NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F044599

Metagenome / Metatranscriptome Family F044599

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F044599
Family Type Metagenome / Metatranscriptome
Number of Sequences 154
Average Sequence Length 44 residues
Representative Sequence ALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
Number of Associated Samples 130
Number of Associated Scaffolds 154

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.30 %
% of genes near scaffold ends (potentially truncated) 98.70 %
% of genes from short scaffolds (< 2000 bps) 94.16 %
Associated GOLD sequencing projects 120
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.351 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(19.480 % of family members)
Environment Ontology (ENVO) Unclassified
(19.481 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.753 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 44.12%    β-sheet: 0.00%    Coil/Unstructured: 55.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 154 Family Scaffolds
PF02156Glyco_hydro_26 37.66
PF00293NUDIX 1.30
PF00398RrnaAD 0.65
PF00535Glycos_transf_2 0.65
PF13692Glyco_trans_1_4 0.65
PF13231PMT_2 0.65
PF13641Glyco_tranf_2_3 0.65

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 154 Family Scaffolds
COG4124Beta-mannanaseCarbohydrate transport and metabolism [G] 37.66
COG003016S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity)Translation, ribosomal structure and biogenesis [J] 0.65


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.35 %
UnclassifiedrootN/A0.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908045|KansclcFeb2_ConsensusfromContig575780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300000956|JGI10216J12902_124930673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia769Open in IMG/M
3300004478|Ga0068972_1289841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia689Open in IMG/M
3300005339|Ga0070660_101061108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300005435|Ga0070714_101619093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300005436|Ga0070713_101212384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300005467|Ga0070706_101029227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300005530|Ga0070679_101594915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces600Open in IMG/M
3300005541|Ga0070733_11033031All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300005591|Ga0070761_10615903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300005591|Ga0070761_10670222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia648Open in IMG/M
3300005614|Ga0068856_100822062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces948Open in IMG/M
3300005764|Ga0066903_105140203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium693Open in IMG/M
3300005952|Ga0080026_10153116All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300005983|Ga0081540_1290877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300006028|Ga0070717_11378702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces640Open in IMG/M
3300006176|Ga0070765_101374648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces665Open in IMG/M
3300006176|Ga0070765_101833573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium569Open in IMG/M
3300006237|Ga0097621_100210895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1690Open in IMG/M
3300006579|Ga0074054_11982893All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia592Open in IMG/M
3300006755|Ga0079222_11792319All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300006804|Ga0079221_10083740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1524Open in IMG/M
3300006806|Ga0079220_10328253All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces mirabilis961Open in IMG/M
3300006806|Ga0079220_10579838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium791Open in IMG/M
3300006806|Ga0079220_11789714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300006854|Ga0075425_100146903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2699Open in IMG/M
3300006854|Ga0075425_101114705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia898Open in IMG/M
3300006871|Ga0075434_102452631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces523Open in IMG/M
3300009101|Ga0105247_10063133All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces2299Open in IMG/M
3300009101|Ga0105247_10700233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium762Open in IMG/M
3300009162|Ga0075423_12950324All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300009174|Ga0105241_10303741All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1370Open in IMG/M
3300009630|Ga0116114_1161596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300010048|Ga0126373_11692404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300010048|Ga0126373_12567007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300010337|Ga0134062_10683653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300010361|Ga0126378_11497866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300010376|Ga0126381_103566379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300010396|Ga0134126_11812971All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300010398|Ga0126383_10639843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1138Open in IMG/M
3300010398|Ga0126383_12208340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300012096|Ga0137389_11710327All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300012206|Ga0137380_11127864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300012206|Ga0137380_11141582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300012285|Ga0137370_10581449All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium691Open in IMG/M
3300012351|Ga0137386_10800884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300012683|Ga0137398_11241479All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300012951|Ga0164300_10794296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300012971|Ga0126369_12050201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300012988|Ga0164306_10798908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium759Open in IMG/M
3300013102|Ga0157371_10918072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium665Open in IMG/M
3300013307|Ga0157372_12928717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium546Open in IMG/M
3300013501|Ga0120154_1149687All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium526Open in IMG/M
3300014150|Ga0134081_10122377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300016387|Ga0182040_11239944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300017959|Ga0187779_11012836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300017970|Ga0187783_11261321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium532Open in IMG/M
3300017975|Ga0187782_10446726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium985Open in IMG/M
3300018007|Ga0187805_10178371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium968Open in IMG/M
3300018014|Ga0187860_1381708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300018034|Ga0187863_10112071All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300018037|Ga0187883_10423751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300018038|Ga0187855_10111546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1647Open in IMG/M
3300018040|Ga0187862_10046841All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3163Open in IMG/M
3300018040|Ga0187862_10552620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium687Open in IMG/M
3300018043|Ga0187887_10354582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
3300020583|Ga0210401_10065171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3431Open in IMG/M
3300021171|Ga0210405_11252981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300021180|Ga0210396_10768191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium829Open in IMG/M
3300021180|Ga0210396_11569742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300021402|Ga0210385_11290255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium560Open in IMG/M
3300021402|Ga0210385_11472065All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300021407|Ga0210383_10695527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium874Open in IMG/M
3300021432|Ga0210384_10646830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium948Open in IMG/M
3300021474|Ga0210390_10267254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1449Open in IMG/M
3300021474|Ga0210390_10855248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium750Open in IMG/M
3300021474|Ga0210390_11538291Not Available525Open in IMG/M
3300021475|Ga0210392_11271259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300021478|Ga0210402_10276709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1552Open in IMG/M
3300021479|Ga0210410_11774612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300021559|Ga0210409_10759371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium842Open in IMG/M
3300021560|Ga0126371_13795524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300022716|Ga0242673_1083233All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300022716|Ga0242673_1090069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium579Open in IMG/M
3300025494|Ga0207928_1073857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium635Open in IMG/M
3300025625|Ga0208219_1030764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1465Open in IMG/M
3300025625|Ga0208219_1096329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300025625|Ga0208219_1096330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium677Open in IMG/M
3300025633|Ga0208480_1026175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1684Open in IMG/M
3300025910|Ga0207684_10882106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium753Open in IMG/M
3300025913|Ga0207695_10867236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium783Open in IMG/M
3300025915|Ga0207693_10093638All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2355Open in IMG/M
3300025916|Ga0207663_10114873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. DC121833Open in IMG/M
3300025916|Ga0207663_10836275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300025919|Ga0207657_10865521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300025921|Ga0207652_11339755All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300025927|Ga0207687_10262415All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1377Open in IMG/M
3300025928|Ga0207700_10029186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3889Open in IMG/M
3300025928|Ga0207700_10372344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1247Open in IMG/M
3300025929|Ga0207664_10277230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1471Open in IMG/M
3300025944|Ga0207661_10632399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium983Open in IMG/M
3300026078|Ga0207702_10319765All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1478Open in IMG/M
3300027648|Ga0209420_1157563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium620Open in IMG/M
3300027765|Ga0209073_10152439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium854Open in IMG/M
3300027787|Ga0209074_10363281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300027853|Ga0209274_10469788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300027869|Ga0209579_10517129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium648Open in IMG/M
3300027908|Ga0209006_11148278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium610Open in IMG/M
3300028379|Ga0268266_11032402All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium796Open in IMG/M
3300028566|Ga0302147_10291343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300028824|Ga0307310_10241738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium864Open in IMG/M
3300028828|Ga0307312_10450709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium847Open in IMG/M
3300028867|Ga0302146_10402212All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300028884|Ga0307308_10601979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300029910|Ga0311369_10591203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium928Open in IMG/M
3300029943|Ga0311340_10108508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3031Open in IMG/M
3300029943|Ga0311340_10683758All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium882Open in IMG/M
3300029943|Ga0311340_11180728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300030042|Ga0302300_1160330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium645Open in IMG/M
3300030490|Ga0302184_10224974All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium777Open in IMG/M
3300030524|Ga0311357_11407509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium594Open in IMG/M
3300030760|Ga0265762_1036798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300031234|Ga0302325_11333464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium940Open in IMG/M
3300031236|Ga0302324_102042631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium717Open in IMG/M
3300031525|Ga0302326_10059483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7191Open in IMG/M
3300031525|Ga0302326_12599023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium632Open in IMG/M
3300031546|Ga0318538_10195197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1080Open in IMG/M
3300031564|Ga0318573_10403890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium734Open in IMG/M
3300031680|Ga0318574_10481189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300031681|Ga0318572_10953934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300031718|Ga0307474_11015100All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium657Open in IMG/M
3300031744|Ga0306918_10539413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium914Open in IMG/M
3300031788|Ga0302319_11493248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300031792|Ga0318529_10561881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300031819|Ga0318568_10791997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium588Open in IMG/M
3300031821|Ga0318567_10171363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1206Open in IMG/M
3300031831|Ga0318564_10368749All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium630Open in IMG/M
3300031890|Ga0306925_11111917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300031938|Ga0308175_100930027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium958Open in IMG/M
3300031939|Ga0308174_10162966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1670Open in IMG/M
3300031954|Ga0306926_11950937All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium662Open in IMG/M
3300032008|Ga0318562_10828657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300032009|Ga0318563_10157039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1222Open in IMG/M
3300032055|Ga0318575_10271992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium856Open in IMG/M
3300032094|Ga0318540_10245569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium864Open in IMG/M
3300032782|Ga0335082_11617208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium521Open in IMG/M
3300032892|Ga0335081_11225370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium853Open in IMG/M
3300032896|Ga0335075_10017896All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10517Open in IMG/M
3300032896|Ga0335075_10769985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium909Open in IMG/M
3300032897|Ga0335071_11137186All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium726Open in IMG/M
3300032898|Ga0335072_10836602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium873Open in IMG/M
3300032898|Ga0335072_11629247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300033289|Ga0310914_11894865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300033544|Ga0316215_1012924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium831Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil19.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.14%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.84%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.19%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.55%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.90%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.90%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.25%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.60%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.60%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.95%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.30%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.30%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.30%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.30%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.30%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.30%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.30%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.30%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.65%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.65%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.65%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.65%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.65%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.65%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.65%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.65%
RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Roots0.65%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.65%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.65%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908045Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011EnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004478Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005952Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013501Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25MEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025494Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025625Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025633Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027648Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027765Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028867Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_3EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030042Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030490Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030760Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033544Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
KansclcFeb2_125923302124908045SoilLAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
JGI10216J12902_12493067323300000956SoilMALLWAVLAIWRTVTLDSVQFAVLVFFGLLNLAVVTRIVFPGVRTP*
Ga0068972_128984113300004478Peatlands SoilMALLWLALAIWRSVTLGTSGFSVLLFFGLLNLAVVGRVIFPGDKAA*
Ga0070660_10106110813300005339Corn RhizosphereIRWWSGSVALLWLALALWRTVALGSPQFAVLLLFGLLNLAMVARVIFPGGRLA*
Ga0070714_10161909313300005435Agricultural SoilAVLWLALAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAA*
Ga0070713_10121238413300005436Corn, Switchgrass And Miscanthus RhizosphereSGSAAVLWLALAVWRTATLGSPQFGVLLFFGLVNLAAVGCVIFPGGRAA*
Ga0070706_10102922713300005467Corn, Switchgrass And Miscanthus RhizosphereSGSMALLWLGLAVWRTETLGALQFGVLLFFGLLNLAVVSRVVFPGGRAA*
Ga0070679_10159491513300005530Corn RhizosphereGWSGGVGLLWLALAAWRMAATGSARFAILLVFGALNLAVVARVIFPGKTAAA*
Ga0070733_1103303123300005541Surface SoilALWRTVTFGSPQFAVLLFFGLLNLAMVSRVVFPGGGRA*
Ga0070761_1061590323300005591SoilRTITLGSPQFAVLLFFGVVNLMMVGRVIFPGSRAG*
Ga0070761_1067022213300005591SoilLWLALAIWRTVTLGSPQFAVLLLFGALNLAVVSRVIFPGGNAA*
Ga0068856_10082206223300005614Corn RhizosphereAAVLWFALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0066903_10514020313300005764Tropical Forest SoilIWRTVTLGSAQFAVLVAFGIINLAVVIRVIFPGGRTA*
Ga0080026_1015311623300005952Permafrost SoilVTWWSGGMAMLWLVLAIWRTVTIGYLQFAVLLFFALLNLAMVSRIVFPGAKTA*
Ga0081540_129087723300005983Tabebuia Heterophylla RhizosphereWAVLAIWRTVALDSAQFAVLVFFGLLNLAVVTRIVFPGVRTA*
Ga0070717_1137870213300006028Corn, Switchgrass And Miscanthus RhizosphereGSAAVLWLALAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAA*
Ga0070765_10137464823300006176SoilLLWVVLAVWRTMTLGSFRFAVLLVFGLLNLAVVSRVILPGGKPA*
Ga0070765_10183357313300006176SoilLAIWRSASGGWQPLALLLFGLLNLAVVSRVIFPGKKTA*
Ga0097621_10021089533300006237Miscanthus RhizosphereSVALLWLALALWRTVALGSPQFAVLLFFGLLNLAMVARVIFPGGQLA*
Ga0074054_1198289313300006579SoilWSGGMALLWAALAIWRTVTLGSAQFAVLVFFGLLNLAVVGRVIFPGGGTA*
Ga0079222_1179231913300006755Agricultural SoilTWWSGSAAVLWFALAVWRTAMLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0079221_1008374033300006804Agricultural SoilGITWWSGSAAVLWLALAVWRTATLGSPQFGVLLFFGMINLAAVGCVIFLGGRAA*
Ga0079220_1032825313300006806Agricultural SoilSAAVLWLALAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAA*
Ga0079220_1057983813300006806Agricultural SoilTAALGSAQFAVLVLFGILNLAIDGRVIVPGGRTA*
Ga0079220_1178971423300006806Agricultural SoilVLWFALAVWRTAMLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0075425_10014690343300006854Populus RhizosphereLLWAVLAIWRTVTLDSAQFAFLLFFGLLNLAVVSRVIFPGSAAA*
Ga0075425_10111470513300006854Populus RhizosphereGTALIWAVLAIWRTVTFGSAQFAVLVFFGMLNLAVVSRVIFPGGRTA*
Ga0075434_10245263123300006871Populus RhizosphereWAVLAIWRTVTLDSAQFAFLLFFGLLNLAVVSRVIFPGSAAA*
Ga0105247_1006313333300009101Switchgrass RhizosphereALWRTVALGSPQFAVLLFFGLLNLAMVARVIFPGGRLA*
Ga0105247_1070023313300009101Switchgrass RhizosphereTALLWAVLAIWRTVTLDSAQFAVLVFFGLLNLAVVSRIVFPGVRTA*
Ga0075423_1295032413300009162Populus RhizosphereWAVLAIWRTVTFGSAQFAVLVFFGMLNLAVVSRVIFPGGRTA*
Ga0105241_1030374113300009174Corn RhizosphereRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0116114_116159623300009630PeatlandTGGMALLWLALAIWRTVTAGSTRFMVLLIVGLLNLILVGRVIFPGNKTA*
Ga0126373_1169240413300010048Tropical Forest SoilAGLAVWRTVTLSSAQFAILLLFGVLNLAVVSRVIFPGRPAA*
Ga0126373_1256700723300010048Tropical Forest SoilGGAAVLWLGLAVWRTVTLGAWQFGVLLLFGGLNLAVVGRVILPGGTTA*
Ga0134062_1068365323300010337Grasslands SoilWWSGSVAVLWLALALWRTVALGSPQFAVLLFFGLLNLAMVARVIFPGGQPA*
Ga0126378_1149786623300010361Tropical Forest SoilGLAVWRTVTLSSAQFAILLLFGVLNLALVSRVIFPGRPAS*
Ga0126381_10356637923300010376Tropical Forest SoilALTFGATQFAVLMFFGVLNLAVASRVIFPGGRAA*
Ga0134126_1181297113300010396Terrestrial SoilSAAVLWFALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0126383_1063984313300010398Tropical Forest SoilTALAWAALAIWRTITLDTAQFAVLVFFGLLNLAIVTRIIFPGTSTP*
Ga0126383_1220834013300010398Tropical Forest SoilAIWRTVTLDSAQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0137389_1171032713300012096Vadose Zone SoilIWRVATDSWQSAALLLFGLLNLAVVSRVIFPGETAA*
Ga0137380_1112786423300012206Vadose Zone SoilWRTAGTGSVRFGVLVFFGLLNLAVVSRVIFPGARSA*
Ga0137380_1114158223300012206Vadose Zone SoilLALAWAGLAVWRTVSLESAEFAVVLAFGLLNLAVVSRVVFPGKRTA*
Ga0137370_1058144913300012285Vadose Zone SoilAVWRTATLGSPQFAVLLFFGLLNLAIVGRVIFPGGRAA*
Ga0137386_1080088413300012351Vadose Zone SoilLAGWRTVTLSSSQFAVLLFFGLLNLAVVGRVIFPGERTT*
Ga0137398_1124147913300012683Vadose Zone SoilAIWRVAAGSWQSAALLFFGLLNLAVVSRVIFPGETTA*
Ga0164300_1079429613300012951SoilGSVALLWLALALWRTVALGSPQFAVLLFFGLLNLAMVARVIFPGGRLA*
Ga0126369_1205020123300012971Tropical Forest SoilWRTVTLGSVQFAILVFFGALNLAVVGRVIFPGTRAE*
Ga0164306_1079890823300012988SoilWLALALWRAVALGSPQFAVLLFFGLLNLVMVARVIFPGGQPA*
Ga0157371_1091807223300013102Corn RhizosphereGSAAVLWFALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA*
Ga0157372_1292871713300013307Corn RhizosphereSVAVLWLALALWRAVALGSLQFAVLLFFGLLNLVMVARVIFPGGQPA*
Ga0120154_114968723300013501PermafrostMAWAMLAVWRTVTLGSPQYAVVLSFGLLNLAAVGRVIFPGDKAA*
Ga0134081_1012237713300014150Grasslands SoilGGLAVAWAGLAIWRTVAYGSAQFAIVLAFGLFNLAVVSRVVFPGKRAA*
Ga0182040_1123994423300016387SoilWRTVTLSSAQFAILLLFGALNLAVMSRVIFPGRPPA
Ga0187779_1101283613300017959Tropical PeatlandSGGMALLWLALAIWRTVTLASLQFAILLFFGVLNLAVASRVIFPGRPA
Ga0187783_1126132123300017970Tropical PeatlandWLVLAAWRTVALGSLQFTVLLVFGLLNLAVVSRVVLPGEKAA
Ga0187782_1044672623300017975Tropical PeatlandPWWSGGAALLSLTLAVWRTAATGSVRFAVLLFFGALNLAVVGRVIFPGGETA
Ga0187805_1017837113300018007Freshwater SedimentAAWVLLAIWRTCSTGSPRFAVLLVFGVLNVAVVGRVLLSGRSSG
Ga0187860_138170823300018014PeatlandGGMALLWLALAIWRTVTAGSARFTVLLIVALLNLILVGRVIFPGNKTA
Ga0187863_1011207113300018034PeatlandIWRMVTIGYLQFAVLLFFALLNLAMVSRVVFPGVKTA
Ga0187883_1042375113300018037PeatlandYWSGSVAVIWLVLAIWRMATLGAAQFAVLLFFGLLNFTVVSRVIFPGGRTA
Ga0187855_1011154613300018038PeatlandRTVTLGSLQFAVLLSFALLNLAVVSRVIFPGGNAA
Ga0187862_1004684143300018040PeatlandLALAIWRMATLGAAQFAVLLFFGLLNFTVVSRVIFPGGRTA
Ga0187862_1055262013300018040PeatlandAIWRSVAGGWQPLALLLFGLLNLAVVSRVIFPGKKTA
Ga0187887_1035458213300018043PeatlandWLALALWRTVTLGSLQFAVLLSFALLNLAVVSRVIFPGGDTA
Ga0210401_1006517113300020583SoilALALWRTVTFGSPQFAVLLFFGLLNLAMVSRVVFPGGGRA
Ga0210405_1125298123300021171SoilVTWWSGGVALLWLALALWRTITLGSPQFAVLLFFGALNLAVVGRVILPGSRAR
Ga0210396_1076819123300021180SoilRWWSGSVAVLWLALALWRTAALGSPEFAVLLFFGLLNLAMVGRVVFPGGPAE
Ga0210396_1156974223300021180SoilKWWSGSVAMLWPALAIWRTATLGSLQFAVLLFFGFLNLAMVGRVIFPGGEAA
Ga0210385_1129025513300021402SoilLAIWRMVTLGSLQFAVLLVFGLLNLAVVSRVIFPGEKTA
Ga0210385_1147206513300021402SoilWVVLAIWRTMALGSLRFAILLVFGVLNLAVVSRVIFPGEEPA
Ga0210383_1069552723300021407SoilLALWRTITLGSPQFAVLLFFGAVNLAMVGRVVFPGSRAG
Ga0210384_1064683023300021432SoilAVLWLALALWRTAALGSPEFAVLLFFGLLNLAMVGRVVFPGGPAE
Ga0210390_1026725413300021474SoilLALALWRTITLGSPQFTVLLAFGVLNLAVVGRVVFPGSQAA
Ga0210390_1085524823300021474SoilLLWLALALWRSITLGSPQFAVLLFFGAVNLVAVGRVIFPGSRAG
Ga0210390_1153829113300021474SoilLAIWRTVALGSAQFVVLLVFGVLNLAIVGRVIFPGGRAA
Ga0210392_1127125913300021475SoilALAIWRTATLGSLQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0210402_1027670933300021478SoilLAIWRTATLGSLQFAVLLFFGFLNLAMVGRVIFPGGEAA
Ga0210410_1177461213300021479SoilLWPALAIWRTATLGSLQFAVLLFFGFLNLAMVGRVIFPGGEAA
Ga0210409_1075937123300021559SoilLALALWRTVTFGSPQFAVLLFFGLLNLAMVSRVVFPGGGRA
Ga0126371_1379552413300021560Tropical Forest SoilVWRTVTLSSAQFAILLLFGVLNLAVVRRVIFPGRPAA
Ga0242673_108323323300022716SoilLWLALAIWRTVTLGSPQFAVLLLFGALNLAVVSRVIFPGGNAA
Ga0242673_109006913300022716SoilMALLWVVLAGWRTMTLGSFRFAVLLVFGLLNLAVVSRVIFPGGKPA
Ga0207928_107385723300025494Arctic Peat SoilAIWRSAAGGWQPLALLLFGLLNLAVVSRVIFPGKKTA
Ga0208219_103076433300025625Arctic Peat SoilTWWSGGMAVLWVALAIWRSASGGWQPLFLLLFGLLNLAVVSRVIFPGKKTA
Ga0208219_109632913300025625Arctic Peat SoilRMATLGAPQFAVLLFFGVLNLAVVARVIFPGARAA
Ga0208219_109633013300025625Arctic Peat SoilRMATLGAPQFAVLLFFGVLNLAVVARVIFPGARTA
Ga0208480_102617533300025633Arctic Peat SoilLWVALAIWRSIAGGWQPLALLLFGLLNLAVVSRVIFPGKKTA
Ga0207684_1088210613300025910Corn, Switchgrass And Miscanthus RhizosphereVWRTETLGALQFGVLLFFGLLNLAVVSRVVFPGGRAA
Ga0207695_1086723613300025913Corn RhizosphereVGITWWSGSAAVLWFALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0207693_1009363813300025915Corn, Switchgrass And Miscanthus RhizosphereTWWSGSAAGLWFALAVWRTATLGSLEFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0207663_1011487313300025916Corn, Switchgrass And Miscanthus RhizosphereLAIWRTVTLDSAQFAVLVFFGLLNLAVVSRIVFPGVRTA
Ga0207663_1083627523300025916Corn, Switchgrass And Miscanthus RhizosphereGTALLWVVLALWRTVTLGSAQFAILMFFGVLNLAVVGRVIFPGGRTE
Ga0207657_1086552113300025919Corn RhizosphereIRIRWWSGSVALMWLALALWRTVALGSPQFAVLLLFGLLNLAMVARVIFPGGRLA
Ga0207652_1133975523300025921Corn RhizosphereSGSVAVLWLALALLRAVALGSLQFAVLLFFGLLNLVMVARVIFPGGQPA
Ga0207687_1026241513300025927Miscanthus RhizosphereIRWWSGSVAVLWLALALWRAVALGSLQFAVLLFFGLLNLVMVARVIFPGGQPA
Ga0207700_1002918633300025928Corn, Switchgrass And Miscanthus RhizosphereVLWLALAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAA
Ga0207700_1037234433300025928Corn, Switchgrass And Miscanthus RhizosphereLLWVILASWRTVAQGSVQFIVVLAFGLLNLAVVSRVIFPGKKPA
Ga0207664_1027723033300025929Agricultural SoilWSGSAAVLWLALAVWRTATLGSPQFGVLLFFGLVNLAAVGCVIFPGGRAA
Ga0207661_1063239913300025944Corn RhizosphereIGITWWSGSVAVLWLALAIWRTATLGSFQLAVLLFFGLVNLVVVGRVIFPGGRAV
Ga0207702_1031976533300026078Corn RhizosphereWSGSAAVLWLALAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGCAA
Ga0209420_115756323300027648Forest SoilSGGIALLWVVLAVWRTMTLGSFRFAVLLVFGLLNLAVVSRVIFPGGKPA
Ga0209073_1015243913300027765Agricultural SoilVLWFALAVWRTAMLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0209074_1036328113300027787Agricultural SoilALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0209274_1046978823300027853SoilALAIWRTVTLGSPQFAVLLLFGALNLAVVSRVIFPGGNAA
Ga0209579_1051712913300027869Surface SoilVWLALALWRTITLGSAQYTVLLFFGAVNLAMVGRVILPGSRAR
Ga0209006_1114827813300027908Forest SoilWSGGMAVLWVALAIWRSASGGWQPLALLLFGLLNLAVVSRVIFPGKKTA
Ga0268266_1103240223300028379Switchgrass RhizosphereGSAAVLWFALAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0302147_1029134313300028566BogVAVIWLALAIWRMATLGAAQFAVLLFFGLLNFAVVSRVIFPGGRTA
Ga0307310_1024173813300028824SoilAVWRTATLGSPQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0307312_1045070913300028828SoilSAAVLWFALAVWRTATLGSLQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0302146_1040221213300028867BogIWRMATLCAAQFAVLLFFGLLNFAVVSRVIFPGGRTA
Ga0307308_1060197923300028884SoilWFALAVWRTATLGSLQFAVLLFFGLLNLAVVGRVIFPGGRAA
Ga0311369_1059120313300029910PalsaLALALWRTVTLGSLQFAVLLFFAVLNLAVVSRVIFPGGHTA
Ga0311340_1010850843300029943PalsaLALALWRMVTLGSLQFAVLLFFALLNLAVVSRVIFPGGNPA
Ga0311340_1068375823300029943PalsaIWRTATLDHWQFAVLLFFGALNLAVVSRVIFPGGRTA
Ga0311340_1118072823300029943PalsaWLALAIWRMAALGAPQFAVLLFFGLLNFAVVSRVIFPGGRTA
Ga0302300_116033023300030042PalsaLWRTVTLGSLQFAVLLFFALLNLAVVCRVIFPGGNAA
Ga0302184_1022497413300030490PalsaWRMVSLDSPQFAILLFFAAFNLAVVARVIFPGWKAA
Ga0311357_1140750913300030524PalsaLGLALWRTVTSSSPQFAVLLFFGAVNLAMVSRVIFPGSRAG
Ga0265762_103679813300030760SoilALLWVVLAVWRTMTLGSFRFAVLLVFGLLNLAVVSRVIFPGGKPA
Ga0302325_1133346423300031234PalsaGGMALLWLGLALWRTVTSGSPQFAVLLFFGAVNLAMVSRVIFPGSRAG
Ga0302324_10204263113300031236PalsaWSGSVAVLWLALAIWRMMTLVSGQFTVLLLFGVLNLVGVSRVIFPGGRTA
Ga0302326_1005948373300031525PalsaMLWLLLAIWRTATLDHWQFAVLLFFGALNLAVVSRVIFPGGRAA
Ga0302326_1259902313300031525PalsaLLWLALDLWRTITLGSPQFAVLLFFGALNLVMVSRVVFPGSRAG
Ga0318538_1019519713300031546SoilSGGAALLWVALAIWRTAALGSLQFAVLLLFGLLNLAVVSRVIFPGETAA
Ga0318573_1040389013300031564SoilALAAWRATAFGVTQFAVLIFFGVLNLAVVSRVIFPGGRAA
Ga0318574_1048118913300031680SoilVGLAVWRTVTLSSAQFAILLLFGALNLAVMSRVIFPGRLPA
Ga0318572_1095393423300031681SoilWSGGLALAWAALAVWRTVALVSVQFAVLLAFGLFNLAVVSRVVFPGRRAV
Ga0307474_1101510013300031718Hardwood Forest SoilAVWRTATLGALQFAVLLFFGLLNLAVVTRVVFPGGAR
Ga0306918_1053941323300031744SoilVALAAWRAATFGVTQFAVLIFFGALNLAVVSRVIFPGGRAA
Ga0302319_1149324823300031788BogVAVIWPALAIWRMATLGAAQFAVLLFFGLLNFAVVSRVIFPGGRTA
Ga0318529_1056188113300031792SoilTWWSGGAALLWVALAIWRTAALGSLQFAVLLLFGLLNLAVVSRVIFPGETAA
Ga0318568_1079199713300031819SoilRMATLGSWQFVILLLFGLLNLAVVGRVIFPGGRAA
Ga0318567_1017136333300031821SoilLWVSLAIWRTVALGSAQFAILLLFGVLNLAIVSRVIFPGGETA
Ga0318564_1036874913300031831SoilWRTATFGSSKFAVVLFFGLLNLAVVARVIFPGKKPA
Ga0306925_1111191713300031890SoilLLWVGLAVWRTVTLSSAQFAILLLFGVLNLAVVSRVIFPGRPAA
Ga0308175_10093002713300031938SoilAAVLWFVLAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAE
Ga0308174_1016296633300031939SoilRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAE
Ga0306926_1195093713300031954SoilLLWVVLAFWRTVTLGSVQFAILVFFGVLNLAVVGRVIFPGARTE
Ga0318562_1082865713300032008SoilGGLAVAWAGLAIWRTVAYGSAQFAIVLAFGLFNLAVVSRVVFPGKRTA
Ga0318563_1015703913300032009SoilLWFALATWRTVTLGSWQFAVLLLFGLLNLAVVGRVIFPGGRAA
Ga0318575_1027199213300032055SoilAWRAATFGVTQFAVLIFFGALNLAVVSRVIFPGGRAA
Ga0318540_1024556923300032094SoilLALVWAGLAIWRTATFGSSKFAVVLFFGLLNLAVVARVIFPGKKPA
Ga0335082_1161720813300032782SoilWLALAVWRTATLGSPQFGVLLFFGLINLAAVGCVIFPGGRAA
Ga0335081_1122537023300032892SoilMAVTWLALAIWRMVTLGYLQFAVLLFFGLVNLAVVSRVIFPGVRTA
Ga0335075_1001789693300032896SoilGVCWWSGGAAAAWLMLAVWRTATTGSVRFGVLLFFGLVNVIVVGRIIVARGGSA
Ga0335075_1076998513300032896SoilALLWLILAIWRMVTLGSVQFGVLLLFGLLNFAVVCRVIFPGEKSA
Ga0335071_1113718623300032897SoilALAIWRTATLSSWQFAVLLLFGLLNLAVVGRVIFPGGGAA
Ga0335072_1083660223300032898SoilAVLWLLLATWRTVSAGSLRFVVLLVFGAVNLAVVARVIFAGGKTP
Ga0335072_1162924723300032898SoilWVALAGWRMAAAGHPGGAGPWQFAVLLSFGLLNLAVVSRVIVPGGRTA
Ga0310914_1189486523300033289SoilALLWVALAAWRAAALGVTQFAVLIFFGVLNLAVVSRVIFPGGRAA
Ga0316215_101292423300033544RootsWTGGTSLAWAGLAVWRTLSLDTARFAVLAAFGLLNLALVSRVIFAGGSRS


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.