Basic Information | |
---|---|
Family ID | F045962 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 152 |
Average Sequence Length | 45 residues |
Representative Sequence | MKLLGLDHIGIVVRDIDETIARAGDTVDGRALGERILAGDIDLQFL |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 152 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.34 % |
% of genes near scaffold ends (potentially truncated) | 98.03 % |
% of genes from short scaffolds (< 2000 bps) | 91.45 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (62.500 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere (29.605 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.816 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (55.921 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.68% β-sheet: 0.00% Coil/Unstructured: 74.32% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 152 Family Scaffolds |
---|---|---|
PF13561 | adh_short_C2 | 17.11 |
PF13411 | MerR_1 | 13.82 |
PF05199 | GMC_oxred_C | 5.92 |
PF12680 | SnoaL_2 | 5.26 |
PF00106 | adh_short | 4.61 |
PF00376 | MerR | 2.63 |
PF00440 | TetR_N | 1.97 |
PF12852 | Cupin_6 | 1.97 |
PF13577 | SnoaL_4 | 1.97 |
PF12833 | HTH_18 | 1.97 |
PF13560 | HTH_31 | 1.32 |
PF08388 | GIIM | 0.66 |
PF03640 | Lipoprotein_15 | 0.66 |
PF05163 | DinB | 0.66 |
PF00378 | ECH_1 | 0.66 |
PF01053 | Cys_Met_Meta_PP | 0.66 |
PF00069 | Pkinase | 0.66 |
PF02738 | MoCoBD_1 | 0.66 |
PF07730 | HisKA_3 | 0.66 |
PF10009 | DUF2252 | 0.66 |
PF04185 | Phosphoesterase | 0.66 |
PF07366 | SnoaL | 0.66 |
PF13604 | AAA_30 | 0.66 |
PF00903 | Glyoxalase | 0.66 |
PF09278 | MerR-DNA-bind | 0.66 |
PF13412 | HTH_24 | 0.66 |
PF13592 | HTH_33 | 0.66 |
PF13376 | OmdA | 0.66 |
PF12802 | MarR_2 | 0.66 |
PF00196 | GerE | 0.66 |
PF17164 | DUF5122 | 0.66 |
PF06441 | EHN | 0.66 |
PF00730 | HhH-GPD | 0.66 |
COG ID | Name | Functional Category | % Frequency in 152 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 5.92 |
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.63 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.66 |
COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.66 |
COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.66 |
COG4315 | Predicted lipoprotein with conserved Yx(FWY)xxD motif (function unknown) | Function unknown [S] | 0.66 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.66 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.66 |
COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.66 |
COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.66 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.66 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 0.66 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.66 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.66 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.66 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 0.66 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.66 |
COG0789 | DNA-binding transcriptional regulator, MerR family | Transcription [K] | 0.66 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.66 |
COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.66 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.66 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.66 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.66 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 0.66 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.66 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.66 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.16 % |
Unclassified | root | N/A | 36.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101151482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter | 664 | Open in IMG/M |
3300002914|JGI25617J43924_10166872 | Not Available | 743 | Open in IMG/M |
3300005093|Ga0062594_100399097 | Not Available | 1110 | Open in IMG/M |
3300005329|Ga0070683_100356681 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300005340|Ga0070689_100103316 | All Organisms → cellular organisms → Bacteria | 2258 | Open in IMG/M |
3300005341|Ga0070691_10192374 | Not Available | 1068 | Open in IMG/M |
3300005355|Ga0070671_101315650 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300005355|Ga0070671_101542874 | Not Available | 588 | Open in IMG/M |
3300005356|Ga0070674_101552146 | Not Available | 596 | Open in IMG/M |
3300005434|Ga0070709_10241838 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300005434|Ga0070709_11192348 | Not Available | 611 | Open in IMG/M |
3300005435|Ga0070714_100897366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces corallincola | 860 | Open in IMG/M |
3300005435|Ga0070714_101068076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus anmyonensis | 786 | Open in IMG/M |
3300005435|Ga0070714_101581307 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300005435|Ga0070714_101978977 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
3300005435|Ga0070714_102065362 | Not Available | 555 | Open in IMG/M |
3300005437|Ga0070710_11079201 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
3300005437|Ga0070710_11300462 | Not Available | 541 | Open in IMG/M |
3300005439|Ga0070711_100332536 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300005440|Ga0070705_100436834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
3300005445|Ga0070708_100435563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → unclassified Ktedonobacter → Ktedonobacter sp. 13_1_20CM_4_53_11 | 1237 | Open in IMG/M |
3300005445|Ga0070708_101152831 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300005445|Ga0070708_101282322 | Not Available | 684 | Open in IMG/M |
3300005467|Ga0070706_100102826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2656 | Open in IMG/M |
3300005467|Ga0070706_101131121 | Not Available | 720 | Open in IMG/M |
3300005467|Ga0070706_101614361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 591 | Open in IMG/M |
3300005467|Ga0070706_101638941 | Not Available | 587 | Open in IMG/M |
3300005467|Ga0070706_101910697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 538 | Open in IMG/M |
3300005468|Ga0070707_101818050 | Not Available | 576 | Open in IMG/M |
3300005468|Ga0070707_102195661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300005468|Ga0070707_102290078 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300005471|Ga0070698_100052272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4157 | Open in IMG/M |
3300005471|Ga0070698_100677947 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
3300005538|Ga0070731_11106288 | Not Available | 524 | Open in IMG/M |
3300005541|Ga0070733_10421278 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
3300005549|Ga0070704_100071842 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
3300005578|Ga0068854_101810448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300005614|Ga0068856_101313437 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005921|Ga0070766_10020008 | All Organisms → cellular organisms → Bacteria | 3549 | Open in IMG/M |
3300005921|Ga0070766_10957637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
3300006028|Ga0070717_11002630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus anmyonensis | 760 | Open in IMG/M |
3300006028|Ga0070717_12061627 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300006173|Ga0070716_100345948 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
3300006175|Ga0070712_101301107 | Not Available | 633 | Open in IMG/M |
3300006175|Ga0070712_101711259 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
3300006358|Ga0068871_101377186 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300006804|Ga0079221_10112094 | Not Available | 1362 | Open in IMG/M |
3300006804|Ga0079221_10388283 | Not Available | 860 | Open in IMG/M |
3300006804|Ga0079221_10401479 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300006806|Ga0079220_10217182 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300006852|Ga0075433_10807491 | Not Available | 820 | Open in IMG/M |
3300006852|Ga0075433_10838527 | Not Available | 802 | Open in IMG/M |
3300006871|Ga0075434_100029280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5415 | Open in IMG/M |
3300006871|Ga0075434_100518567 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
3300006903|Ga0075426_10191086 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
3300006903|Ga0075426_10247206 | Not Available | 1298 | Open in IMG/M |
3300006954|Ga0079219_10555152 | Not Available | 824 | Open in IMG/M |
3300007076|Ga0075435_100144205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1999 | Open in IMG/M |
3300007076|Ga0075435_100538617 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300007076|Ga0075435_101600648 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
3300009101|Ga0105247_11069826 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
3300009147|Ga0114129_11450947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 845 | Open in IMG/M |
3300010396|Ga0134126_10058406 | All Organisms → cellular organisms → Bacteria | 4815 | Open in IMG/M |
3300011120|Ga0150983_14426302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus anmyonensis | 741 | Open in IMG/M |
3300011269|Ga0137392_11327120 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
3300011271|Ga0137393_11491459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 566 | Open in IMG/M |
3300012169|Ga0153990_1061321 | Not Available | 852 | Open in IMG/M |
3300012205|Ga0137362_11323286 | Not Available | 606 | Open in IMG/M |
3300012363|Ga0137390_10740382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 943 | Open in IMG/M |
3300012917|Ga0137395_11057895 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 578 | Open in IMG/M |
3300012955|Ga0164298_10515035 | Not Available | 803 | Open in IMG/M |
3300012960|Ga0164301_10381972 | Not Available | 979 | Open in IMG/M |
3300012961|Ga0164302_11864347 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300012985|Ga0164308_11806614 | Not Available | 570 | Open in IMG/M |
3300012986|Ga0164304_10266200 | Not Available | 1157 | Open in IMG/M |
3300012988|Ga0164306_11574338 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300014968|Ga0157379_11627950 | Not Available | 631 | Open in IMG/M |
3300017792|Ga0163161_10187743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1588 | Open in IMG/M |
3300020579|Ga0210407_11151698 | Not Available | 586 | Open in IMG/M |
3300020581|Ga0210399_10716456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 822 | Open in IMG/M |
3300021088|Ga0210404_10138681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1265 | Open in IMG/M |
3300021170|Ga0210400_10761720 | Not Available | 794 | Open in IMG/M |
3300021180|Ga0210396_10736411 | Not Available | 849 | Open in IMG/M |
3300021180|Ga0210396_11345789 | Not Available | 592 | Open in IMG/M |
3300021403|Ga0210397_10144036 | Not Available | 1659 | Open in IMG/M |
3300021403|Ga0210397_11113573 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 613 | Open in IMG/M |
3300021432|Ga0210384_10469157 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
3300021432|Ga0210384_11236171 | Not Available | 651 | Open in IMG/M |
3300021479|Ga0210410_10467753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1127 | Open in IMG/M |
3300021479|Ga0210410_11036011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
3300021479|Ga0210410_11208828 | Not Available | 647 | Open in IMG/M |
3300021479|Ga0210410_11400546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Photobacterium | 592 | Open in IMG/M |
3300021559|Ga0210409_10609796 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300021559|Ga0210409_10645168 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300021861|Ga0213853_10326251 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300024331|Ga0247668_1041693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 937 | Open in IMG/M |
3300025885|Ga0207653_10115197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 963 | Open in IMG/M |
3300025885|Ga0207653_10165961 | Not Available | 819 | Open in IMG/M |
3300025898|Ga0207692_10315426 | Not Available | 955 | Open in IMG/M |
3300025898|Ga0207692_10448120 | Not Available | 812 | Open in IMG/M |
3300025906|Ga0207699_10486900 | Not Available | 889 | Open in IMG/M |
3300025910|Ga0207684_10068970 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 3005 | Open in IMG/M |
3300025910|Ga0207684_10361437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus anmyonensis | 1249 | Open in IMG/M |
3300025910|Ga0207684_10401294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1179 | Open in IMG/M |
3300025910|Ga0207684_10698471 | Not Available | 862 | Open in IMG/M |
3300025915|Ga0207693_10281394 | All Organisms → Viruses → Predicted Viral | 1303 | Open in IMG/M |
3300025915|Ga0207693_10710024 | Not Available | 778 | Open in IMG/M |
3300025915|Ga0207693_11253822 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300025916|Ga0207663_10726470 | Not Available | 788 | Open in IMG/M |
3300025922|Ga0207646_10983176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 746 | Open in IMG/M |
3300025922|Ga0207646_11379896 | Not Available | 613 | Open in IMG/M |
3300025928|Ga0207700_10835034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus anmyonensis | 824 | Open in IMG/M |
3300025928|Ga0207700_11543294 | Not Available | 589 | Open in IMG/M |
3300025928|Ga0207700_11597375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
3300025929|Ga0207664_10835245 | Not Available | 828 | Open in IMG/M |
3300025929|Ga0207664_11189268 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus → Streptacidiphilus anmyonensis | 680 | Open in IMG/M |
3300025929|Ga0207664_11368015 | Not Available | 628 | Open in IMG/M |
3300025929|Ga0207664_11642317 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 565 | Open in IMG/M |
3300025931|Ga0207644_10346407 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
3300025936|Ga0207670_10136012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1806 | Open in IMG/M |
3300025939|Ga0207665_10793595 | Not Available | 748 | Open in IMG/M |
3300026340|Ga0257162_1018277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 838 | Open in IMG/M |
3300026507|Ga0257165_1090521 | Not Available | 565 | Open in IMG/M |
3300026555|Ga0179593_1158664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 3226 | Open in IMG/M |
3300026555|Ga0179593_1179535 | Not Available | 2206 | Open in IMG/M |
3300026998|Ga0208369_1007666 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300027371|Ga0209418_1024460 | All Organisms → cellular organisms → Bacteria | 1025 | Open in IMG/M |
3300027857|Ga0209166_10216697 | Not Available | 1025 | Open in IMG/M |
3300027857|Ga0209166_10721240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 501 | Open in IMG/M |
3300027862|Ga0209701_10133186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1530 | Open in IMG/M |
3300027867|Ga0209167_10424567 | Not Available | 726 | Open in IMG/M |
3300028047|Ga0209526_10042827 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3186 | Open in IMG/M |
3300029636|Ga0222749_10559151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
3300029636|Ga0222749_10668244 | Not Available | 568 | Open in IMG/M |
3300031708|Ga0310686_111555005 | Not Available | 566 | Open in IMG/M |
3300031720|Ga0307469_10132539 | All Organisms → cellular organisms → Bacteria | 1828 | Open in IMG/M |
3300031720|Ga0307469_12466694 | Not Available | 508 | Open in IMG/M |
3300031740|Ga0307468_101928850 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300031753|Ga0307477_10561499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
3300031820|Ga0307473_10244881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
3300031820|Ga0307473_11572118 | Not Available | 501 | Open in IMG/M |
3300031823|Ga0307478_10001874 | All Organisms → cellular organisms → Bacteria | 17471 | Open in IMG/M |
3300031962|Ga0307479_10064946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3520 | Open in IMG/M |
3300031962|Ga0307479_10781719 | Not Available | 931 | Open in IMG/M |
3300031962|Ga0307479_10804828 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300031962|Ga0307479_11841924 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300031962|Ga0307479_11963260 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300032174|Ga0307470_10139657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1463 | Open in IMG/M |
3300032174|Ga0307470_10881279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis | 701 | Open in IMG/M |
3300032180|Ga0307471_101332470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300032180|Ga0307471_101858847 | Not Available | 752 | Open in IMG/M |
3300032180|Ga0307471_102303994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → unclassified Streptomyces → Streptomyces sp. GbtcB6 | 679 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 29.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.82% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 11.18% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.58% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 5.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.61% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.29% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.29% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.29% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.97% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.32% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.32% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.32% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.66% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.66% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.66% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.66% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.66% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026998 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF046 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1011514821 | 3300002245 | Forest Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCGET |
JGI25617J43924_101668721 | 3300002914 | Grasslands Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLC |
Ga0062594_1003990972 | 3300005093 | Soil | MKLLGLDHIGIIVRDINETIARAGDTVDGTAVGERILAGDIDLQFLL |
Ga0070683_1003566812 | 3300005329 | Corn Rhizosphere | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGD |
Ga0070689_1001033161 | 3300005340 | Switchgrass Rhizosphere | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDLQF |
Ga0070691_101923741 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIIVRDINETIARAGDTVDGTAVGERILAGDIDLQFL |
Ga0070671_1013156502 | 3300005355 | Switchgrass Rhizosphere | MRLLGLDHIAIVVRDIDETIARAGDTVDGRAGGERILAGDIDLQFLLFGETR |
Ga0070671_1015428742 | 3300005355 | Switchgrass Rhizosphere | MKLLGLDHIGVVVRDIDQTVARAGETLDGRPVGGRFVSDDIDLQVLL |
Ga0070674_1015521461 | 3300005356 | Miscanthus Rhizosphere | MNIVGLDHIAFVVRSIDETVARAGDIADGRAVGERFVSDDID |
Ga0070709_102418381 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIAIVVRDIDETIARAGDTVDGRAVGERLRGGDIDLQF |
Ga0070709_111923481 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGVVVRDIDETVARAGETVDGRAVGGRFVSDDIDLQVLLCGESTLELIE |
Ga0070714_1008973662 | 3300005435 | Agricultural Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQFL |
Ga0070714_1010680763 | 3300005435 | Agricultural Soil | MKLLGLDHIAIVVRDINETVARAGDTVDGRASGERILAGDIDLQFLLFG |
Ga0070714_1015813072 | 3300005435 | Agricultural Soil | MRLLGLDHIAIIVRDIDETVARAGDTVDGRAVGERLRGGDIDLQFLLFGETR |
Ga0070714_1019789771 | 3300005435 | Agricultural Soil | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCG |
Ga0070714_1020653622 | 3300005435 | Agricultural Soil | MKLLGLDHIGIVVRDISETIARAGDTVDGRALGERILAGDI |
Ga0070710_110792013 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIAIVVRDIDETIARAGDTVDGRAVGERLRGGDIDLQFLLFGETRLE |
Ga0070710_113004622 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIVGLDHIAFVVRDIDETIARVGDTLEGRAVGERFVSDDIDLQ |
Ga0070711_1003325363 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETITQAGDTLDGRAVGERFVSDDIDLQVLLCG |
Ga0070705_1004368343 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIAIVVRDIDETIARAGDTVDGRALGERILAGDIDLQFLL |
Ga0070708_1004355634 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDINETIARAGETFAGRAVGRRFVSGDIDLQVLLLGESR |
Ga0070708_1011528311 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIAVRDINETIARAGGTVDGRALGERILAGDIDLQFLLCGETRLELIEV |
Ga0070708_1012823222 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIIVRDIDETIAQAGDTVDGRAVGERFVSGDIDLQVLLLGESRL |
Ga0070706_1001028261 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIVVRDISETVARAGDTVDGRAVGERLRGGDIDLQFLLFGET |
Ga0070706_1011311212 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIAIVVRDINETVARAGDTVDGRAGGERILAGDIDLQFLLFGETRLELI |
Ga0070706_1016143611 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGD |
Ga0070706_1016389411 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MKIVGLDHIAFVVRDIDDTIARAGDTLEGRAVGERFVSDDIDL |
Ga0070706_1019106971 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIIVRDISETVARAGDTVDGRAVGERLRGGDIDLQFLLFGET |
Ga0070707_1018180502 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIIVRDIDETIAQAGDTVDGRAVGGRFVSGDIDLQVLLLGESRLE |
Ga0070707_1021956611 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDVDLQFLLCGETR |
Ga0070707_1022900781 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETIARAGDTVDGRALGERILAGDIDLQFL |
Ga0070698_1000522721 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLGLDHVGVVVRDIDETVARAGDTVDGRAVGERFVSDDIDLQVVLLG |
Ga0070698_1006779472 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIIVRDISETVARAGDTVDGRAVGERLRGGDIDLQFLLFGETRLE |
Ga0070731_111062881 | 3300005538 | Surface Soil | MKLLGLDHVGIVVRDIDETVARAGETVDGRPVGERFVADNIDLQVLLCGE* |
Ga0070733_104212782 | 3300005541 | Surface Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRADGERLRGGDIDLQFLLFGETRLEL |
Ga0070704_1000718424 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGVVVRDIDQTVARAGETLDGRPVGGRFVSDDIDLQVLLCGESTLELIE |
Ga0068854_1018104481 | 3300005578 | Corn Rhizosphere | MKLLGLDHIGIIVRDINETIARAGDTVDGTAVGERILAG |
Ga0068856_1013134372 | 3300005614 | Corn Rhizosphere | MRLLGLDHIAIVVRDIDETVARAGDTVDGRAGGERILAGDIDLQFLLFG |
Ga0070766_100200085 | 3300005921 | Soil | MRLLGLDHIAIVVRDISETVARAGDTVDGRADGERLRG |
Ga0070766_109576372 | 3300005921 | Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGERILAGDIDLQFLLFGETRLE |
Ga0070717_110026301 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGER |
Ga0070717_120616272 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIIVRDISETVARAGDTVDGRAVGERLRGGDIDLQF |
Ga0070716_1003459482 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETVTRAGDTLDGRAVGERFVSDDIDLQVLLCGESTLEL |
Ga0070712_1013011071 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDISETIARAGDTVDGRALGERILAGDIDLQFL |
Ga0070712_1017112591 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDL |
Ga0068871_1013771861 | 3300006358 | Miscanthus Rhizosphere | MRLLGLDHIAIVVRDIDETVARAGDTVDGRAGGERILAGDID |
Ga0079221_101120944 | 3300006804 | Agricultural Soil | MRLLGLDHIAIVVRDISETVARAGDTVDGRAGGERILAGDIDLQFLLFGETR |
Ga0079221_103882831 | 3300006804 | Agricultural Soil | MKLLGLDHIGIVVRDIDEAVARAGVTVDGRAIGERFVSP |
Ga0079221_104014792 | 3300006804 | Agricultural Soil | VKLLGLDHIGIVVRDIDETVAQAGATVDGRAVGKRFVSADIDLQVLL |
Ga0079220_102171821 | 3300006806 | Agricultural Soil | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDLQFL |
Ga0075433_108074912 | 3300006852 | Populus Rhizosphere | MRLLGLDHIAIVVRDINETVARAGDTVDGMAGGERILAGDIDLQFLLFGETRLE |
Ga0075433_108385271 | 3300006852 | Populus Rhizosphere | MELLGLDHVGIVVRDIDETVARAGDTVDGRAVGERFVFDDIDLQVLMAGEST |
Ga0075434_1000292801 | 3300006871 | Populus Rhizosphere | MNIVGLDHIAFVVRSIDETVARAGDIADGRAVGERFVSDDIDLQVLL |
Ga0075434_1005185671 | 3300006871 | Populus Rhizosphere | MKLLGLDHIGIVVRNIDETVARAGDTLDGRAVGDRFVSDDIDLQVL |
Ga0075426_101910861 | 3300006903 | Populus Rhizosphere | MKLLGLDHVGVVVRDIDETVARAGHTFDGRAVGERFVTDDIDLQV |
Ga0075426_102472061 | 3300006903 | Populus Rhizosphere | MKLLGLDHIGIVVRDIDKTVARAGDTVDGRAVGERFVSDNIDLQVLMAGKST |
Ga0079219_105551521 | 3300006954 | Agricultural Soil | MKLLGLDHIGIVVRDIDNTVARAGDIVDGRAVGERFVSDDIDLQVL |
Ga0075435_1001442051 | 3300007076 | Populus Rhizosphere | MKLLGLDHVGIVVRDIDETVARAGDTVDGRAVGERF |
Ga0075435_1005386172 | 3300007076 | Populus Rhizosphere | MKLRGLDHIGIVVRDINETVARAGDTVDGRALGERILAGDI |
Ga0075435_1016006482 | 3300007076 | Populus Rhizosphere | VKLLGLDHIGIVVRDINETVARAGETVDGRPVGERFVADDIDLQVLLCGESTLEL |
Ga0105247_110698263 | 3300009101 | Switchgrass Rhizosphere | LDHIAIVVRDIDETIARAGDTVDGRAGGERILAGDIDLQFLLFGETRL |
Ga0114129_114509471 | 3300009147 | Populus Rhizosphere | MKVLGLDHIGIVVRDINETIARAGETFDGRAVGRRFVSGDIDLQVLLLGESRLELI |
Ga0134126_100584061 | 3300010396 | Terrestrial Soil | LDHIAIVVRDINETVARAGDTVDGMAGGERILAGDIDLQFLLFGETRLELI |
Ga0150983_144263021 | 3300011120 | Forest Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRAGGDRILAGDIDLQFMLFGETRLELIE |
Ga0137392_113271202 | 3300011269 | Vadose Zone Soil | MKLLGLDHIGIVVRNIDKTVARAGDTVDGRAVGERFVSDDIDLQVLMAGKSTLEL |
Ga0137393_114914592 | 3300011271 | Vadose Zone Soil | MKLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDLQ |
Ga0153990_10613211 | 3300012169 | Attine Ant Fungus Gardens | MKLLGLDHIGIVVRDIDNTVARAGDTIDGRAVGERF |
Ga0137362_113232861 | 3300012205 | Vadose Zone Soil | LDHIAFVVRDIDETIARAGDTVDGRAVGERIHAGDIDLQVLLSGEMQLE |
Ga0137390_107403821 | 3300012363 | Vadose Zone Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCGETR |
Ga0137395_110578952 | 3300012917 | Vadose Zone Soil | MKLLALDHIGIVVRDINETIARASDTVDGRALGERILAGDIDLQ |
Ga0164298_105150352 | 3300012955 | Soil | MKLLGLDHIGVVVRDIDQTVARAGETLDGRPIGGRFVSDDIDL |
Ga0164301_103819723 | 3300012960 | Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGERILAGDI |
Ga0164302_118643471 | 3300012961 | Soil | MKLIGLDHIGIVVREIDETIAQAGGTVDGRAVGERFVSADIELQVLLCGESTLELIE |
Ga0164308_118066141 | 3300012985 | Soil | MNIVGLDHIAFVVRDIDETITRVGDTLEGRAVGERFVSDDI |
Ga0164304_102662001 | 3300012986 | Soil | MKLRGLDHIGIVVRDINETVARAGDTVDGRAGGERIL |
Ga0164306_115743381 | 3300012988 | Soil | MELLGLDHIGIVVRDIDETIARAGDTVDGRAIGERIRGGDIDLQVLLSGETRLE |
Ga0157379_116279503 | 3300014968 | Switchgrass Rhizosphere | MRLRVLDHIAIVVRDINETVARAGDTVDGRAGGERILAG |
Ga0163161_101877432 | 3300017792 | Switchgrass Rhizosphere | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCGETRLEL |
Ga0210407_111516981 | 3300020579 | Soil | MKLLGLDHIGIVVRDIDKTVARAGDTVDGRAVGERFVSDDIDLQVLMAGKSTLEL |
Ga0210399_107164561 | 3300020581 | Soil | MKLLGLDHIGIIVRDLEETIAQARDTVDARPVGERFVSGDIDLQVL |
Ga0210404_101386811 | 3300021088 | Soil | MKLLGLDHIGIIVRDLEETIAQARDTVDARPVGERFVSGDIDLQVLLMG |
Ga0210400_107617201 | 3300021170 | Soil | MKLLGIDHIGIVVRDINETIARAGDTVDGRALGERIPAGNVDLQFLLCGESLLEL |
Ga0210396_107364112 | 3300021180 | Soil | MRLLGLDHIAVIVRDINETVARAGDTVDGRADGERLRGGDI |
Ga0210396_113457891 | 3300021180 | Soil | MRLLGLDHIAIVVRDISETVARAGDTVDGRADGERLRGGDIDL |
Ga0210397_101440361 | 3300021403 | Soil | MKLLGIDHIGIVVRDINETIARAGDTLDGRALGERIPA |
Ga0210397_111135731 | 3300021403 | Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGER |
Ga0210384_104691573 | 3300021432 | Soil | MKLLGLDHIGIVVRDIDNTVARAGATVDGRAVGERFVSDSIDLQV |
Ga0210384_112361712 | 3300021432 | Soil | MKLLGIDHIGIVVRDINETIARAGDTVDGRALGERIPAG |
Ga0210410_104677533 | 3300021479 | Soil | MKVLGLDHIGIVVRDINDTIARAGDTVDGSALGERIPAGD |
Ga0210410_110360112 | 3300021479 | Soil | MKLLGLDHVGIVVRNIDETVARAGAIVDGRAVGDRFVSDDIDLQVLLAG |
Ga0210410_112088282 | 3300021479 | Soil | MKLLGIDHIGIVVRDINETIARAGDTVDGRALGER |
Ga0210410_114005462 | 3300021479 | Soil | MKLLGLDHIGIVVRDIDKTVARAGDTVDGRAVGERFVSDDIDLQ |
Ga0210409_106097961 | 3300021559 | Soil | MKLLGLDHVGIVVRDIDETVARAGATVDGRAVGERFVSDDIDLQVLTAG |
Ga0210409_106451682 | 3300021559 | Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILA |
Ga0213853_103262512 | 3300021861 | Watersheds | MKLLGLDHIGIVVRDINETIARAGDTVDGTALGERILAGD |
Ga0247668_10416932 | 3300024331 | Soil | MRLRVLDHIAIVVRDINETVARAGDTVDGRADGER |
Ga0207653_101151972 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLLGLDHIGIVVRDIDETVARAGETVDGRPVGERF |
Ga0207653_101659611 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDNTVARAGDTVDGRAVGERFVSDNIDLQVLMIGKSA |
Ga0207692_103154261 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGERILAG |
Ga0207692_104481202 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETVARAGETVDGRPVGDRF |
Ga0207699_104869003 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGVVVRDIDETVARAGETLDGRPVGGRFLSDDIDLQVLL |
Ga0207684_100689701 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQF |
Ga0207684_103614374 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIVVRDINETVARACDTVDGRAGGERILAGDIDL |
Ga0207684_104012941 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETIARAGETVDGRPVGERF |
Ga0207684_106984711 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLLGLDHIAIIVRDISETVARAGDTVDGRAVGERLRGGDIDLQFLLFGETRL |
Ga0207693_102813941 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VKLLGLDHIGIVVRDIDETVARAGDTLDGRAVGER |
Ga0207693_107100241 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETVAQAGGTVDGRAVGKRFV |
Ga0207693_112538222 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSMKLLGLDHIGIVVRDIDETVARARETVDGNPVGER |
Ga0207663_107264702 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGVVVRDIDETVARAGETVDGRAVGGRFVSDDIDLQVLLCGESTLE |
Ga0207646_109831761 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERI |
Ga0207646_113798961 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIIVRDIDETIAQAGDTVDGRAVGGR |
Ga0207700_108350342 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIAIVVRDIDETIARAGDTVDGRAVGERLRGGDIDLQFLLFGETRLELIE |
Ga0207700_115432941 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHVGIVVRNVDEAVARAGETVDGRAVGERF |
Ga0207700_115973752 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIIVRDINETIARAGDTVDGTAVGERILAGDIDLQFLLF |
Ga0207664_108352452 | 3300025929 | Agricultural Soil | MKLLGLDHVGIVVRDIDETVARAGETLDGRTVGERFVSDDID |
Ga0207664_111892681 | 3300025929 | Agricultural Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRADGERILAGD |
Ga0207664_113680152 | 3300025929 | Agricultural Soil | MKLLGLDHIGIVVRDIDETVARAGETVDGRPVGERFVADDIDLQV |
Ga0207664_116423172 | 3300025929 | Agricultural Soil | MRLLGLDHIAIIVRDIDETVARAGDTVDGRAVGERLRGGDIDLQFL |
Ga0207644_103464071 | 3300025931 | Switchgrass Rhizosphere | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILA |
Ga0207670_101360123 | 3300025936 | Switchgrass Rhizosphere | MRLLGLDHIAIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCGET |
Ga0207665_107935951 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLLGLDHIGIVVRDIDETVARAGETVDGKTVGERF |
Ga0257162_10182771 | 3300026340 | Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRAQGERILAGDIDLQFLLFGETRLELI |
Ga0257165_10905211 | 3300026507 | Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCGETRLEL |
Ga0179593_11586645 | 3300026555 | Vadose Zone Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDVDLQFLLCG |
Ga0179593_11795352 | 3300026555 | Vadose Zone Soil | MKLLGLDHIGIVVRDIDNTVARAGDTVDGRAVGERFVSDDIDLQVLMPANLPWS |
Ga0208369_10076661 | 3300026998 | Forest Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRAGGERILAG |
Ga0209418_10244601 | 3300027371 | Forest Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAG |
Ga0209166_102166972 | 3300027857 | Surface Soil | MRLLGLDHIAIVVRDIDETVARAGDTVDGRADGERLRGGDIDLQFLLFGETRLE |
Ga0209166_107212402 | 3300027857 | Surface Soil | MKLLGLDHIGIVVRDINETIARAGDTVDGRALGERILAGDIDLQFLLCGETRLE |
Ga0209701_101331861 | 3300027862 | Vadose Zone Soil | MKLLGLDHIGIVVRDIDQTVARAGETVDGRAVGERFVADDID |
Ga0209167_104245671 | 3300027867 | Surface Soil | MRLLGLDHIAIVVRDIDETVARAGDTVDGRADGERLHGGDIDLQFL |
Ga0209526_100428274 | 3300028047 | Forest Soil | MKLLGLDHIGIVVRDINETVARAGDTVDGRALGERILAGDVDLQFLLCGETR |
Ga0222749_105591513 | 3300029636 | Soil | MKLLGLDHVGIIVRDIDETVARAGNTVDGRTVGERFVSE |
Ga0222749_106682441 | 3300029636 | Soil | MKVLGLDHIAFVVRDIDETVARAGDTIGGGAVGERLH |
Ga0310686_1115550051 | 3300031708 | Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGERILAGDIDLQFLLFGET |
Ga0307469_101325393 | 3300031720 | Hardwood Forest Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGMAGGERILAGDIDLQFLLFG |
Ga0307469_124666942 | 3300031720 | Hardwood Forest Soil | MKLLGLDHIGIVVRDIDNTVARAGDTVDGRAVGERFVSDNIDL |
Ga0307468_1019288501 | 3300031740 | Hardwood Forest Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGERILAGDIDLQF |
Ga0307477_105614992 | 3300031753 | Hardwood Forest Soil | MKLLGLDHIGIVVRNIDETVTRASDTLDGRAVGERFVSDDIELQVL |
Ga0307473_102448811 | 3300031820 | Hardwood Forest Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGMAGGERILAGDIDLQFLLFGETRLELI |
Ga0307473_115721182 | 3300031820 | Hardwood Forest Soil | MKLLGLDHVGIVVPNIDAAVIQAGRTLEGRAVGDR |
Ga0307478_1000187415 | 3300031823 | Hardwood Forest Soil | MKLLGLDHIGIVVRDIDETVARAGETVDGRPVGDRFVADDIDLQVLRFGESTLEL |
Ga0307479_100649466 | 3300031962 | Hardwood Forest Soil | MKLLGLDHIGIVVGDIDETVARAGETVDGRPVGERFVADDIDLQVLLCGEST |
Ga0307479_107817192 | 3300031962 | Hardwood Forest Soil | MKLLGLDHIGIVVRNIDETVTRATDTLDGRAVGERFV |
Ga0307479_108048283 | 3300031962 | Hardwood Forest Soil | MKILGLDHIGIVVRDIEETVARAGETLDGRPVGQRFVAD |
Ga0307479_118419242 | 3300031962 | Hardwood Forest Soil | MKLLGLDHIGIVVRDIDETVARAGETVDGRAVGERFV |
Ga0307479_119632601 | 3300031962 | Hardwood Forest Soil | VKLLGLDHIGIVVRDIDETVAQAGATVDGRAVGKRFA |
Ga0307470_101396571 | 3300032174 | Hardwood Forest Soil | MRLLGLDHIAIVVRDINETVARAGDTVDGRAGGERI |
Ga0307470_108812792 | 3300032174 | Hardwood Forest Soil | MKLLGLDHIGVIVGNIDEAVARAGDTIDGRAVGERFV |
Ga0307471_1013324703 | 3300032180 | Hardwood Forest Soil | MKLLGLDHIGIVVRDIDETIARAGETVDGRPVGERFVADNIDLQVLLV |
Ga0307471_1018588472 | 3300032180 | Hardwood Forest Soil | MKLLGLDHIGIVVRDIDNTVARAGDTVDGRAVGERFVSDDIDLQVLMAG |
Ga0307471_1023039942 | 3300032180 | Hardwood Forest Soil | MKLLGLDHIGIVVRDIDETIARAGETVDGRAVGGRFVSDDIDLQVLLC |
⦗Top⦘ |