Basic Information | |
---|---|
Family ID | F045293 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 153 |
Average Sequence Length | 46 residues |
Representative Sequence | DLRFETSAIQWDKNVAPTVGQRLSYDVGQTNDRQPCALNLQTI |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 153 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 3.29 % |
% of genes near scaffold ends (potentially truncated) | 96.08 % |
% of genes from short scaffolds (< 2000 bps) | 90.20 % |
Associated GOLD sequencing projects | 93 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.22 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (67.320 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere (15.033 % of family members) |
Environment Ontology (ENVO) | Unclassified (68.627 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (81.046 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 8.45% β-sheet: 11.27% Coil/Unstructured: 80.28% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 153 Family Scaffolds |
---|---|---|
PF13581 | HATPase_c_2 | 4.58 |
PF09722 | Xre_MbcA_ParS_C | 4.58 |
PF02518 | HATPase_c | 2.61 |
PF08448 | PAS_4 | 1.96 |
PF00072 | Response_reg | 1.31 |
PF00313 | CSD | 1.31 |
PF13443 | HTH_26 | 0.65 |
PF02423 | OCD_Mu_crystall | 0.65 |
PF00574 | CLP_protease | 0.65 |
PF10546 | P63C | 0.65 |
PF13305 | TetR_C_33 | 0.65 |
PF00009 | GTP_EFTU | 0.65 |
PF00873 | ACR_tran | 0.65 |
PF07508 | Recombinase | 0.65 |
PF07568 | HisKA_2 | 0.65 |
PF01988 | VIT1 | 0.65 |
PF13676 | TIR_2 | 0.65 |
PF03060 | NMO | 0.65 |
COG ID | Name | Functional Category | % Frequency in 153 Family Scaffolds |
---|---|---|---|
COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.31 |
COG0740 | ATP-dependent protease ClpP, protease subunit | Posttranslational modification, protein turnover, chaperones [O] | 1.31 |
COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.65 |
COG1030 | Membrane-bound serine protease NfeD, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 0.65 |
COG1633 | Rubrerythrin, includes spore coat protein YhjR | Inorganic ion transport and metabolism [P] | 0.65 |
COG1814 | Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 family | Inorganic ion transport and metabolism [P] | 0.65 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.65 |
COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.65 |
COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 0.65 |
COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 67.32 % |
Unclassified | root | N/A | 32.68 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573000|GPBTN7E02FR1KA | Not Available | 510 | Open in IMG/M |
3300001989|JGI24739J22299_10199687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 587 | Open in IMG/M |
3300002074|JGI24748J21848_1057841 | Not Available | 514 | Open in IMG/M |
3300002239|JGI24034J26672_10004459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1987 | Open in IMG/M |
3300004081|Ga0063454_100665769 | Not Available | 776 | Open in IMG/M |
3300004114|Ga0062593_102286456 | Not Available | 608 | Open in IMG/M |
3300004463|Ga0063356_100450260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1680 | Open in IMG/M |
3300004463|Ga0063356_100744580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1356 | Open in IMG/M |
3300004480|Ga0062592_101443070 | Not Available | 657 | Open in IMG/M |
3300005093|Ga0062594_100082743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1829 | Open in IMG/M |
3300005093|Ga0062594_100154332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1511 | Open in IMG/M |
3300005327|Ga0070658_10454824 | Not Available | 1103 | Open in IMG/M |
3300005327|Ga0070658_11372244 | Not Available | 613 | Open in IMG/M |
3300005327|Ga0070658_11726831 | Not Available | 542 | Open in IMG/M |
3300005328|Ga0070676_10906873 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 657 | Open in IMG/M |
3300005335|Ga0070666_10868319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 666 | Open in IMG/M |
3300005338|Ga0068868_101067977 | Not Available | 741 | Open in IMG/M |
3300005339|Ga0070660_101503460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 572 | Open in IMG/M |
3300005341|Ga0070691_10006762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 5248 | Open in IMG/M |
3300005344|Ga0070661_100677235 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 839 | Open in IMG/M |
3300005345|Ga0070692_11223283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 536 | Open in IMG/M |
3300005353|Ga0070669_100691014 | Not Available | 861 | Open in IMG/M |
3300005353|Ga0070669_100805890 | Not Available | 798 | Open in IMG/M |
3300005356|Ga0070674_101242052 | Not Available | 663 | Open in IMG/M |
3300005356|Ga0070674_101442191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 617 | Open in IMG/M |
3300005366|Ga0070659_101082581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 706 | Open in IMG/M |
3300005438|Ga0070701_10690762 | Not Available | 685 | Open in IMG/M |
3300005440|Ga0070705_100450608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 965 | Open in IMG/M |
3300005457|Ga0070662_100242102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1447 | Open in IMG/M |
3300005457|Ga0070662_100612271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 917 | Open in IMG/M |
3300005459|Ga0068867_101586452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 611 | Open in IMG/M |
3300005530|Ga0070679_100899275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 829 | Open in IMG/M |
3300005539|Ga0068853_100047951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3667 | Open in IMG/M |
3300005564|Ga0070664_101101313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 748 | Open in IMG/M |
3300005564|Ga0070664_102322835 | Not Available | 509 | Open in IMG/M |
3300005577|Ga0068857_101534045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas jaspsi | 650 | Open in IMG/M |
3300005614|Ga0068856_100005840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 12131 | Open in IMG/M |
3300005614|Ga0068856_100057657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3834 | Open in IMG/M |
3300005614|Ga0068856_100225828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1888 | Open in IMG/M |
3300005614|Ga0068856_101454308 | Not Available | 699 | Open in IMG/M |
3300005614|Ga0068856_102448050 | Not Available | 529 | Open in IMG/M |
3300005615|Ga0070702_100314153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1089 | Open in IMG/M |
3300005616|Ga0068852_101341171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 737 | Open in IMG/M |
3300005617|Ga0068859_101748425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 687 | Open in IMG/M |
3300005617|Ga0068859_101981095 | Not Available | 643 | Open in IMG/M |
3300005617|Ga0068859_102713763 | Not Available | 544 | Open in IMG/M |
3300005718|Ga0068866_10146167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1363 | Open in IMG/M |
3300005840|Ga0068870_10198388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1215 | Open in IMG/M |
3300005840|Ga0068870_11335492 | Not Available | 523 | Open in IMG/M |
3300005842|Ga0068858_100974735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 830 | Open in IMG/M |
3300005843|Ga0068860_101978638 | Not Available | 604 | Open in IMG/M |
3300005843|Ga0068860_102284079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 561 | Open in IMG/M |
3300006173|Ga0070716_101401844 | Not Available | 568 | Open in IMG/M |
3300006237|Ga0097621_100947071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 804 | Open in IMG/M |
3300006880|Ga0075429_101374579 | Not Available | 615 | Open in IMG/M |
3300009098|Ga0105245_11181333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 813 | Open in IMG/M |
3300009168|Ga0105104_10631224 | Not Available | 611 | Open in IMG/M |
3300009174|Ga0105241_12399197 | Not Available | 526 | Open in IMG/M |
3300009176|Ga0105242_10404485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1275 | Open in IMG/M |
3300009177|Ga0105248_10213641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2173 | Open in IMG/M |
3300009177|Ga0105248_10378186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1594 | Open in IMG/M |
3300009177|Ga0105248_13062854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 532 | Open in IMG/M |
3300009545|Ga0105237_10565012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1144 | Open in IMG/M |
3300009551|Ga0105238_12158076 | Not Available | 592 | Open in IMG/M |
3300010396|Ga0134126_10180209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2541 | Open in IMG/M |
3300010401|Ga0134121_10314931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1390 | Open in IMG/M |
3300011119|Ga0105246_10004152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8797 | Open in IMG/M |
3300011119|Ga0105246_11275799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 680 | Open in IMG/M |
3300012212|Ga0150985_116228090 | Not Available | 616 | Open in IMG/M |
3300012469|Ga0150984_109442211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Azospirillum → Azospirillum baldaniorum | 928 | Open in IMG/M |
3300012908|Ga0157286_10326899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300012951|Ga0164300_10555367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 668 | Open in IMG/M |
3300012986|Ga0164304_10881429 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 698 | Open in IMG/M |
3300012989|Ga0164305_11102455 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 682 | Open in IMG/M |
3300013100|Ga0157373_10059036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2718 | Open in IMG/M |
3300013100|Ga0157373_10063118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2624 | Open in IMG/M |
3300013100|Ga0157373_10406580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 976 | Open in IMG/M |
3300013100|Ga0157373_10596306 | Not Available | 804 | Open in IMG/M |
3300013102|Ga0157371_10072695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2435 | Open in IMG/M |
3300013102|Ga0157371_10164513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1584 | Open in IMG/M |
3300013102|Ga0157371_10563957 | Not Available | 845 | Open in IMG/M |
3300013102|Ga0157371_11406713 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 542 | Open in IMG/M |
3300013102|Ga0157371_11523037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 522 | Open in IMG/M |
3300013102|Ga0157371_11592509 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 511 | Open in IMG/M |
3300013104|Ga0157370_10172808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2008 | Open in IMG/M |
3300013105|Ga0157369_11057182 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 830 | Open in IMG/M |
3300013105|Ga0157369_11648578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 652 | Open in IMG/M |
3300013296|Ga0157374_12046519 | Not Available | 599 | Open in IMG/M |
3300013297|Ga0157378_11862227 | Not Available | 650 | Open in IMG/M |
3300013306|Ga0163162_12304315 | Not Available | 619 | Open in IMG/M |
3300013307|Ga0157372_11725264 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300013307|Ga0157372_12385200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 607 | Open in IMG/M |
3300013308|Ga0157375_10206627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2120 | Open in IMG/M |
3300014969|Ga0157376_11099139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 821 | Open in IMG/M |
3300015371|Ga0132258_13423377 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1089 | Open in IMG/M |
3300015374|Ga0132255_103874204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 636 | Open in IMG/M |
3300020070|Ga0206356_10016647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1558 | Open in IMG/M |
3300025903|Ga0207680_10336154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1059 | Open in IMG/M |
3300025904|Ga0207647_10010940 | All Organisms → cellular organisms → Bacteria | 6382 | Open in IMG/M |
3300025907|Ga0207645_10427409 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
3300025908|Ga0207643_10191293 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1242 | Open in IMG/M |
3300025908|Ga0207643_10976479 | Not Available | 548 | Open in IMG/M |
3300025909|Ga0207705_10208521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1482 | Open in IMG/M |
3300025909|Ga0207705_11076403 | Not Available | 620 | Open in IMG/M |
3300025911|Ga0207654_11389263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 512 | Open in IMG/M |
3300025913|Ga0207695_11200221 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 639 | Open in IMG/M |
3300025917|Ga0207660_10300185 | Not Available | 1279 | Open in IMG/M |
3300025917|Ga0207660_10495590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 991 | Open in IMG/M |
3300025919|Ga0207657_10459656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 999 | Open in IMG/M |
3300025920|Ga0207649_10135326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1679 | Open in IMG/M |
3300025920|Ga0207649_11025536 | Not Available | 650 | Open in IMG/M |
3300025920|Ga0207649_11472922 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 539 | Open in IMG/M |
3300025923|Ga0207681_10649303 | Not Available | 875 | Open in IMG/M |
3300025925|Ga0207650_11321690 | Not Available | 614 | Open in IMG/M |
3300025925|Ga0207650_11591476 | Not Available | 555 | Open in IMG/M |
3300025932|Ga0207690_10006278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 7039 | Open in IMG/M |
3300025932|Ga0207690_10579627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 914 | Open in IMG/M |
3300025933|Ga0207706_11343416 | Not Available | 589 | Open in IMG/M |
3300025936|Ga0207670_10756617 | Not Available | 807 | Open in IMG/M |
3300025941|Ga0207711_10529325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1099 | Open in IMG/M |
3300025941|Ga0207711_10552391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1074 | Open in IMG/M |
3300025944|Ga0207661_11812736 | Not Available | 556 | Open in IMG/M |
3300025945|Ga0207679_10153666 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1876 | Open in IMG/M |
3300025945|Ga0207679_10226761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1575 | Open in IMG/M |
3300025945|Ga0207679_12051730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 520 | Open in IMG/M |
3300025960|Ga0207651_10213308 | Not Available | 1555 | Open in IMG/M |
3300025981|Ga0207640_10206771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1492 | Open in IMG/M |
3300025981|Ga0207640_10682772 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 878 | Open in IMG/M |
3300026023|Ga0207677_12192531 | Not Available | 514 | Open in IMG/M |
3300026067|Ga0207678_10501026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1058 | Open in IMG/M |
3300026078|Ga0207702_10186331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1914 | Open in IMG/M |
3300026078|Ga0207702_11411720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 690 | Open in IMG/M |
3300026089|Ga0207648_11599388 | Not Available | 612 | Open in IMG/M |
3300026142|Ga0207698_10448496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1245 | Open in IMG/M |
3300026142|Ga0207698_11941490 | Not Available | 603 | Open in IMG/M |
3300027725|Ga0209178_1220165 | Not Available | 678 | Open in IMG/M |
3300028379|Ga0268266_10767931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 930 | Open in IMG/M |
3300028381|Ga0268264_12121609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 570 | Open in IMG/M |
3300028590|Ga0247823_10158464 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1727 | Open in IMG/M |
3300028608|Ga0247819_10367947 | Not Available | 822 | Open in IMG/M |
3300028889|Ga0247827_11352288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 500 | Open in IMG/M |
3300031740|Ga0307468_101976282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 558 | Open in IMG/M |
3300031824|Ga0307413_10444963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1027 | Open in IMG/M |
3300031858|Ga0310892_10917536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 614 | Open in IMG/M |
3300031943|Ga0310885_10466863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 683 | Open in IMG/M |
3300031944|Ga0310884_10050541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1862 | Open in IMG/M |
3300031996|Ga0308176_10860479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 950 | Open in IMG/M |
3300032000|Ga0310903_10439645 | Not Available | 671 | Open in IMG/M |
3300032004|Ga0307414_11289390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 677 | Open in IMG/M |
3300032005|Ga0307411_11544180 | Not Available | 611 | Open in IMG/M |
3300032013|Ga0310906_11168281 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 559 | Open in IMG/M |
3300032211|Ga0310896_10816406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 535 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 15.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 10.46% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 9.80% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.19% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.88% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.58% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.27% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.61% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.61% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.61% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.61% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.31% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.31% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.31% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.65% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.65% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.65% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.65% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.65% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.65% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.65% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.65% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.65% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573000 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms) | Environmental | Open in IMG/M |
3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Host-Associated | Open in IMG/M |
3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Host-Associated | Open in IMG/M |
3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
N55_10667680 | 2189573000 | Grass Soil | EKSAISWDKNVAPTLGQRLSYERGTSASHQPCALNLMTI |
JGI24739J22299_101996871 | 3300001989 | Corn Rhizosphere | RFERSAFSWDNDSVPTVGQRLSYDVGTSKESHPCALNLATI* |
JGI24748J21848_10578412 | 3300002074 | Corn, Switchgrass And Miscanthus Rhizosphere | AKGLGEIKPEVAGNDIRFETSAILWDKKVPPVVGQRLSYDVGTGSDRQPTALNLQTI* |
JGI24034J26672_100044593 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | IKPETGGNDLGFEKSSIQWDKNIAPTVGQRLSYDVGTNNERQPCALNLQTV* |
Ga0063454_1006657691 | 3300004081 | Soil | PLRFEVGAIMWDKKIAPVIGQRLSYDVGQGVDRQPTALNLQTI* |
Ga0062593_1022864561 | 3300004114 | Soil | QGRGEIKPETGGNDLPFEKSAIQWDKNVDPTVGQRLSYDVGQTSERHPCALNLQTI* |
Ga0063356_1004502603 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TGGDMLGFERSAFSWENGSVPTVGQRLSYDVGTSKDRHPCALNLATI* |
Ga0063356_1007445802 | 3300004463 | Arabidopsis Thaliana Rhizosphere | TQEAGGDDLRFEKSAISWDKDIAPTLGQRLSYERGTSNDRQPCALNLMTI* |
Ga0062592_1014430702 | 3300004480 | Soil | MKYFGTVTSYDPVKGNGELKQEVGGTDLPFEKTAFQWDKDVAPSIGQRLSYDIGQSSDRRSCALNLQTI* |
Ga0062594_1000827437 | 3300005093 | Soil | QETGGNDLPFEKSAIQWDQNVDPTIGQRLSYDVGQTSERRPCAINLQTI* |
Ga0062594_1001543321 | 3300005093 | Soil | KGHGEIKQEAGGNDLRFETSAIKWDKNVAPTIGQRLSYDIGQNSERQPCALNLQTI* |
Ga0070658_104548242 | 3300005327 | Corn Rhizosphere | GNDLRFETAAIMWDKNIAPVIGQRLSYDVGQNAERHPRALNLQTI* |
Ga0070658_113722441 | 3300005327 | Corn Rhizosphere | NDLRFETSAIMWDKNVAPVIGQRLSYDVGQSPERHPCALNVQTI* |
Ga0070658_117268312 | 3300005327 | Corn Rhizosphere | KPETGGDMLRFERSAFSWENNAVPTVGQRLSYDVGTNPERQPCALNLQTI* |
Ga0070676_109068731 | 3300005328 | Miscanthus Rhizosphere | GDAIRFETSAIMWDKNVAPTIGQRLSYDVGTNNERQPRALNLMTI* |
Ga0070666_108683191 | 3300005335 | Switchgrass Rhizosphere | EAGGNDLPFEKSAIAWAKNIVPTLGQRLSYDVGTGTDRQPCALNLQTV* |
Ga0068868_1010679772 | 3300005338 | Miscanthus Rhizosphere | PLRFEIGAIMWDKKVAPVIGQRLSYDVGQGTDRQPTALNLQTV* |
Ga0070660_1015034601 | 3300005339 | Corn Rhizosphere | GEIKQEAGGNDLGFEKAAISWDKNIAPTIGQRLSYDLGTTTDRKPCALNLQTI* |
Ga0070691_100067621 | 3300005341 | Corn, Switchgrass And Miscanthus Rhizosphere | IKGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRLSYDVGQTSERAPCALNLQTI* |
Ga0070661_1006772353 | 3300005344 | Corn Rhizosphere | QEAGGNDLPFETSAIQWDKNVAPAVGQRLSYDVGQTRERAPCALNLQTI* |
Ga0070692_112232831 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | GGNDLRFETSAIMWDKNVAPVIGQRLSYDVGQSPERHPCALNVQTI* |
Ga0070669_1006910143 | 3300005353 | Switchgrass Rhizosphere | PEVAGNPLRFEIGAIMWDKKVAPVIGQRLSYDVGQGTDRQPTALNLQTV* |
Ga0070669_1008058901 | 3300005353 | Switchgrass Rhizosphere | KGHGEIKPEAGGNDLPFETSAIQWDKTVAPTVGQRLSYDVGQTSARAPCALNLQTI* |
Ga0070674_1012420521 | 3300005356 | Miscanthus Rhizosphere | LPFEKSAIAWAKNIVPTLGQRLSYDVGTGTDRQPCALNLQTV* |
Ga0070674_1014421911 | 3300005356 | Miscanthus Rhizosphere | DMLGFERSAFAWTGDTIPTVGQRLSYDVGTNEQRQPCALNLQTI* |
Ga0070659_1010825811 | 3300005366 | Corn Rhizosphere | RFETSAIQWDKNIAPTIGQRLSYDVGQSSDRQPCALNLQTI* |
Ga0070701_106907621 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | FDVTQGRGEIKPETGGNDLPFEKSAIQWDKNVDPTVGQRLSYDVGQTSERHPCALNLQTI |
Ga0070705_1004506082 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | DMLRFERSAFSWENDSVPTVGQRLSYDVGTSKESHPCALNLATI* |
Ga0070662_1002421024 | 3300005457 | Corn Rhizosphere | KPETGGDMLRFERSAFSWEKNAVPTVGQRLSYDVGTNTQRQPCALNLQTI* |
Ga0070662_1006122713 | 3300005457 | Corn Rhizosphere | FDTIKGHGEIKQEAGGNDLRFETSAIMWDKNVAPVIGQRLSYDVGQTPERHPCALNLQTI |
Ga0068867_1015864521 | 3300005459 | Miscanthus Rhizosphere | GGNDLPFEKSAIAWAKNIVPTLGQRLSYDVGTGTDRQPCALNLQTV* |
Ga0070679_1008992752 | 3300005530 | Corn Rhizosphere | IKQEAGGNDLPFETAAISWDKKVAPTVGQRLSYDVGTNTERQPCALNLQTI* |
Ga0068853_1000479511 | 3300005539 | Corn Rhizosphere | GDMLRFESSAFSWEDKSVPMVGQRLSYDVGTTKERQPCALNLETI* |
Ga0070664_1011013132 | 3300005564 | Corn Rhizosphere | MLRFERSAFSWEKNAVPTVGQRLSYDVGTNTQRQPCALNLQTI* |
Ga0070664_1023228351 | 3300005564 | Corn Rhizosphere | GHGEIKQEAGGNDLPFETSAIQWDKTVAPTIGQRLSYDVGQSSQRQPCALNLQTI* |
Ga0068857_1015340453 | 3300005577 | Corn Rhizosphere | FERSAFSWENDSVPAVGQRLSYDVGTSKDRQPCALNLATI* |
Ga0068856_1000058401 | 3300005614 | Corn Rhizosphere | QEAGGNDLPFETSAIQWDKNVAPTVGQRLSYDVGQTSERVPCALNLQTI* |
Ga0068856_1000576571 | 3300005614 | Corn Rhizosphere | RFERGAFSWENKAVPTVGQRLSYDVGTTNERQPCALNLQTI* |
Ga0068856_1002258284 | 3300005614 | Corn Rhizosphere | TGGDMLRFERGAFSWENKAVPTVGQRLSYDVGTNNERQPCALNLQTI* |
Ga0068856_1014543083 | 3300005614 | Corn Rhizosphere | NPEVAGNPIRFEVGAILWDKEVSPVIGQRLSYDVGQGVDRQPTALNLQTI* |
Ga0068856_1024480503 | 3300005614 | Corn Rhizosphere | SWDKNIAPTIGQRLSYDLGTTTDRKPCALNLQTI* |
Ga0070702_1003141531 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GNDIRFETSAILWDKKVPPVVGQRLSYDVGTGSDRQPTALNLQTI* |
Ga0068852_1013411712 | 3300005616 | Corn Rhizosphere | LRFEKSAIAWDKNIHPTVGQRLSYDVGTSTDRQPCALNLQTI* |
Ga0068859_1017484251 | 3300005617 | Switchgrass Rhizosphere | SWDKNIAPTVGQRLSYDVGTNNERQPCALNLMTV* |
Ga0068859_1019810953 | 3300005617 | Switchgrass Rhizosphere | IKQEAGGNDLPFETSAIQWDKTVAPTIGQRLSYDVGQSSQRQPCALNLQTI* |
Ga0068859_1027137632 | 3300005617 | Switchgrass Rhizosphere | EKSAIAWDNDIAPTLGQRLSYEKGTSADHKPCALNLMTI* |
Ga0068866_101461673 | 3300005718 | Miscanthus Rhizosphere | IKQEAGGNDLRFETSAIKWDKNVAPTIGQRLSYDIGQNSERQPCALNFQTI* |
Ga0068870_101983883 | 3300005840 | Miscanthus Rhizosphere | GGNDLRFETSAIKWDKNVAPTIGQRLSYDIGQNSERQPCALNLQTI* |
Ga0068870_113354923 | 3300005840 | Miscanthus Rhizosphere | EAGGNDLPFETSAIQWDKTVAPTIGQRLSYDVGQSSQRQPCALNLQTI* |
Ga0068858_1009747353 | 3300005842 | Switchgrass Rhizosphere | SWDKDTLPTVGQRLSYDVGTNNERQPCALNLQTI* |
Ga0068860_1019786381 | 3300005843 | Switchgrass Rhizosphere | EVAGNDIRFETSAILWDKKVPPVVGQRLSYDVGTGSDRQPTALNLQTI* |
Ga0068860_1022840791 | 3300005843 | Switchgrass Rhizosphere | RFEKSAISWDKNIAPTVGQRLSYDVGTNNERQPCALNLMTV* |
Ga0070716_1014018441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GNDLRFETSAIMWDKNVAPVIGQRLSYDVGQTPERHPCALNLQTI* |
Ga0097621_1009470712 | 3300006237 | Miscanthus Rhizosphere | VKSFDTIKGHGEIKQEAGGNDLPFKTSAILWDKNVAPTVGQRLSYDVGQTSERAPCALNLQTI* |
Ga0075429_1013745792 | 3300006880 | Populus Rhizosphere | SAFSWENNNVPTVGQRLSYDVGTTKERQPCALNLATI* |
Ga0105245_111813331 | 3300009098 | Miscanthus Rhizosphere | RFEKSAISWDKNVAPTEGQRLSYERGTAADHKPCALNLMTI* |
Ga0105104_106312242 | 3300009168 | Freshwater Sediment | ERSAFSWENGSVPAVGQRLSYDVGTSKESLPCALNLATI* |
Ga0105241_123991971 | 3300009174 | Corn Rhizosphere | MLRFERGAFSWENKAVPTVGQRLSYDVGTNNERQPCALNLQTI* |
Ga0105242_104044851 | 3300009176 | Miscanthus Rhizosphere | SSIQWDKNIAPTVGQRLSYDVGTNNERQPCALNLQTV* |
Ga0105248_102136411 | 3300009177 | Switchgrass Rhizosphere | IQWDKSVAPTVGQRLSYDVGQSSESQPCALNLQTI* |
Ga0105248_103781863 | 3300009177 | Switchgrass Rhizosphere | EAGGNDLRFEKSAIAWDKNIHPTVGQRLSYDVGTSTDRQPCALNLQTI* |
Ga0105248_130628541 | 3300009177 | Switchgrass Rhizosphere | SWDKNVAPTVGQRLSYERGTSASHQPCALNLMTI* |
Ga0105237_105650122 | 3300009545 | Corn Rhizosphere | NDLGFEKSSIQWDKNIAPTVGQRLSYDVGTNHERQPCALNVQTV* |
Ga0105238_121580761 | 3300009551 | Corn Rhizosphere | MWDKNIAPVIGQRLGYDVGQTPERHPCALNLQTI* |
Ga0134126_101802097 | 3300010396 | Terrestrial Soil | QWDKNVAPTIGQRLSYDVGQTSERQACALNLQTI* |
Ga0134121_103149315 | 3300010401 | Terrestrial Soil | LPFETSAIQWDKNVAPTVGQRLSYDVGQTGERQPCALNLQTI* |
Ga0105246_1000415213 | 3300011119 | Miscanthus Rhizosphere | DPRHDIPVEAGGNDLRFETSAIKWDKNVAPTIGQRLSYDIGQNSERQPCALNLQTI* |
Ga0105246_112757991 | 3300011119 | Miscanthus Rhizosphere | KSAISWDKNVAPTVGQRLSYERGTSASHQPCALNLMTI* |
Ga0150985_1162280901 | 3300012212 | Avena Fatua Rhizosphere | VGAILWDKKIAPVIGQRLSYDVGHGVDRQPTALKLQTI* |
Ga0150984_1094422111 | 3300012469 | Avena Fatua Rhizosphere | GAILWDKKIAPVIGQRLSYDVGHGVDRQPTALNVQTI* |
Ga0157286_103268992 | 3300012908 | Soil | RSAFSWDNDSVPTVGQRLSYDVGTSKESHPCALNLATI* |
Ga0164300_105553672 | 3300012951 | Soil | GEIKQEAGGNDLGFQKSAIGWDKNIAPTVGQRLSYDVGTNNERQPCALNLQTI* |
Ga0164304_108814291 | 3300012986 | Soil | DLRFEKSAIAWDKNIHPTVGQRLSYDVGTSTDRQPCALNLQTI* |
Ga0164305_111024552 | 3300012989 | Soil | DLSTGHGEIKQEAGGNDLRFEKSAIAWDKNIHPTVGQRLSYDVGTSTDRQPCALNLQTI* |
Ga0157373_100590361 | 3300013100 | Corn Rhizosphere | PETGGDMLRFERGAFSWENKAVPTVGQRLSYDVGTNNERQPCALNLQTI* |
Ga0157373_100631188 | 3300013100 | Corn Rhizosphere | FETSAIMWDKNVAPVIGQRLSYDVGQTPERHPCALNLQTI* |
Ga0157373_104065801 | 3300013100 | Corn Rhizosphere | NDLRFETSAIQWDKSIAPTVGQRLSYDVGQSSDRAPCALNLQKI* |
Ga0157373_105963061 | 3300013100 | Corn Rhizosphere | QEAGGDDLRFEKGVISWDKTVAPTVGQRLSYERGTSADHKPCALNLMTI* |
Ga0157371_100726951 | 3300013102 | Corn Rhizosphere | IKQEAGGNDLRFETSAIMWDKNVAPVIGQRLSYDVGQSPERHPCALNVQTI* |
Ga0157371_101645135 | 3300013102 | Corn Rhizosphere | GEIKPETGGNDLPFEKSAIQWDKNVDPTVGQRLSYDVGQTSERHPCALNLQTI* |
Ga0157371_105639571 | 3300013102 | Corn Rhizosphere | IKGHGEIKQEAGGNDLRFETSAIQWDKNIAPTIGQRLSYDVGQSSDRQPCALNLQTI* |
Ga0157371_114067131 | 3300013102 | Corn Rhizosphere | KSAISWDKNVAPTQGQRLSYERGTSADRKPCALNLMTI* |
Ga0157371_115230372 | 3300013102 | Corn Rhizosphere | SAISWDKDIAPTLGQRLSYERGTSNDRQPCALNLMTI* |
Ga0157371_115925091 | 3300013102 | Corn Rhizosphere | RFEKSAISWDKNVAPTQGQRLSYERGTAADHKPCALNLMTI* |
Ga0157370_101728081 | 3300013104 | Corn Rhizosphere | IMWDKNVAPVIGQRLSYDVGQTPERHPCALNLQTI* |
Ga0157369_110571822 | 3300013105 | Corn Rhizosphere | GEIIQEAGGNDLRFETSAIQWDKNIAPKVGQRLSYDVGQSSNRAPCALNLQTI* |
Ga0157369_116485782 | 3300013105 | Corn Rhizosphere | ETSAIKWDKNVAPTIGQRLSYDIGQNSERQPCALNLQTI* |
Ga0157374_120465191 | 3300013296 | Miscanthus Rhizosphere | GEIKQEAGGNDLPFETSAIQWDKSVAPTVGQRLSYDVGQTSERAPCALNLQTI* |
Ga0157378_118622271 | 3300013297 | Miscanthus Rhizosphere | TGGNDLPFEKSAIQWDKNVDPTVGQRLSYDVGQTSERHPCALNLQTI* |
Ga0163162_123043151 | 3300013306 | Switchgrass Rhizosphere | TSAIQWDKNVAPTVGQRLSYDVGQSNERLPCALNLQTI* |
Ga0157372_117252643 | 3300013307 | Corn Rhizosphere | EAGGNDLHFNKSAIAWGKEIAPVVGQRLSYDVGTDTDRQPCALNLQTI* |
Ga0157372_123852002 | 3300013307 | Corn Rhizosphere | DLRFETSAIQWDKNVAPTVGQRLSYDVGQTNDRQPCALNLQTI* |
Ga0157375_102066271 | 3300013308 | Miscanthus Rhizosphere | EIGAIMWDKKVAPVIGQRLSYDVGQGTDRQPTALNLQTV* |
Ga0157376_110991391 | 3300014969 | Miscanthus Rhizosphere | GEIKQEAGGNDLPFETGAIQWDKNVAPTVGQRLSYDVGQTSERAPCALNLQTI* |
Ga0132258_134233771 | 3300015371 | Arabidopsis Rhizosphere | KPEAGGDMLRFERSAFSWENDSVPTVGQRLSYDVGTTSERQPCALNLATI* |
Ga0132255_1038742042 | 3300015374 | Arabidopsis Rhizosphere | KPEAGGDMLRFERSAFSWDNDSVPTVGQRLSYDVGTSKESHPCALNLATI* |
Ga0206356_100166471 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | TIKGHGEIKQEAGGNDLRFETSAIMWDKNVAPVIGQRLSYDVGQSPERHPCALNLQTI |
Ga0207680_103361541 | 3300025903 | Switchgrass Rhizosphere | AFSWENDSVPTVGQRLSYDVGTSKESHPCALNLATI |
Ga0207647_100109401 | 3300025904 | Corn Rhizosphere | IKGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRLSYDVGQNSERVPCALNLQTI |
Ga0207645_104274091 | 3300025907 | Miscanthus Rhizosphere | AFSWEKNAVPTVGQRLSYDVGTNTQRQPCALNLQTI |
Ga0207643_101912931 | 3300025908 | Miscanthus Rhizosphere | GHGEIKQEAGGNDLRFETSAIKWDKNVAPTIGQRLSYDIGQNSERQPCALNLQTI |
Ga0207643_109764793 | 3300025908 | Miscanthus Rhizosphere | SAIQWDKTVAPTIGQRLSYDVGQSSQRQPCALNLQTI |
Ga0207705_102085211 | 3300025909 | Corn Rhizosphere | IKQEAGGNDLRFETSAIQWDKNIAPTVGQRLSYDVGQTSDRAPCALNLQTI |
Ga0207705_110764032 | 3300025909 | Corn Rhizosphere | DMLRFERSAFSWKNDAVPSVGQRLSYDVGTNTERQPCALNLQTI |
Ga0207654_113892631 | 3300025911 | Corn Rhizosphere | KSFDTIKGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRLSYDVGQTSERAPCALNLQTI |
Ga0207695_112002212 | 3300025913 | Corn Rhizosphere | MLRFERSAFSWENNAVPTVGQRLSYDVGTTPQRQPCALNLQTI |
Ga0207660_103001852 | 3300025917 | Corn Rhizosphere | LRFETSAIMWDKNVAPVIGQRLSYDVGQSPERHPCALNVQTI |
Ga0207660_104955901 | 3300025917 | Corn Rhizosphere | IQWDKNVAPTVGQRLSYDVGQNSERAPCALNLQTI |
Ga0207657_104596561 | 3300025919 | Corn Rhizosphere | FEKSAISWDKNVAPTVGQRLSYERGTSASHQPCALNLMTI |
Ga0207649_101353265 | 3300025920 | Corn Rhizosphere | KGHGEIKQEAGGNDLPFETSAIQWDKNVAPAVGQRLSYDVGQTRERAPCALNLQTI |
Ga0207649_110255361 | 3300025920 | Corn Rhizosphere | ETGGNDLPFEKSAIAWGNDVDPTLGQRLSYDVGQSSDRQPCALNLQTI |
Ga0207649_114729221 | 3300025920 | Corn Rhizosphere | GHGEIKQEAGGNDLRFETSAIQWDKNVAPTVGQRLSYDVGQTNDRQPCALNLQTI |
Ga0207681_106493031 | 3300025923 | Switchgrass Rhizosphere | LRFEIGAIMWDKKVAPVIGQRLSYDVGQGTDRQPTALNLQTV |
Ga0207650_113216901 | 3300025925 | Switchgrass Rhizosphere | FSWKNDHVPTVGQRLSYDVGTTKERQPCALNLATI |
Ga0207650_115914761 | 3300025925 | Switchgrass Rhizosphere | MKYFGTVTSYDPVKGNGELKQEVGGTDLPFEKTAFQWDKDVAPSIGQRLSYDIGQSSDRRSCALNLQTI |
Ga0207690_100062781 | 3300025932 | Corn Rhizosphere | LRFEKSAISWDKNVAPTPGQRLSYERGTATDHKPCALNLMTI |
Ga0207690_105796271 | 3300025932 | Corn Rhizosphere | RSAFSWEKNTVPTVGQRLSYEVGTNPQRQPCALNLQTI |
Ga0207706_113434161 | 3300025933 | Corn Rhizosphere | DLPFEKSAIQWDQNVDPTIGQRLSYDVGQTSERRPCAINLQTI |
Ga0207670_107566173 | 3300025936 | Switchgrass Rhizosphere | IQWDKTVAPTVGQRLSYDVGQTSARAPCALNLQTI |
Ga0207711_105293255 | 3300025941 | Switchgrass Rhizosphere | IQWDKTVAPTIGQRLSYDVGQSSQRQPCALNLQTI |
Ga0207711_105523914 | 3300025941 | Switchgrass Rhizosphere | AIQWDKSVAPTVGQRLSYDVGQSSESQPCALNLQTI |
Ga0207661_118127361 | 3300025944 | Corn Rhizosphere | KQEAGGDDLHFDKSAIAWDQSVAPTQGQRISYERGIMPDRQPCALNLQTI |
Ga0207679_101536664 | 3300025945 | Corn Rhizosphere | RFEKSAIAWDNDIAPTLGQRLSYEKGTSADHKPCALNLMTI |
Ga0207679_102267613 | 3300025945 | Corn Rhizosphere | KGHGEIKQEAGGNDLPFETSAIQWDKNVAPTVGQRLSYDVGQNSERVPCALNLQTI |
Ga0207679_120517301 | 3300025945 | Corn Rhizosphere | MLRFERSAFSWEKNAVPTVGQRLSYDVGTNTQRQPCALNLQTI |
Ga0207651_102133084 | 3300025960 | Switchgrass Rhizosphere | SPLRFEIGAIMWDKKVAPVIGQRLSYDVGQGTDRQPTALNLQTV |
Ga0207640_102067711 | 3300025981 | Corn Rhizosphere | AGGNDLPFETSAIQWDKNVAPAVGQRLSYDVGQTRERAPCALNLQTI |
Ga0207640_106827722 | 3300025981 | Corn Rhizosphere | LRFETSAIQWDKNIAPKVGQRLSYDVGQSSDRAPCALNLQTI |
Ga0207677_121925312 | 3300026023 | Miscanthus Rhizosphere | FETSAILWDKKVPPVVGQRLSYDVGTGSDRQPTALNLQTI |
Ga0207678_105010263 | 3300026067 | Corn Rhizosphere | KGLGEITQEAGGDDLRFDKSAIQWDQNVAPTVGQRLTYDRGIMADRQPCAMNLMTI |
Ga0207702_101863314 | 3300026078 | Corn Rhizosphere | IKPETGGDMLRFERGAFSWENKAVPTVGQRLSYDVGTNNERQPCALNLQTI |
Ga0207702_114117201 | 3300026078 | Corn Rhizosphere | TSAIQWDKNVAPTVGQRLSYDVGQTGERQPCALNLQTI |
Ga0207648_115993882 | 3300026089 | Miscanthus Rhizosphere | GGNDLPFEKSAIAWAKNIVPTLGQRLSYDVGTGTDRQPCALNLQTV |
Ga0207698_104484961 | 3300026142 | Corn Rhizosphere | STGHGEIKQEAGGNDLRFEKSAIAWDKNIHPTVGQRLSYDVGTSTDRQPCALNLQTI |
Ga0207698_119414901 | 3300026142 | Corn Rhizosphere | EVAGSPLRFEIGAIMWDKKVAPVIGQRLSYDVGQGTDRQPTALNLQTV |
Ga0209178_12201651 | 3300027725 | Agricultural Soil | HGEIKQEAGGNDLPFETSAIQWEKNVAPTVGQRLSYDVGQTSERQPCALNLQTI |
Ga0268266_107679311 | 3300028379 | Switchgrass Rhizosphere | AIAWDQSVAPTQGQRISYERGIMPDRQPCALNLQTI |
Ga0268264_121216091 | 3300028381 | Switchgrass Rhizosphere | ELRFEKSAISWDKNIAPTVGQRLSYDVGTNNERQPCALNLMTV |
Ga0247823_101584641 | 3300028590 | Soil | RSAFSWDNDSVPTVGQRLSYDVGTSKESHPCALNLATI |
Ga0247819_103679472 | 3300028608 | Soil | AFSWPKDIVPTIGQRLSYDVGTNNQLSCALNLQTI |
Ga0247827_113522881 | 3300028889 | Soil | FEKSAIQWDKNVAPTVGQRLSYDVGQTSERAPCALNLQTI |
Ga0307468_1019762821 | 3300031740 | Hardwood Forest Soil | ERSAFSWEKNSVPTVGQRLSYDVGTNKERQPCALNLQTI |
Ga0307413_104449631 | 3300031824 | Rhizosphere | FERSAFSWEDNSVPTVGQRLSYDVGTTKERQPCALNLETI |
Ga0310892_109175362 | 3300031858 | Soil | VSWAENAAPTVGQRLSYDVGTNGQRQPCALNLQTI |
Ga0310885_104668633 | 3300031943 | Soil | SAFTWDKDVVPTVGQRLSYDKGTSNEQPAALNLQSI |
Ga0310884_100505416 | 3300031944 | Soil | TIKGHGEIKQEAGGNDLPFEKSAIQWDKNVAPTVGQRLSYDVGQTSERAPCALNLQTI |
Ga0308176_108604792 | 3300031996 | Soil | LRFERGAFSWEKNAVPTVGQRLSYDVGTDTARQPCALNLQTI |
Ga0310903_104396452 | 3300032000 | Soil | GNDLPFEKSAIQWDQNVDPTIGQRLSYDVGQTSERRPCAINLQTI |
Ga0307414_112893901 | 3300032004 | Rhizosphere | GGDDLRFEKSAISWDKDIAPTLGQRLSYERGTSNDRQPCALNLMTI |
Ga0307411_115441802 | 3300032005 | Rhizosphere | GAFSWAENSVPAVGQRLSYDRGTDKDRQPCAVNLETI |
Ga0310906_111682811 | 3300032013 | Soil | PETGGDPLRFERAAVSWAENAAPTVGQRLSYDVGTNGQRQPCALNLQTI |
Ga0308173_101709131 | 3300032074 | Soil | ITQETGGDDLRFETTAIMWDKKIAPVIGQRLSYERGANDERQPRALNLMTI |
Ga0310896_108164062 | 3300032211 | Soil | QEAGGDMLPFDRSAFTWDKDVVPTVGQRLSYDKGTSNEQPAALNLQSI |
⦗Top⦘ |