 | Vadose Zone Soil | MTQQLTFNLMPTRPVWTVSELTARIRDLLAKNFTDISVQGE |
Ga0137358_102158993 | 3300012582 | Vadose Zone Soil | MTQQLTFNLQPTRKAWTVSELTAKIRDLLAKNFTD |
Ga0137358_102972223 | 3300012582 | Vadose Zone Soil | MTRHLTFNLMPDRKTFTVSELTGKIRDLLAKNFTDISVQGEIS |
Ga0137398_106057883 | 3300012683 | Vadose Zone Soil | MSQLTFNLQPSRRALTVSELTARIRDLLTKNFTELSV |
Ga0137398_111432171 | 3300012683 | Vadose Zone Soil | MTQQLTFNLMPDRKTFTVSELTGKIRDLLAKNFTDISVQ |
Ga0137397_106601221 | 3300012685 | Vadose Zone Soil | MSQLTFNLMPERRTLSVSELTARIRDLLAKNFTDIL |
Ga0137397_111117271 | 3300012685 | Vadose Zone Soil | MAPRDMTTQLQFNLAPERRILTVSELTGKIRDLLGK |
Ga0137396_100831691 | 3300012918 | Vadose Zone Soil | MTQQLTFNLMPTRQVFTVSELTGKIRDLLAKNFTDI |
Ga0137419_106119442 | 3300012925 | Vadose Zone Soil | MSQLTFNLQPDRRAFTVSELTARIRDMLAKNFTDVAVEGE |
Ga0137404_101844482 | 3300012929 | Vadose Zone Soil | MSQLTFNLQPSRRALTVSELTARIRDLLAKNFTELSVEGEV |
Ga0137404_108431262 | 3300012929 | Vadose Zone Soil | MSQLTFNLQPDRRLLTVSELTAQLRDLLAKNFTDILVEGEISNPP |
Ga0153915_110631771 | 3300012931 | Freshwater Wetlands | MSQLTFNLMPERKTWTVSELTARIRDLLGKNFTDILVQGE |
Ga0126375_100624812 | 3300012948 | Tropical Forest Soil | MSQLTFNLQPDRRSLTVSELTARIRDLLAKNFIDVLVEGEISNCREA* |
Ga0164303_112959262 | 3300012957 | Soil | MGQLTFNLQPERRSLTVSELTARIRDLLAKNYIDVLVEGEISNCRE |
Ga0126369_100723296 | 3300012971 | Tropical Forest Soil | MSQLQFNLQPERRIYSVSDLTARIRDLLAKNFTDIVVQ |
Ga0126369_107574292 | 3300012971 | Tropical Forest Soil | MSQLQFNLRPERRVFSVSELTTSIRDLFVRNFTDILVQGE |
Ga0134075_100411541 | 3300014154 | Grasslands Soil | MSQLQFNLMPDRKVWTVSELTARIRDLLARNFTDI |
Ga0181531_100453754 | 3300014169 | Bog | MSQLTFNLMPQRRILTVSELTGKVRDLLARNFTDIWV |
Ga0137405_12644134 | 3300015053 | Vadose Zone Soil | MNQLTFNLQPERRIYTVSDLTARIRELMAKNFTDVTVQGE |
Ga0137420_11869161 | 3300015054 | Vadose Zone Soil | MTQQLSFNLMPNRKTFTVSELTGKIRDLLAKNFTEISVQVHRDQ |
Ga0137418_102295774 | 3300015241 | Vadose Zone Soil | VDASKTQLTFNLQPDRRIYTVSDLTARIRELLAKNFTDVT |
Ga0137412_106807321 | 3300015242 | Vadose Zone Soil | MSQLTFNLQPSRRALTVSELTARIRDLLAKNFTELS |
Ga0137409_112868501 | 3300015245 | Vadose Zone Soil | MTQQLTFNLMPEKRAWTVSELTAKIRDLLAKNFTD |
Ga0134073_100487493 | 3300015356 | Grasslands Soil | MTQQLTFNLMPDRKTWTVSELTAKIRDLLSKNFTDISVQGEIS |
Ga0132255_1002137381 | 3300015374 | Arabidopsis Rhizosphere | MGQLTFNLQPERRSLTVSELTARIRHLLSKNFIDV |
Ga0182035_100813541 | 3300016341 | Soil | MDQLRFNLQPERRVYTVSDLTARIRDLLARNFTDVSVQGEISNC |
Ga0182034_107535561 | 3300016371 | Soil | MSQLQFNLQPERRVFTVSDLTARIRDLLARNFMDISVQGEI |
Ga0182034_114365071 | 3300016371 | Soil | MSQLTFNLQPTRTVLTVSELTARIRDLLARNFTDIFVQGEISNCHE |
Ga0182034_119428411 | 3300016371 | Soil | MTTQLTFNLRPERRILTVSELTGKIRDLLGKNFSAILVQGEIS |
Ga0182038_104015991 | 3300016445 | Soil | MSQLQFNLQPERRVFTVSDLTARIRDLLARNFMDISVQGEISNC |
Ga0187802_104240381 | 3300017822 | Freshwater Sediment | MTTQLTFNLQPTRRALTVSELTARIRDLLGKNFTDLW |
Ga0187801_100200961 | 3300017933 | Freshwater Sediment | MNQLQFNLQPERPIFTVSDLTARIRDLLAKNFTDITVQGEISNCR |
Ga0187781_103473941 | 3300017972 | Tropical Peatland | MDQLQLNLQPERRVFTVSDLTARIRDLLAKNFNDISVQGEISN |
Ga0187816_103483782 | 3300017995 | Freshwater Sediment | MNQLQLNLQPERRVYTVSDLTARIRDLLLKNFTDISVQGEISNC |
Ga0187769_107132781 | 3300018086 | Tropical Peatland | MDQLQLNLQPERHVFTVSDLTARIRDLLAKNFTDISVQGEI |
Ga0066667_109079541 | 3300018433 | Grasslands Soil | MSQLTFNLQPTRQILSVSELTARIRDLLARNFTDIFVQGEISNCRE |
Ga0193755_10069021 | 3300020004 | Soil | MTEQLTFNLMPEKRAWTVSELTAKIRDLLAKNFTD |
Ga0210407_110107571 | 3300020579 | Soil | MTQLQFNLMPDRRAFTVTELTAKIRDLFARNLTDIWVTGE |
Ga0210407_111642801 | 3300020579 | Soil | MTTQLQFNLMPERRVWSVTELTVKIRDLLARNFTDIL |
Ga0210407_111946671 | 3300020579 | Soil | MNQLTFNLQPERRIYTVSDLTARIRELLAKNFTDVTVQGE |
Ga0210399_101438971 | 3300020581 | Soil | VDGSKTQLTFNLQPERRIYTVSDLTARIRELLAKNFTDVTV |
Ga0210399_103302643 | 3300020581 | Soil | MTQQLTFNLMPDRKTWTVSELTGKIRDLLAKNFTDITVQG |
Ga0210399_103328441 | 3300020581 | Soil | MSQLQFNLMPERRAFTVTELTARIRDLFARNFTDIW |
Ga0210404_105438871 | 3300021088 | Soil | MTQQQLTFNLMPDRKTFTVSELTGKIRDLLTKNFTDI |
Ga0210406_102122971 | 3300021168 | Soil | VDASKTQLTFNLQPERRIYTVSDLTARIRELLAKNFT |
Ga0210400_112245461 | 3300021170 | Soil | VSQLQFNLMPERRAFTVTELTARIRDLFARNFTDIWVTG |
Ga0210405_109634612 | 3300021171 | Soil | MTQLQFNLQPTRRVLTVSELTARIRDLLAKNFTDIWVV |
Ga0210396_110918242 | 3300021180 | Soil | MAMDQLQFNLQPERRVYAVSDLTARIRDLLFRNFTD |
Ga0210393_100843751 | 3300021401 | Soil | MTTQLTFNLQPTRRALTVSELTARIRDLLGKNFTDIW |
Ga0210387_108695531 | 3300021405 | Soil | MSQLQFNLMPERRVFSVSELTARIRDLLTRNFTDILAE |
Ga0210394_102229661 | 3300021420 | Soil | VDGSKTQLTFNLQPERRIYTVSDLTARIRELLAKN |
Ga0210392_113762491 | 3300021475 | Soil | MSQLQFNLMPERRVYSVTELTGRIRDLFVRNFTDILVEGEIS |
Ga0210398_112822672 | 3300021477 | Soil | MSQLTFNLMPQRRILTVSELTGKVRDLLVKNFTDILVGGEISNC |
Ga0210409_113444911 | 3300021559 | Soil | MSQLQFNLMPDRRAFTVTELTARIRDLFARNFTDI |
Ga0247680_10482471 | 3300024246 | Soil | MSQLTFNLQPTRRALTVSELTARIRDLLGKNFTDIWVEG |
Ga0247681_10109231 | 3300024310 | Soil | MGQLTFNLQPERRSLTVSELTARIRDLLAKNFVDVQVEGEISNCRE |
Ga0137417_13340625 | 3300024330 | Vadose Zone Soil | MTRQLTFNLMPDRKTFTVSELTGKIRDLLAKNFTDISVQGEISNRREAQSGTSISP |
Ga0137417_13607903 | 3300024330 | Vadose Zone Soil | MTEQLTFNLMPDRRTFTVSELTGKIRDLLAKNFTDIAVQGEVSNCGKPSPATSTSP |
Ga0247668_10542571 | 3300024331 | Soil | MGQLTFNLQPERRSLTVSELTARIRDLLAKNFVDVLV |
Ga0207646_101597241 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHTTMSQLTFNLQPERRSLTVTELTSRIRDLLAKNFT |
Ga0207665_106815051 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MSQLQFNLMPERRVFSVSELTGRIRDLFVRNFTDILVEGEL |
Ga0209235_12188501 | 3300026296 | Grasslands Soil | MSQLTLNLNLQPTRKAWTVSELTAKIRDLLAKNFTDI |
Ga0209647_12161102 | 3300026319 | Grasslands Soil | MSQLTFNLQPDRRAFTVSELTARIRDLLASAARAA |
Ga0209687_11483701 | 3300026322 | Soil | MTQQLTFNLMPTRKTWTVSELTGKIRDLLAKNFTDINVQGEVSN |
Ga0257169_10296132 | 3300026469 | Soil | MSQLTFNLQPDRRSLTVSELTARIRDLLAKNFTDILVEGE |
Ga0209648_101018331 | 3300026551 | Grasslands Soil | MTEQLTFNLMPDRRTFTVSELTGKIRDLLAKNFTDIR |
Ga0179587_110057101 | 3300026557 | Vadose Zone Soil | MTQQLTFNLMPDRKTFTVSELTGKIRDLLAKNFTD |
Ga0207726_10379393 | 3300027045 | Tropical Forest Soil | MDQLRFNLQPERRVYTVSDLTARIRELLARNFTDVSVQGEISN |
Ga0209588_10091701 | 3300027671 | Vadose Zone Soil | MTQQLTFNLMPDRKTWTVSELTGKIRDLLAKNFTDISVQGEISNCR |
Ga0209060_102232672 | 3300027826 | Surface Soil | VSQLQFNLMPERRVYSVTELTARIRDLFTRNFTDILVE |
Ga0209180_101361491 | 3300027846 | Vadose Zone Soil | MTQQLTFNLMPDRKTWTVSELTAKIRDLLAKNFTDI |
Ga0209283_107354712 | 3300027875 | Vadose Zone Soil | MSQLQFNLVPERKIWSVSELTARIRDLLEGNFREL |
Ga0209283_108879421 | 3300027875 | Vadose Zone Soil | MTQQLTFNLMPDRKTFTVSELTGKIRDLLAKNFTDISVQG |
Ga0209415_100684181 | 3300027905 | Peatlands Soil | MDQLQLNLQPERRVFTVSDLTARIRDLLAKNFTDIS |
Ga0209698_107995981 | 3300027911 | Watersheds | MTKQLTFNLLPARTVLTVSELTGKIRDLLVRNFTDISVIGEISNCR |
Ga0247689_10709292 | 3300028281 | Soil | MGQLTFNLQPERRSLTVSELTARIRDLLAKNFVDVQV |
Ga0268264_103621573 | 3300028381 | Switchgrass Rhizosphere | MSQLQFNLRPERRIFSVTELTGSIRDLFTRNFTDIFVEG |
Ga0308309_103102483 | 3300028906 | Soil | MYRGSASFMGQLTFNLQPERRVYTVSDLTARIRDILAKNFTDVSVTGEISNCRE |
Ga0170834_1018391241 | 3300031057 | Forest Soil | MSQLTFNLMPERRTLSVSELTARIRDLLAKNFTDILV |
Ga0170823_151528131 | 3300031128 | Forest Soil | MSQLQFNLMPERRVFSVSELTARIRDLLTRNFADIL |
Ga0170824_1091380503 | 3300031231 | Forest Soil | VDASKSQLTFNLQPERRIYTVSDLTARIRELLAKNFTDVTVQ |
Ga0170820_156438722 | 3300031446 | Forest Soil | MSQLTFNLMPERRTLSVSELTARIRDLLAKNFTDILVEG |
Ga0318534_104759381 | 3300031544 | Soil | MSQLQFNLQPERRVFTVSDLTARIRDLLARNFMDISVQGEISN |
Ga0310686_1026190351 | 3300031708 | Soil | MSQLTFNLMPDRKTWTVSELTGAIRDLLARNFTDIHVHGEISNC |
Ga0310686_1034515221 | 3300031708 | Soil | MAMDQLQFNLQPERRVYTVSDLTARIRDLLFRNFTDI |
Ga0307474_1001135710 | 3300031718 | Hardwood Forest Soil | MTMQLQFNLMPERRVWSVTELTVRIRDLLARNFADIL |
Ga0307469_102565511 | 3300031720 | Hardwood Forest Soil | MTTQLQFNLAPERRIFTVSELTGKIRDLLGKNFAGILVQGE |
Ga0307473_105906721 | 3300031820 | Hardwood Forest Soil | MSQLQFNLMPERRVFSVSELTGRIRDLFVRNFTDILVE |
Ga0318520_108684441 | 3300031897 | Soil | MEQLQFNLQPVRRIFTVSDLTARIRDLLARNFTDIIVQGEISNC |
Ga0306923_110484941 | 3300031910 | Soil | MDQLRFNLQPERRVYTVSDLTARIRDLLARNFTDV |
Ga0310912_104754733 | 3300031941 | Soil | MDQLQFNLQPERRIYTVSDLTARIRDLLARSFTDVSV |
Ga0310912_112091893 | 3300031941 | Soil | MDQLRFNLQPERRVYTVSDLTARIRDLLARNFTDVAVQG |
Ga0310909_104884811 | 3300031947 | Soil | MSQLTFNLQPDKRIYTVSDLTARIRDLLAKNFTEISVQG |
Ga0307479_105499313 | 3300031962 | Hardwood Forest Soil | MTTQLQFNLMPERRVWSVTELTVRIRDLLARNFND |
Ga0306924_107427092 | 3300032076 | Soil | MSQLTFNLQPERRSLTVSELTARIRDLLAKNFLHV |
Ga0307470_119186462 | 3300032174 | Hardwood Forest Soil | MSQLQFNLQPTRQVLTVTQLTAKIRDLLARNFTDI |
Ga0307471_1004830785 | 3300032180 | Hardwood Forest Soil | MNQLTFNLQPERRIYTVSDLTARIRELLAKNFTDVTVQ |
Ga0307471_1043289491 | 3300032180 | Hardwood Forest Soil | MSQLTFNLQPERRSLTVTELTSRIRDLLAKNFTDVLVEGE |
Ga0306920_1028982011 | 3300032261 | Soil | MGQLTFNLQPERRIYTVSDLTARIRELLAKHFTDVT |
Ga0335080_100328918 | 3300032828 | Soil | MGQLQFNLQPDRRVFTVSDLTARIRDLLARNFTDISVQGEI |
Ga0335081_108559753 | 3300032892 | Soil | MDQLQLNLQPERRIFTVSDLTARIRDLLSKNFTDIFVQGEI |
Ga0335069_100778423 | 3300032893 | Soil | VSQLQFNLMPERRVYSVTELTARIRDLFTRNFTDIFVE |
Ga0371488_0091581_3_113 | 3300033983 | Peat Soil | MDQLQLNLQPERRVFTVSDLTARIRDLLAKNFTDICV |
⦗Top⦘ |