Basic Information | |
---|---|
Family ID | F044449 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 154 |
Average Sequence Length | 37 residues |
Representative Sequence | MAEIGEPDRVVRREREPLISPALPVPTPELEPAK |
Number of Associated Samples | 111 |
Number of Associated Scaffolds | 154 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 64.94 % |
% of genes near scaffold ends (potentially truncated) | 29.87 % |
% of genes from short scaffolds (< 2000 bps) | 63.64 % |
Associated GOLD sequencing projects | 102 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.19 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.325 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (14.286 % of family members) |
Environment Ontology (ENVO) | Unclassified (60.390 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (82.468 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 154 Family Scaffolds |
---|---|---|
PF04134 | DCC1-like | 14.94 |
PF00462 | Glutaredoxin | 10.39 |
PF11160 | Hva1_TUDOR | 3.90 |
PF00106 | adh_short | 1.95 |
PF02469 | Fasciclin | 1.95 |
PF16156 | DUF4864 | 1.95 |
PF01408 | GFO_IDH_MocA | 1.95 |
PF00089 | Trypsin | 1.30 |
PF03350 | UPF0114 | 1.30 |
PF13365 | Trypsin_2 | 1.30 |
PF13378 | MR_MLE_C | 1.30 |
PF07719 | TPR_2 | 1.30 |
PF13414 | TPR_11 | 1.30 |
PF00081 | Sod_Fe_N | 1.30 |
PF00528 | BPD_transp_1 | 0.65 |
PF13343 | SBP_bac_6 | 0.65 |
PF00885 | DMRL_synthase | 0.65 |
PF00209 | SNF | 0.65 |
PF07995 | GSDH | 0.65 |
PF01784 | NIF3 | 0.65 |
PF02535 | Zip | 0.65 |
PF03713 | DUF305 | 0.65 |
PF03575 | Peptidase_S51 | 0.65 |
PF00480 | ROK | 0.65 |
PF01726 | LexA_DNA_bind | 0.65 |
PF01872 | RibD_C | 0.65 |
PF14117 | DUF4287 | 0.65 |
PF00881 | Nitroreductase | 0.65 |
PF08240 | ADH_N | 0.65 |
PF00724 | Oxidored_FMN | 0.65 |
PF03441 | FAD_binding_7 | 0.65 |
PF02894 | GFO_IDH_MocA_C | 0.65 |
PF01472 | PUA | 0.65 |
PF13561 | adh_short_C2 | 0.65 |
PF00196 | GerE | 0.65 |
PF01145 | Band_7 | 0.65 |
PF03437 | BtpA | 0.65 |
PF00581 | Rhodanese | 0.65 |
PF00107 | ADH_zinc_N | 0.65 |
PF00491 | Arginase | 0.65 |
PF00174 | Oxidored_molyb | 0.65 |
PF01451 | LMWPc | 0.65 |
PF04832 | SOUL | 0.65 |
PF02557 | VanY | 0.65 |
PF01740 | STAS | 0.65 |
PF05163 | DinB | 0.65 |
PF05656 | DUF805 | 0.65 |
PF13377 | Peripla_BP_3 | 0.65 |
PF00589 | Phage_integrase | 0.65 |
PF00005 | ABC_tran | 0.65 |
PF00403 | HMA | 0.65 |
COG ID | Name | Functional Category | % Frequency in 154 Family Scaffolds |
---|---|---|---|
COG3011 | Predicted thiol-disulfide oxidoreductase YuxK, DCC family | General function prediction only [R] | 14.94 |
COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 1.95 |
COG2862 | Uncharacterized membrane protein YqhA | Function unknown [S] | 1.30 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.30 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.30 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.65 |
COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.65 |
COG3544 | Uncharacterized conserved protein, DUF305 family | Function unknown [S] | 0.65 |
COG3323 | PII-like insert in the uncharacterized protein YqfO, YbgI/NIF3 family | Function unknown [S] | 0.65 |
COG3152 | Uncharacterized membrane protein YhaH, DUF805 family | Function unknown [S] | 0.65 |
COG2608 | Copper chaperone CopZ | Inorganic ion transport and metabolism [P] | 0.65 |
COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.65 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.65 |
COG2173 | D-alanyl-D-alanine dipeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG2133 | Glucose/arabinose dehydrogenase, beta-propeller fold | Carbohydrate transport and metabolism [G] | 0.65 |
COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.65 |
COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.65 |
COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 0.65 |
COG1876 | LD-carboxypeptidase LdcB, LAS superfamily | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG0733 | Na+-dependent transporter, SNF family | General function prediction only [R] | 0.65 |
COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.65 |
COG0434 | Membrane biogenesis protein, BtpA/SgcQ family | Cell wall/membrane/envelope biogenesis [M] | 0.65 |
COG0428 | Zinc transporter ZupT | Inorganic ion transport and metabolism [P] | 0.65 |
COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.65 |
COG0327 | Putative GTP cyclohydrolase 1 type 2, NIF3 family | Coenzyme transport and metabolism [H] | 0.65 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.65 |
COG0054 | 6,7-dimethyl-8-ribityllumazine synthase (Riboflavin synthase beta chain) | Coenzyme transport and metabolism [H] | 0.65 |
COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 0.65 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.92 % |
Unclassified | root | N/A | 22.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2236876004|none_p0472064 | Not Available | 513 | Open in IMG/M |
3300000736|JGI12547J11936_1007612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 2897 | Open in IMG/M |
3300000736|JGI12547J11936_1033064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 1141 | Open in IMG/M |
3300000736|JGI12547J11936_1056014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 784 | Open in IMG/M |
3300001282|B570J14230_10178176 | Not Available | 595 | Open in IMG/M |
3300001948|GOS2228_1011308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA023-D18 | 1777 | Open in IMG/M |
3300001968|GOS2236_1033902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA023-D18 | 976 | Open in IMG/M |
3300003388|JGI25910J50241_10005728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4543 | Open in IMG/M |
3300003497|JGI25925J51416_10023859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1794 | Open in IMG/M |
3300004240|Ga0007787_10133590 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300004770|Ga0007804_1067123 | Not Available | 929 | Open in IMG/M |
3300005517|Ga0070374_10003137 | Not Available | 7466 | Open in IMG/M |
3300005517|Ga0070374_10006461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5545 | Open in IMG/M |
3300005517|Ga0070374_10016447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3716 | Open in IMG/M |
3300005517|Ga0070374_10176370 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
3300005517|Ga0070374_10199606 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300005517|Ga0070374_10305566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 807 | Open in IMG/M |
3300005517|Ga0070374_10553270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 572 | Open in IMG/M |
3300005528|Ga0068872_10288573 | Not Available | 913 | Open in IMG/M |
3300005580|Ga0049083_10108173 | Not Available | 961 | Open in IMG/M |
3300005581|Ga0049081_10062819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1398 | Open in IMG/M |
3300005583|Ga0049085_10005879 | All Organisms → cellular organisms → Bacteria | 4863 | Open in IMG/M |
3300005583|Ga0049085_10029664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2036 | Open in IMG/M |
3300005583|Ga0049085_10119325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 901 | Open in IMG/M |
3300005583|Ga0049085_10244172 | Not Available | 589 | Open in IMG/M |
3300005584|Ga0049082_10128926 | Not Available | 882 | Open in IMG/M |
3300005739|Ga0076948_1012861 | Not Available | 1994 | Open in IMG/M |
3300005805|Ga0079957_1013647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5973 | Open in IMG/M |
3300005805|Ga0079957_1085315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1770 | Open in IMG/M |
3300005941|Ga0070743_10100074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 974 | Open in IMG/M |
3300005990|Ga0073921_1107144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
3300006072|Ga0007881_1166034 | Not Available | 535 | Open in IMG/M |
3300006639|Ga0079301_1219282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
3300006862|Ga0079299_1055784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 773 | Open in IMG/M |
3300007516|Ga0105050_10001812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 31424 | Open in IMG/M |
3300007516|Ga0105050_10034833 | All Organisms → cellular organisms → Bacteria | 3967 | Open in IMG/M |
3300007516|Ga0105050_10062961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2599 | Open in IMG/M |
3300007516|Ga0105050_10066906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2494 | Open in IMG/M |
3300007516|Ga0105050_10129573 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
3300007519|Ga0105055_10002042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 32009 | Open in IMG/M |
3300007522|Ga0105053_10137695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2443 | Open in IMG/M |
3300007544|Ga0102861_1009656 | Not Available | 2291 | Open in IMG/M |
3300007546|Ga0102874_1132201 | Not Available | 781 | Open in IMG/M |
3300007547|Ga0102875_1152256 | Not Available | 726 | Open in IMG/M |
3300007585|Ga0102916_1010660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2187 | Open in IMG/M |
3300007590|Ga0102917_1007637 | All Organisms → cellular organisms → Bacteria | 3683 | Open in IMG/M |
3300007603|Ga0102921_1019667 | All Organisms → cellular organisms → Bacteria | 2493 | Open in IMG/M |
3300007621|Ga0102872_1104605 | Not Available | 758 | Open in IMG/M |
3300007629|Ga0102895_1099570 | Not Available | 750 | Open in IMG/M |
3300007634|Ga0102901_1016913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2110 | Open in IMG/M |
3300007716|Ga0102867_1194375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300007972|Ga0105745_1047082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 1174 | Open in IMG/M |
3300007973|Ga0105746_1043447 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 1398 | Open in IMG/M |
3300008108|Ga0114341_10036777 | All Organisms → cellular organisms → Bacteria | 3980 | Open in IMG/M |
3300008108|Ga0114341_10070413 | Not Available | 2204 | Open in IMG/M |
3300008111|Ga0114344_1013368 | All Organisms → cellular organisms → Bacteria | 9618 | Open in IMG/M |
3300008111|Ga0114344_1041869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1787 | Open in IMG/M |
3300008996|Ga0102831_1057530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1300 | Open in IMG/M |
3300009057|Ga0102892_1017427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1335 | Open in IMG/M |
3300009451|Ga0127402_1002323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6266 | Open in IMG/M |
3300009684|Ga0114958_10005382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8669 | Open in IMG/M |
3300010293|Ga0116204_1012773 | All Organisms → cellular organisms → Bacteria | 3664 | Open in IMG/M |
3300010293|Ga0116204_1014671 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
3300010368|Ga0129324_10022957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3057 | Open in IMG/M |
3300011011|Ga0139556_1004180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2139 | Open in IMG/M |
3300011246|Ga0137490_1000307 | Not Available | 9168 | Open in IMG/M |
3300011249|Ga0137489_1007397 | Not Available | 1803 | Open in IMG/M |
3300012000|Ga0119951_1032804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1664 | Open in IMG/M |
3300013004|Ga0164293_10175192 | Not Available | 1571 | Open in IMG/M |
3300013006|Ga0164294_10193907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1443 | Open in IMG/M |
3300013014|Ga0164295_11472713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
3300013087|Ga0163212_1000549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 16708 | Open in IMG/M |
3300013087|Ga0163212_1010594 | All Organisms → cellular organisms → Bacteria | 3529 | Open in IMG/M |
3300013087|Ga0163212_1023923 | Not Available | 2184 | Open in IMG/M |
3300013087|Ga0163212_1155063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
3300013087|Ga0163212_1265473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → unclassified Clavibacter → Clavibacter sp. | 532 | Open in IMG/M |
3300013091|Ga0163210_1311060 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 553 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10155509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1616 | Open in IMG/M |
3300013285|Ga0136642_1000106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 51612 | Open in IMG/M |
3300013285|Ga0136642_1001751 | All Organisms → cellular organisms → Bacteria | 9007 | Open in IMG/M |
3300013285|Ga0136642_1098004 | Not Available | 757 | Open in IMG/M |
3300013285|Ga0136642_1186224 | Not Available | 506 | Open in IMG/M |
3300013286|Ga0136641_1025348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium CSP1-4 | 1810 | Open in IMG/M |
3300013372|Ga0177922_10186768 | Not Available | 1085 | Open in IMG/M |
3300014050|Ga0119952_1013655 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
3300014050|Ga0119952_1036033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1458 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10462760 | Not Available | 716 | Open in IMG/M |
3300015196|Ga0167627_1001287 | All Organisms → cellular organisms → Bacteria | 14296 | Open in IMG/M |
3300015196|Ga0167627_1007466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5222 | Open in IMG/M |
3300017788|Ga0169931_10218677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1598 | Open in IMG/M |
3300018868|Ga0187844_10150938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1020 | Open in IMG/M |
3300018868|Ga0187844_10407170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 557 | Open in IMG/M |
3300019093|Ga0187843_10153629 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Nibricoccus → Nibricoccus aquaticus | 998 | Open in IMG/M |
3300019096|Ga0188835_1011758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium BACL4 MAG-120507-bin0 | 743 | Open in IMG/M |
3300020074|Ga0194113_10003096 | All Organisms → cellular organisms → Bacteria | 22386 | Open in IMG/M |
3300020074|Ga0194113_10010636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10977 | Open in IMG/M |
3300020074|Ga0194113_10014780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium acAMD-5 | 8974 | Open in IMG/M |
3300020074|Ga0194113_10152569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1917 | Open in IMG/M |
3300020074|Ga0194113_10158170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1870 | Open in IMG/M |
3300020074|Ga0194113_10251521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
3300020109|Ga0194112_10919883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → unclassified Clavibacter → Clavibacter sp. | 560 | Open in IMG/M |
3300020179|Ga0194134_10023938 | All Organisms → cellular organisms → Bacteria | 3922 | Open in IMG/M |
3300020190|Ga0194118_10112393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1653 | Open in IMG/M |
3300020190|Ga0194118_10476211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 607 | Open in IMG/M |
3300020197|Ga0194128_10319993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 766 | Open in IMG/M |
3300020198|Ga0194120_10301041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinobacteria bacterium BACL4 MAG-120507-bin0 | 805 | Open in IMG/M |
3300020204|Ga0194116_10299900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Clavibacter → unclassified Clavibacter → Clavibacter sp. | 845 | Open in IMG/M |
3300020220|Ga0194119_10507033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
3300020220|Ga0194119_10781009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
3300020221|Ga0194127_10107277 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2064 | Open in IMG/M |
3300021091|Ga0194133_10531400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 596 | Open in IMG/M |
3300021376|Ga0194130_10218912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1110 | Open in IMG/M |
3300023184|Ga0214919_10184287 | Not Available | 1595 | Open in IMG/M |
3300024239|Ga0247724_1002099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3561 | Open in IMG/M |
3300024856|Ga0256304_1122998 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 517 | Open in IMG/M |
3300025283|Ga0208048_1000627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 18904 | Open in IMG/M |
3300025283|Ga0208048_1001433 | All Organisms → cellular organisms → Bacteria | 12255 | Open in IMG/M |
3300025356|Ga0208870_1015793 | Not Available | 906 | Open in IMG/M |
3300025413|Ga0208614_1023003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1010 | Open in IMG/M |
3300025470|Ga0208389_1089821 | Not Available | 539 | Open in IMG/M |
3300027151|Ga0255063_1003355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 3910 | Open in IMG/M |
3300027154|Ga0255111_1097225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 540 | Open in IMG/M |
3300027287|Ga0255135_1041444 | Not Available | 558 | Open in IMG/M |
3300027295|Ga0255126_1014451 | Not Available | 1995 | Open in IMG/M |
3300027301|Ga0255127_1081704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 500 | Open in IMG/M |
3300027329|Ga0255109_1092616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 629 | Open in IMG/M |
3300027333|Ga0255138_1076824 | All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Halteriidae → Halteria → Halteria grandinella | 554 | Open in IMG/M |
3300027335|Ga0255130_1023473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1242 | Open in IMG/M |
3300027563|Ga0209552_1080742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 889 | Open in IMG/M |
3300027563|Ga0209552_1179526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 534 | Open in IMG/M |
3300027581|Ga0209651_1212111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 502 | Open in IMG/M |
3300027586|Ga0208966_1101306 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Nibricoccus → Nibricoccus aquaticus | 789 | Open in IMG/M |
3300027595|Ga0255122_1084083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 524 | Open in IMG/M |
3300027627|Ga0208942_1007799 | Not Available | 3600 | Open in IMG/M |
3300027627|Ga0208942_1036270 | Not Available | 1552 | Open in IMG/M |
3300027627|Ga0208942_1091869 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Nibricoccus → Nibricoccus aquaticus | 873 | Open in IMG/M |
3300027642|Ga0209135_1036490 | All Organisms → cellular organisms → Bacteria | 1750 | Open in IMG/M |
3300027712|Ga0209499_1006051 | Not Available | 6763 | Open in IMG/M |
3300027732|Ga0209442_1035380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 2228 | Open in IMG/M |
3300027744|Ga0209355_1071913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1622 | Open in IMG/M |
3300027744|Ga0209355_1139627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Planktophila | 1048 | Open in IMG/M |
3300027785|Ga0209246_10021459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2423 | Open in IMG/M |
3300027785|Ga0209246_10069509 | Not Available | 1367 | Open in IMG/M |
3300027832|Ga0209491_10026168 | All Organisms → cellular organisms → Bacteria | 6111 | Open in IMG/M |
3300027848|Ga0209390_10119738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2450 | Open in IMG/M |
3300027848|Ga0209390_10187118 | All Organisms → Viruses → Predicted Viral | 1808 | Open in IMG/M |
3300027892|Ga0209550_10247079 | Not Available | 1181 | Open in IMG/M |
(restricted) 3300027970|Ga0247837_1313872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales | 585 | Open in IMG/M |
3300027976|Ga0209702_10001565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 43438 | Open in IMG/M |
3300028105|Ga0255254_1123359 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae → Candidatus Nanopelagicus | 517 | Open in IMG/M |
3300029894|Ga0247028_1000293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 21794 | Open in IMG/M |
3300029912|Ga0247050_1017095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Candidatus Nanopelagicales → Candidatus Nanopelagicaceae | 2609 | Open in IMG/M |
3300032462|Ga0335396_10079935 | All Organisms → cellular organisms → Bacteria | 2159 | Open in IMG/M |
3300034073|Ga0310130_0032652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1598 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 14.29% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.69% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.39% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 8.44% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 7.79% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 7.79% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 7.14% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.14% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 3.25% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.60% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 1.95% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 1.30% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.30% |
Anoxic Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Lake Water | 1.30% |
Cryconite | Environmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite | 1.30% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.30% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.30% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.30% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.30% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.65% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.65% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.65% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine Estuarine | 0.65% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.65% |
Meromictic Pond | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Meromictic Pond | 0.65% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.65% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.65% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.65% |
Basal Ice | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Basal Ice | 0.65% |
Cryoconite Hole, Glacier Surface | Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Cryoconite Hole, Glacier Surface | 0.65% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2236876004 | Estuarine microbial communities from Columbia River, sample from South Channel ETM site, GS313-0p1-ETM-15m | Environmental | Open in IMG/M |
3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001948 | Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012 | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004770 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE25Aug07 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
3300005990 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_30-Apr-14 | Environmental | Open in IMG/M |
3300006072 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006862 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series LW 2014_7_11 | Environmental | Open in IMG/M |
3300007516 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 | Environmental | Open in IMG/M |
3300007519 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-03 | Environmental | Open in IMG/M |
3300007522 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
3300007585 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-3 | Environmental | Open in IMG/M |
3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
3300007634 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02 | Environmental | Open in IMG/M |
3300007716 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3 | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
3300009057 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 | Environmental | Open in IMG/M |
3300009451 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, 8m depth; DNA IDBA-UD | Environmental | Open in IMG/M |
3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
3300010293 | Anoxic lake water microbial communities from Lake Kivu, Rwanda to study Microbial Dark Matter (Phase II) - Lake Kivu water 52m metaG | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300011246 | Glacer surface microbial communities from an Arctic cyroconite hole, Midre Lovenbreen, Svalbard, Norway (Sample 22) | Environmental | Open in IMG/M |
3300011249 | Basal ice microbial communities from dark ice on Arctic glacier surface, Midre Lovenbreen, Svalbard, Norway (sample 23) | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013091 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_220m | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013285 | Freshwater microbial communities from Lower Cathedral Lake, Yosemite National Park, California, USA - 13028-31Y | Environmental | Open in IMG/M |
3300013286 | Freshwater microbial communities from Elizabeth Lake, Yosemite National Park, California, USA - 13020-23Y | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300015196 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G2C, Ice surface) | Environmental | Open in IMG/M |
3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
3300018868 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50 | Environmental | Open in IMG/M |
3300019093 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_43 | Environmental | Open in IMG/M |
3300019096 | Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1 | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020197 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65m | Environmental | Open in IMG/M |
3300020198 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65m | Environmental | Open in IMG/M |
3300020204 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015008 Mahale S9 surface | Environmental | Open in IMG/M |
3300020220 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100m | Environmental | Open in IMG/M |
3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300024239 | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E | Environmental | Open in IMG/M |
3300024856 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025283 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L (SPAdes) | Environmental | Open in IMG/M |
3300025356 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE27Aug07 (SPAdes) | Environmental | Open in IMG/M |
3300025413 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE23Jun09 (SPAdes) | Environmental | Open in IMG/M |
3300025470 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug09 (SPAdes) | Environmental | Open in IMG/M |
3300027151 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0h | Environmental | Open in IMG/M |
3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027287 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300027295 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepA_8d | Environmental | Open in IMG/M |
3300027301 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027329 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h | Environmental | Open in IMG/M |
3300027333 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8d | Environmental | Open in IMG/M |
3300027335 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepB_8d | Environmental | Open in IMG/M |
3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027832 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes) | Environmental | Open in IMG/M |
3300027848 | Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027970 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14.5m | Environmental | Open in IMG/M |
3300027976 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes) | Environmental | Open in IMG/M |
3300028105 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029894 | Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-A1b | Environmental | Open in IMG/M |
3300029912 | Cryconite microbial communities from ice sheet in Kangerlussuaq, Greenland - KAN_P-A3a | Environmental | Open in IMG/M |
3300032462 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly) | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
none_04720642 | 2236876004 | Marine Estuarine | MAEIGQPERVVRRERENEPTPAPVVAPVSPELEPAQ |
JGI12547J11936_10076122 | 3300000736 | Freshwater And Sediment | MAEIGQPDRVVRREREPLISPALPVPTPELEPAK* |
JGI12547J11936_10330643 | 3300000736 | Freshwater And Sediment | MAEIGEPDRVVRRERDPVISPALPVPTPELEPAK* |
JGI12547J11936_10560141 | 3300000736 | Freshwater And Sediment | NMAEIGEPDRVVRREREPLISPALPVPTPELEPAK* |
B570J14230_101781762 | 3300001282 | Freshwater | MAEIGEPDRVVRRERDPVISPALPTPTPELEPAK* |
GOS2228_10113084 | 3300001948 | Marine | MAEIGEPDRIVRREREPNPLTSPALPVVVPELEPASK* |
GOS2236_10339021 | 3300001968 | Marine | MAEIGEPERVVRREREPVITPALPTPAPELEPAK* |
JGI25910J50241_100057286 | 3300003388 | Freshwater Lake | MKEVVMAEIGEPDRVVRRERELEPAISPASPVITPELEPAGK* |
JGI25925J51416_100238592 | 3300003497 | Freshwater Lake | MKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK* |
Ga0007787_101335901 | 3300004240 | Freshwater Lake | LRLKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK* |
Ga0007804_10671231 | 3300004770 | Freshwater | SEGGVMAEIGEPDHVVRREREGNPGITPAPAKPAQTPEHQPA* |
Ga0070374_100031373 | 3300005517 | Freshwater Lake | MSMAEIGEPDRVVRRERDPAINPALPIPVPDLEPAQS* |
Ga0070374_100064612 | 3300005517 | Freshwater Lake | VAEIGEPDRVVRREREPAITPSVPAPTPELEPAK* |
Ga0070374_100164476 | 3300005517 | Freshwater Lake | MGEIGEPDRVVRRERDPVKTPALPTPVPELEPAQ* |
Ga0070374_101763703 | 3300005517 | Freshwater Lake | SNIVAEIGQPERVVRRERENEPALDPVVPLTSPALEPAK* |
Ga0070374_101996063 | 3300005517 | Freshwater Lake | AEIGQPERVVRRERENEPALDPVVPLTSPALEPAK* |
Ga0070374_103055661 | 3300005517 | Freshwater Lake | MAEIGEPDRVVRREREPAITPSVPAPTPELEPAK* |
Ga0070374_105532702 | 3300005517 | Freshwater Lake | MAEIGEPDRVVRREREPLISPALPVPTPELEPAK* |
Ga0068872_102885733 | 3300005528 | Freshwater Lake | MAEIGEPDRVVRRERDPVITPALPIPTPELEPAK* |
Ga0049083_101081731 | 3300005580 | Freshwater Lentic | TMGEIGEPDRVIRRERDPAIAPAMPVPTPELEPAK* |
Ga0049081_100628192 | 3300005581 | Freshwater Lentic | MGEIGEPDRVIRRERDPAIAPAMPVPTPELEPAK* |
Ga0049085_100058792 | 3300005583 | Freshwater Lentic | MTEIGQPERVVRREREIEPTPVTPLTAPDLEPAS* |
Ga0049085_100296643 | 3300005583 | Freshwater Lentic | MTEIGQPERVVRREREDEPALVPVVPLTSPALEPAP* |
Ga0049085_101193251 | 3300005583 | Freshwater Lentic | SNYKQRKNMAEIGQPDRVVRREREPLISPALPVPTPELEPAK* |
Ga0049085_102441721 | 3300005583 | Freshwater Lentic | MAEIGEPDRVVRRERDPAINPALPIPVPDLEPAQS* |
Ga0049082_101289261 | 3300005584 | Freshwater Lentic | IGQPERVVRRERENEPVPTPVVPATTPALEPAQKI* |
Ga0076948_10128613 | 3300005739 | Lake Water | MAEIGEPDRVVRRERDPVITPALPTPTPELEPAK* |
Ga0079957_10136478 | 3300005805 | Lake | MAEIGKPDRVIRREREPVISPAVPAPTPELEPSK* |
Ga0079957_10853151 | 3300005805 | Lake | MAEIGEPDRVVRRERDPAITPALPTPTPELEPAK* |
Ga0070743_101000742 | 3300005941 | Estuarine | MAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK* |
Ga0073921_11071443 | 3300005990 | Sand | TMGEIGEPDRVIRRERDPAITPAMPIPTPELEPAK* |
Ga0007881_11660341 | 3300006072 | Freshwater | MAEIGEPDHVVRREREGNPGITPAPAKPAQTPEHQPA* |
Ga0079301_12192822 | 3300006639 | Deep Subsurface | MAEIGEPDRVVRRERELEPAISPASPVVAPELEPAGK* |
Ga0079299_10557842 | 3300006862 | Deep Subsurface | MAEIGEPDRVVRRERDPVITPELPTPTPELEPAK* |
Ga0105050_1000181219 | 3300007516 | Freshwater | MRGLTMAEIGEPDRVVRRGREVEPIKVPIVPEPELEPSK* |
Ga0105050_100348334 | 3300007516 | Freshwater | MAEIGEPDRVVRREREKDPITVPAIPVPELEPAK* |
Ga0105050_100629611 | 3300007516 | Freshwater | MAEIGKPERVVRREREAQPAISPQTPVKQPQPAK* |
Ga0105050_100669064 | 3300007516 | Freshwater | MTMAEIGEPDRVVRRERETQPMEVPSLPTPALEPAN* |
Ga0105050_101295731 | 3300007516 | Freshwater | DMAEIGKPERVVRREREAQPAISPQTPVKQPQPAK* |
Ga0105055_1000204239 | 3300007519 | Freshwater | MAEIGEPDRVVRRERETQPMEVPSVPTPALEPAN* |
Ga0105053_101376954 | 3300007522 | Freshwater | MTMAEIGEPDRVVRRERETQPMEVPSVPTPALEPAN* |
Ga0102861_10096564 | 3300007544 | Estuarine | MGEIGEPDRVIRRERDPAITPATPVPTPELEPAK* |
Ga0102874_11322012 | 3300007546 | Estuarine | MAEIGEPDRVVRRERDPQITPAMPIPTPELEPAK* |
Ga0102875_11522562 | 3300007547 | Estuarine | VDKQMAEIGEPDRVVRRERDPQITPAMPIPTPELEPAK* |
Ga0102916_10106605 | 3300007585 | Estuarine | MAEIGEPERVVRREREPLISPALPVPTPELEPAK* |
Ga0102917_10076377 | 3300007590 | Estuarine | MGEIGEPDRVIRRERDPAITPAMPIPTPELEPAK* |
Ga0102921_10196674 | 3300007603 | Estuarine | MAEIGQPERVVRRERENEPTPAPVVAPVSPELEPAQ* |
Ga0102872_11046051 | 3300007621 | Estuarine | TMGEIGEPDRVIRRERDPAIAPATPVPTPELEPAK* |
Ga0102895_10995703 | 3300007629 | Estuarine | GTRHVREETMGEIGEPDRVIRRERDPAIAPATPVPTPELEPAK* |
Ga0102901_10169135 | 3300007634 | Estuarine | MAEIGEPDRVVRREREPVISPALPVPTPELEPAK* |
Ga0102867_11943751 | 3300007716 | Estuarine | LGTRHVREETMGEIGEPDRVIRRERDPAIAPATPIPTPELEPAK* |
Ga0105745_10470822 | 3300007972 | Estuary Water | MAEIGQPDRVVRREREPLISPALPAPTPELEPAK* |
Ga0105746_10434471 | 3300007973 | Estuary Water | NYKQRKNMAEIGQPDRVVRREREPLISPALPVPTPELEPAK* |
Ga0114341_100367777 | 3300008108 | Freshwater, Plankton | MAEIGEPDRVVRRERDPQIIPATPIPTPELEPAK* |
Ga0114341_100704132 | 3300008108 | Freshwater, Plankton | MAEIGEPERVVRREREPQITPAIPVPTPELEPAK* |
Ga0114344_10133688 | 3300008111 | Freshwater, Plankton | MAEIGQPDRVVRREREPLISPALPVPAPELEPAK* |
Ga0114344_10418692 | 3300008111 | Freshwater, Plankton | MAEIGKPDRVVRREREPVISPAMPIPTPELEPSK* |
Ga0102831_10575301 | 3300008996 | Estuarine | MAEIGEPDRVVRREREPAITPSVPAPTPALEPAK* |
Ga0102892_10174273 | 3300009057 | Estuarine | MAEIGEPDRVVRREREPLISPALPVPTPEIEPAK* |
Ga0127402_10023237 | 3300009451 | Meromictic Pond | MAEIGQPERVVRRERENQPGLDPVVPLAEPELEPAP* |
Ga0114958_100053825 | 3300009684 | Freshwater Lake | MKMAEIGEPDHVVRRERETPGVTPAVPAPNAVPELEPA* |
Ga0116204_10127736 | 3300010293 | Anoxic Lake Water | MAEIGKPDRVVRREREPVITPAVPTPAPELEPSK* |
Ga0116204_10146718 | 3300010293 | Anoxic Lake Water | MAEIGEPDRVVRRERDPVITPASPAPTPELEPAK* |
Ga0129324_100229573 | 3300010368 | Freshwater To Marine Saline Gradient | MGEIGEPDRIVRRERDPITTPALPTPVPELEPAQ* |
Ga0139556_10041802 | 3300011011 | Freshwater | MAEIGEPDRVVRREREPAITPNVPAPTPELEPAK* |
Ga0137490_10003076 | 3300011246 | Cryoconite Hole, Glacier Surface | MAEIGEPERVVRRERENEPAITPSQPVTTPELEPAK* |
Ga0137489_10073973 | 3300011249 | Basal Ice | MAEIGEPERVVRRERENEPAITPTQPVTTPELEPAK* |
Ga0119951_10328042 | 3300012000 | Freshwater | MAEIGEPDKVVRREREPAITPSVPAPTPELEPAK* |
Ga0164293_101751922 | 3300013004 | Freshwater | MAEIGEPDRIVRREREPLISPAAPIPVPELEPAK* |
Ga0164294_101939071 | 3300013006 | Freshwater | LYKFKKKGAVVAEIGEPDRVVRREREPAITPSVPAPTLELEPAK* |
Ga0164295_114727133 | 3300013014 | Freshwater | QVREETMGEIGEPDRVIRRERDPAIAPAMPVPTPELEPAK* |
Ga0163212_100054917 | 3300013087 | Freshwater | MAEIGEPDRVVRRERELEPAIHPTTPVVTPELEPAGK* |
Ga0163212_10105942 | 3300013087 | Freshwater | MAEIGEPDRVVRRERELEPAITPASPIVTPELEPAGK* |
Ga0163212_10239232 | 3300013087 | Freshwater | MAEIGKPDRIVRREREIEGTPTPSPSPVVPELEPAEK* |
Ga0163212_11550632 | 3300013087 | Freshwater | MKEVVMAEIGEPDRVVRRERELEPAITPASPVVTPELEPAGK* |
Ga0163212_12654732 | 3300013087 | Freshwater | MKKVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK* |
Ga0163210_13110601 | 3300013091 | Freshwater | MAMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK* |
(restricted) Ga0172373_101555092 | 3300013131 | Freshwater | MAEIGEPDRVVRREREPEPAISPASPVVTPELEPAGK* |
Ga0136642_100010653 | 3300013285 | Freshwater | MAEIGEPDRVVRRERETQPGALPEKPAVLPLPPEVEPVR* |
Ga0136642_10017516 | 3300013285 | Freshwater | MAEIGEPERVVRREREPLPTVAPQVPGVQPLAPELEPA* |
Ga0136642_10980042 | 3300013285 | Freshwater | MAEIGEPDRVVRRERETQPLTVPQTPAVQPETPALEPASAQ* |
Ga0136642_11862242 | 3300013285 | Freshwater | MAEIGEPDHVVRRERETQPGSVPGQPTVLPATPELEPANYGK* |
Ga0136641_10253482 | 3300013286 | Freshwater | MKMAEIGEPDHVVRRERETPVVTPAVPAPNVVPELEPA* |
Ga0177922_101867684 | 3300013372 | Freshwater | REKTMGEIGEPDRVIRRERDPAIAPAMPVPTPELEPAK* |
Ga0119952_10136554 | 3300014050 | Freshwater | MAEIGEPDKVVRREREPAITSSVPAPTPELEPAK* |
Ga0119952_10360332 | 3300014050 | Freshwater | MAEIGEPDRVVRRERVPQIIPATPIPTPELEPAK* |
(restricted) Ga0172376_104627602 | 3300014720 | Freshwater | RAKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK* |
Ga0167627_100128711 | 3300015196 | Glacier Forefield Soil | MAEIGEPERVVRRERENEPVVTPAQPVTTPELEPAH* |
Ga0167627_10074664 | 3300015196 | Glacier Forefield Soil | MAEIGEPERVVRRERENEPAITPTQPVTTPELEPAQ* |
Ga0169931_102186772 | 3300017788 | Freshwater | MAEIGEPDRVVRREREPEPAISPASPVVTPELEPAGK |
Ga0187844_101509383 | 3300018868 | Freshwater | TLYKFKKGAQMAEIGEPDRVVRREREPAITPSVPVPTPELEPAK |
Ga0187844_104071703 | 3300018868 | Freshwater | QVREETMGEIGEPDRVIRRERDPAIAPATPVPTPELEPAK |
Ga0187843_101536291 | 3300019093 | Freshwater | ITLYKFKKGAQVAEIGEPDRVVRREREPAITPSVPAPTPELEPAK |
Ga0188835_10117581 | 3300019096 | Freshwater Lake | MAEIGEPDRVVRRERELEPAISPPSPVVTPELEPAGK |
Ga0194113_100030969 | 3300020074 | Freshwater Lake | MAMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0194113_100106362 | 3300020074 | Freshwater Lake | MAMAEIGEPDRVVRRERELEPAVSPASPVVTPELEPAGK |
Ga0194113_100147808 | 3300020074 | Freshwater Lake | MAEIGEPDRVVRREREPEPAISPTSPVVTPELEPAGK |
Ga0194113_101525692 | 3300020074 | Freshwater Lake | MAEIGEPDRVVRRERELEPAIHPTTPVVTPELEPAGK |
Ga0194113_101581704 | 3300020074 | Freshwater Lake | MAEIGEPDRVVRRERELEPATSPASPVVTPELEPAGK |
Ga0194113_102515212 | 3300020074 | Freshwater Lake | MAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0194112_109198832 | 3300020109 | Freshwater Lake | MAEIGEPDRVVRRERELEPAISPASPVVTPELEPA |
Ga0194134_100239384 | 3300020179 | Freshwater Lake | VAEIGQPERVVRREREVSPAPIPSEPPVTPELEPAGK |
Ga0194118_101123933 | 3300020190 | Freshwater Lake | MAEIGEPDRVVRRERELEPAITPASPVVTPELEPAGK |
Ga0194118_104762111 | 3300020190 | Freshwater Lake | LAFYKLRAKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0194128_103199933 | 3300020197 | Freshwater Lake | YKLRMKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0194120_103010412 | 3300020198 | Freshwater Lake | MKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0194116_102999001 | 3300020204 | Freshwater Lake | VKEVVMAEIGEPDRVVRRERELEPATSPASPVVTPELEPAGK |
Ga0194119_105070333 | 3300020220 | Freshwater Lake | AFYKLRAKEVVMAEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0194119_107810091 | 3300020220 | Freshwater Lake | MAEIGEPDRVVRRERELEPAISPASPAVTPELEPAGK |
Ga0194127_101072771 | 3300020221 | Freshwater Lake | EVVMAEIGEPDRVVRRERELEPAIHPTTPVVTPELEPAGK |
Ga0194133_105314002 | 3300021091 | Freshwater Lake | MAEIGEPDRVVRRERELEPVISPASPVVTPELEPAGK |
Ga0194130_102189122 | 3300021376 | Freshwater Lake | MKEVVMAEIGEPDRVVRRERELEPAITPASPVVTPELEPAGK |
Ga0214919_101842871 | 3300023184 | Freshwater | AAMAEIGEPDKVVRREREPAITPSVPAPTPELEPAK |
Ga0247724_10020993 | 3300024239 | Deep Subsurface Sediment | MVMAEIGEPDRVVRRERELEPAISPASPVVAPELEPAGK |
Ga0256304_11229982 | 3300024856 | Freshwater | MAEIGEPDRVVRRERELEPAISPASPVITPELEPAGK |
Ga0208048_10006272 | 3300025283 | Freshwater | MAEIGKPDRIVRREREIEGTPTPSPSPVVPELEPAEK |
Ga0208048_100143312 | 3300025283 | Freshwater | MAEIGEPDRVVRRERELEPAITPASPIVTPELEPAGK |
Ga0208870_10157933 | 3300025356 | Freshwater | MAEIGEPDHVVRREREGNPGITPAPAKPAQTPEHQPA |
Ga0208614_10230031 | 3300025413 | Freshwater | MAEIGEPDHVVRREREGNPGITPAPAKPAETPEHQPA |
Ga0208389_10898211 | 3300025470 | Freshwater | MAEIGEPDHVVRREREGNPGITPAPAKPVQTPEHQPA |
Ga0255063_10033553 | 3300027151 | Freshwater | MKEVVMAEIGEPDRVVRRERELEPAISPASPVLEPAGK |
Ga0255111_10972251 | 3300027154 | Freshwater | FKMAEIGEPDRVVRREREPLISPALPVPTPELEPAK |
Ga0255135_10414442 | 3300027287 | Freshwater | GDGLMAEIGEPDRVVRRERDPQIIPATPIPTPELEPAK |
Ga0255126_10144516 | 3300027295 | Freshwater | YKQRKNMAEIGQPDRVVRREREPLISPALPVPTPELEPAK |
Ga0255127_10817041 | 3300027301 | Freshwater | KNMAEIGQPDRVVRREREPLISPALPVPTPELEPAK |
Ga0255109_10926161 | 3300027329 | Freshwater | GFNMAEIGEPDRVVRREREPLISPALPVPTPELEPAK |
Ga0255138_10768242 | 3300027333 | Freshwater | MSEIGEPDRVVRRERELEPAISPASPVVTPELEPAGK |
Ga0255130_10234731 | 3300027335 | Freshwater | MKEVVMAEIGEPDRVVRRERELEPAISPASPVITP |
Ga0209552_10807423 | 3300027563 | Freshwater Lake | MSMAEIGEPDRVVRRERDPAINPALPIPVPDLEPAQS |
Ga0209552_11795262 | 3300027563 | Freshwater Lake | LYKYKKGAQVAEIGEPDRVVRREREPAITPSVPAPTPELEPAK |
Ga0209651_12121113 | 3300027581 | Freshwater Lake | EVVMAEIGEPDRVVRRERELEPAISPASPVITPELEPAGK |
Ga0208966_11013062 | 3300027586 | Freshwater Lentic | MTEIGQPERVVRREREDEPALVPVVPLTSPALEPAP |
Ga0255122_10840831 | 3300027595 | Freshwater | KLGSNVSYYKQRKNMAEIGQPDRVVRREREPLISPALPVPTPELEPAK |
Ga0208942_10077993 | 3300027627 | Freshwater Lentic | MTEIGQPERVVRREREIEPTPTPVTPLTAPDLEPAS |
Ga0208942_10362702 | 3300027627 | Freshwater Lentic | MAEIGQPERVVRRERENEPATNPGVPLTAPALEPAP |
Ga0208942_10918692 | 3300027627 | Freshwater Lentic | MTEIGQPERVVRREREDEPALVPVVPLTLPALEPAP |
Ga0209135_10364901 | 3300027642 | Freshwater Lake | TMGEIGEPDRVIRRERDPAIAPAMPVPTPELEPAK |
Ga0209499_10060513 | 3300027712 | Freshwater Lake | MKMAEIGEPDHVVRRERETPGVTPAVPAPNAVPELEPA |
Ga0209442_10353804 | 3300027732 | Freshwater Lake | KGMSMAEIGEPDRVVRRERDPAINPALPIPVPDLEPAQS |
Ga0209355_10719132 | 3300027744 | Freshwater Lake | MAEIGQPERVVRRERENEPTPAPVPLTSPALEPAQ |
Ga0209355_11396271 | 3300027744 | Freshwater Lake | KEVVMAEIGEPDRVVRRERELEPAISPASPVITPELEPAGK |
Ga0209246_100214594 | 3300027785 | Freshwater Lake | MKEVVMAEIGEPDRVVRRERELEPAISPASPVITPELEPA |
Ga0209246_100695091 | 3300027785 | Freshwater Lake | LALNNSRMKEVVMAEIGEPDRVVRRERELEPAISPASPVITPELEPAGK |
Ga0209491_100261684 | 3300027832 | Freshwater | MTMAEIGEPDRVVRRERETQPMEVPSLPTPALEPAN |
Ga0209390_101197385 | 3300027848 | Freshwater | MTMAEIGEPDRVVRRERETQPMEVPSVPTPALEPAN |
Ga0209390_101871183 | 3300027848 | Freshwater | DMAEIGKPERVVRREREAQPAISPQTPVKQPQPAK |
Ga0209550_102470794 | 3300027892 | Freshwater Lake | RSNIVAEIGQPERVVRRERENEPALDPVVPLTSPALEPAK |
(restricted) Ga0247837_13138721 | 3300027970 | Freshwater | MAEIGEPDRVVRRERELEPAISPATPVVTPELEPAGK |
Ga0209702_1000156519 | 3300027976 | Freshwater | MRGLTMAEIGEPDRVVRRGREVEPIKVPIVPEPELEPSK |
Ga0255254_11233591 | 3300028105 | Freshwater | FNMAEIGEPDRVVRREREPLISPALPIPTPELEPAK |
Ga0247028_10002936 | 3300029894 | Cryconite | MAEIGEPERVVRRERENEPAITPTQPVTTPELEPAK |
Ga0247050_10170953 | 3300029912 | Cryconite | MAEIGEPERVVRRERENEPVITPAQPVTTPELEPAH |
Ga0335396_100799353 | 3300032462 | Freshwater | GGDMAEIGKPERVVRREREAQPAISPQTPVKQPQPAK |
Ga0310130_0032652_1129_1242 | 3300034073 | Fracking Water | MAEIGEPDRVVRRERELEPAISPASPVVAPELEPAGK |
⦗Top⦘ |