NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043547

Metagenome / Metatranscriptome Family F043547

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043547
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 102 residues
Representative Sequence VRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASSQER
Number of Associated Samples 141
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.08 %
% of genes near scaffold ends (potentially truncated) 99.36 %
% of genes from short scaffolds (< 2000 bps) 91.67 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.718 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(14.103 % of family members)
Environment Ontology (ENVO) Unclassified
(42.949 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(39.103 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 61.42%    β-sheet: 1.57%    Coil/Unstructured: 37.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF01258zf-dskA_traR 12.82
PF13186SPASM 7.69
PF05402PqqD 5.77
PF02620YceD 2.56
PF01797Y1_Tnp 2.56
PF00732GMC_oxred_N 1.92
PF13620CarboxypepD_reg 1.92
PF02780Transketolase_C 1.92
PF00232Glyco_hydro_1 1.28
PF01476LysM 0.64
PF00216Bac_DNA_binding 0.64
PF07813LTXXQ 0.64
PF01548DEDD_Tnp_IS110 0.64
PF06386GvpL_GvpF 0.64
PF12850Metallophos_2 0.64
PF13683rve_3 0.64
PF13181TPR_8 0.64
PF14125DUF4292 0.64
PF13650Asp_protease_2 0.64
PF14317YcxB 0.64
PF00290Trp_syntA 0.64
PF13517FG-GAP_3 0.64
PF11937DUF3455 0.64
PF13527Acetyltransf_9 0.64
PF08238Sel1 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 12.82
COG139923S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)Translation, ribosomal structure and biogenesis [J] 2.56
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 2.56
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 2.56
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 1.92
COG2723Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidaseCarbohydrate transport and metabolism [G] 1.28
COG0159Tryptophan synthase alpha chainAmino acid transport and metabolism [E] 0.64
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 0.64
COG3547TransposaseMobilome: prophages, transposons [X] 0.64


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.72 %
UnclassifiedrootN/A1.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105106872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae881Open in IMG/M
3300001100|JGI12703J13194_101160All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71246Open in IMG/M
3300001356|JGI12269J14319_10213997All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7746Open in IMG/M
3300001593|JGI12635J15846_10546486All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7678Open in IMG/M
3300002245|JGIcombinedJ26739_101406457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7591Open in IMG/M
3300002907|JGI25613J43889_10043676All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1268Open in IMG/M
3300005177|Ga0066690_10267249All Organisms → cellular organisms → Bacteria1150Open in IMG/M
3300005436|Ga0070713_100085932All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2696Open in IMG/M
3300005468|Ga0070707_100145506All Organisms → cellular organisms → Bacteria2307Open in IMG/M
3300005468|Ga0070707_100456867All Organisms → cellular organisms → Bacteria1238Open in IMG/M
3300005536|Ga0070697_101300065All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005921|Ga0070766_10997076All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter576Open in IMG/M
3300006059|Ga0075017_100810494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7724Open in IMG/M
3300006059|Ga0075017_101547480All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7523Open in IMG/M
3300006086|Ga0075019_10603746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7688Open in IMG/M
3300006102|Ga0075015_100181695All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300006174|Ga0075014_100017552All Organisms → cellular organisms → Bacteria2673Open in IMG/M
3300006797|Ga0066659_11151327All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009038|Ga0099829_10277789All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71370Open in IMG/M
3300009089|Ga0099828_10343849All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71344Open in IMG/M
3300009143|Ga0099792_10460585All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7789Open in IMG/M
3300009522|Ga0116218_1542561All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7518Open in IMG/M
3300009549|Ga0116137_1099558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7853Open in IMG/M
3300009615|Ga0116103_1032574All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300009617|Ga0116123_1021154All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2074Open in IMG/M
3300009628|Ga0116125_1187526All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7584Open in IMG/M
3300009632|Ga0116102_1087916All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica909Open in IMG/M
3300009636|Ga0116112_1006118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5568Open in IMG/M
3300009644|Ga0116121_1174698All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7680Open in IMG/M
3300009762|Ga0116130_1003755All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6815Open in IMG/M
3300009839|Ga0116223_10765882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7553Open in IMG/M
3300010046|Ga0126384_12032782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7550Open in IMG/M
3300010046|Ga0126384_12172148All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010048|Ga0126373_12469781All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7579Open in IMG/M
3300010358|Ga0126370_12488898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7516Open in IMG/M
3300010360|Ga0126372_11605162All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7689Open in IMG/M
3300010379|Ga0136449_102067341All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7838Open in IMG/M
3300010859|Ga0126352_1284773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7510Open in IMG/M
3300011074|Ga0138559_1153650All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7781Open in IMG/M
3300011270|Ga0137391_11343290All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7561Open in IMG/M
3300012189|Ga0137388_10199579All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300012203|Ga0137399_10460389All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71064Open in IMG/M
3300012205|Ga0137362_11244810All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7629Open in IMG/M
3300012207|Ga0137381_10363186All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300012361|Ga0137360_10792545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium815Open in IMG/M
3300012683|Ga0137398_10159121All Organisms → cellular organisms → Bacteria → Acidobacteria1470Open in IMG/M
3300012683|Ga0137398_10412392All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7920Open in IMG/M
3300012923|Ga0137359_10319062All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300012927|Ga0137416_11331938All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7649Open in IMG/M
3300014154|Ga0134075_10383577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7619Open in IMG/M
3300014155|Ga0181524_10244771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7847Open in IMG/M
3300014164|Ga0181532_10006027All Organisms → cellular organisms → Bacteria → Acidobacteria10164Open in IMG/M
3300014164|Ga0181532_10496370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7669Open in IMG/M
3300014165|Ga0181523_10348513All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300014169|Ga0181531_10966008All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7534Open in IMG/M
3300014491|Ga0182014_10492340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7601Open in IMG/M
3300015264|Ga0137403_10674096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium895Open in IMG/M
3300017823|Ga0187818_10235056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7801Open in IMG/M
3300017823|Ga0187818_10534761All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7527Open in IMG/M
3300017925|Ga0187856_1199034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7727Open in IMG/M
3300017928|Ga0187806_1261110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7602Open in IMG/M
3300017935|Ga0187848_10474724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7512Open in IMG/M
3300017938|Ga0187854_10053361All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300017938|Ga0187854_10152294All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71048Open in IMG/M
3300017946|Ga0187879_10180700All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica1186Open in IMG/M
3300017946|Ga0187879_10812649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7522Open in IMG/M
3300017948|Ga0187847_10839300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7521Open in IMG/M
3300017973|Ga0187780_10205474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1373Open in IMG/M
3300018002|Ga0187868_1226762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7638Open in IMG/M
3300018009|Ga0187884_10277056All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7680Open in IMG/M
3300018013|Ga0187873_1090986All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71222Open in IMG/M
3300018016|Ga0187880_1006516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8235Open in IMG/M
3300018019|Ga0187874_10429610All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7532Open in IMG/M
3300018021|Ga0187882_1388743All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7530Open in IMG/M
3300018022|Ga0187864_10195971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7961Open in IMG/M
3300018026|Ga0187857_10140982All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella arctica1150Open in IMG/M
3300018030|Ga0187869_10144537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71182Open in IMG/M
3300018030|Ga0187869_10412289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7644Open in IMG/M
3300018033|Ga0187867_10768918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7524Open in IMG/M
3300018037|Ga0187883_10091013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71590Open in IMG/M
3300018044|Ga0187890_10524178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7667Open in IMG/M
3300018044|Ga0187890_10552647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7648Open in IMG/M
3300018047|Ga0187859_10336749All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium821Open in IMG/M
3300018060|Ga0187765_10768920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7639Open in IMG/M
3300018062|Ga0187784_11363739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7562Open in IMG/M
3300018062|Ga0187784_11421671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7549Open in IMG/M
3300018085|Ga0187772_10336760All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1040Open in IMG/M
3300018086|Ga0187769_10239314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1349Open in IMG/M
3300018089|Ga0187774_11417203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7510Open in IMG/M
3300018090|Ga0187770_10450857All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71014Open in IMG/M
3300018468|Ga0066662_12568284All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7538Open in IMG/M
3300019888|Ga0193751_1182114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7722Open in IMG/M
3300021181|Ga0210388_11500939All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7563Open in IMG/M
3300021405|Ga0210387_10532940All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300021478|Ga0210402_11166981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium697Open in IMG/M
3300021560|Ga0126371_11092678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7937Open in IMG/M
3300022521|Ga0224541_1003307All Organisms → cellular organisms → Bacteria → Acidobacteria1683Open in IMG/M
3300022521|Ga0224541_1006137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1289Open in IMG/M
3300022840|Ga0224549_1039275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7642Open in IMG/M
3300023090|Ga0224558_1164558All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7699Open in IMG/M
3300023259|Ga0224551_1000378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6848Open in IMG/M
3300024227|Ga0228598_1015080All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71526Open in IMG/M
3300025404|Ga0208936_1027605All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7746Open in IMG/M
3300025412|Ga0208194_1018103All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter1133Open in IMG/M
3300025439|Ga0208323_1056856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7693Open in IMG/M
3300025473|Ga0208190_1068611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7720Open in IMG/M
3300025922|Ga0207646_10124195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2320Open in IMG/M
3300026273|Ga0209881_1178261All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7531Open in IMG/M
3300026358|Ga0257166_1057932All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7556Open in IMG/M
3300026371|Ga0257179_1044867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7567Open in IMG/M
3300026376|Ga0257167_1053082All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7624Open in IMG/M
3300026499|Ga0257181_1018616All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71013Open in IMG/M
3300026551|Ga0209648_10554710All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7642Open in IMG/M
3300026868|Ga0207818_1022838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7547Open in IMG/M
3300027696|Ga0208696_1177268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7682Open in IMG/M
3300027729|Ga0209248_10057594All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71188Open in IMG/M
3300027829|Ga0209773_10190263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7857Open in IMG/M
3300027854|Ga0209517_10438192All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300027855|Ga0209693_10258320All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7853Open in IMG/M
3300027879|Ga0209169_10069963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71814Open in IMG/M
3300027898|Ga0209067_10373450All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7795Open in IMG/M
3300028740|Ga0302294_10106957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300028746|Ga0302233_10224239All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7716Open in IMG/M
3300028798|Ga0302222_10258221All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7679Open in IMG/M
3300028871|Ga0302230_10390756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7542Open in IMG/M
3300029636|Ga0222749_10202615All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7992Open in IMG/M
3300029923|Ga0311347_10285606All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300029989|Ga0311365_10435235All Organisms → cellular organisms → Bacteria → Acidobacteria1135Open in IMG/M
3300029999|Ga0311339_11014674All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7776Open in IMG/M
3300030007|Ga0311338_11821734All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7547Open in IMG/M
3300030014|Ga0302175_10147055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7556Open in IMG/M
3300030043|Ga0302306_10197617Not Available774Open in IMG/M
3300030057|Ga0302176_10056611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1506Open in IMG/M
3300030057|Ga0302176_10422306All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7538Open in IMG/M
3300030058|Ga0302179_10088431All Organisms → cellular organisms → Bacteria → Acidobacteria1371Open in IMG/M
3300030503|Ga0311370_11020828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae920Open in IMG/M
3300030509|Ga0302183_10132413All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7981Open in IMG/M
3300030509|Ga0302183_10260390All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7673Open in IMG/M
3300030737|Ga0302310_10223587All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1089Open in IMG/M
3300030743|Ga0265461_10055512All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71570Open in IMG/M
3300031239|Ga0265328_10368600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7561Open in IMG/M
3300031708|Ga0310686_106264180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7941Open in IMG/M
3300031718|Ga0307474_10247892All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71363Open in IMG/M
3300031820|Ga0307473_10208199All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1167Open in IMG/M
3300031820|Ga0307473_10932877All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7629Open in IMG/M
3300031823|Ga0307478_11152131All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7646Open in IMG/M
3300031962|Ga0307479_10297491All Organisms → cellular organisms → Bacteria1595Open in IMG/M
3300032955|Ga0335076_11200007All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata643Open in IMG/M
3300033402|Ga0326728_10111030All Organisms → cellular organisms → Bacteria3223Open in IMG/M
3300033405|Ga0326727_10575012All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7948Open in IMG/M
3300033433|Ga0326726_10574142Not Available1083Open in IMG/M
3300033561|Ga0371490_1074799All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7942Open in IMG/M
3300033826|Ga0334847_005467All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1278Open in IMG/M
3300033829|Ga0334854_127724All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7613Open in IMG/M
3300033983|Ga0371488_0168602All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71130Open in IMG/M
3300034091|Ga0326724_0049946All Organisms → cellular organisms → Bacteria3056Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland14.10%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil8.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.33%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland7.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.13%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil4.49%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.49%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.85%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog3.21%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.21%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.21%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.28%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.64%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.64%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.64%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.64%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.64%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.64%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001100Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009632Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011074Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 40 (Metagenome Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022521Peat soil microbial communities from Stordalen Mire, Sweden - 717 E3 20-24EnvironmentalOpen in IMG/M
3300022840Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300023259Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025404Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026273Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes)EnvironmentalOpen in IMG/M
3300026358Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-BEnvironmentalOpen in IMG/M
3300026371Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-BEnvironmentalOpen in IMG/M
3300026376Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-BEnvironmentalOpen in IMG/M
3300026499Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-BEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300026868Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 32 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027729Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028740Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030014Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N3_3EnvironmentalOpen in IMG/M
3300030043Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033561Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fractionEnvironmentalOpen in IMG/M
3300033826Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5EnvironmentalOpen in IMG/M
3300033829Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10510687223300000364SoilVRAETRHQLKEDRFSKATLHAAEQTVQWMVEHQSTLLIAGIVVAIVALIGFGGWYYLNTQDEKASIELGAATRVLDQQVRPAGVPAQPGFPSFASAQERATEARR
JGI12703J13194_10116033300001100Forest SoilVRAETRHQLKQDRFSKVTFEAAGNAVHWTAEHQAKLIAAVIAVVVIAAIAFGGWYYVNAQDEKASAELSTAVRTFETPVRPAGVPPQPGTDSF
JGI12269J14319_1021399723300001356Peatlands SoilVRAETRHQLKQDRFRQGTLDAAENAAHWTVEHQSKVIAAVIAVVVIAAIAFGGWYYVQTQDEKASAELSTAVRTFETQVRPAG
JGI12635J15846_1054648613300001593Forest SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGAIAFGGWYYINSQDEKASAEFSTAVRTWETPLRPAGVLPQPGAESFASAQERATAARKQFQAIVDKYPRT
JGIcombinedJ26739_10140645713300002245Forest SoilVRAEARHQLKEDRFSKVTFQAAEKTVHWTAEHQAKLIAAVIAVVVIAGIAVGGWYYVNSQDEKASAELSTGVRTFEAQVRPAGVPPQPGTESFASASERAT
JGI25613J43889_1004367623300002907Grasslands SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSEEHKSTLIAAAVAIVVIAAIAFGGWYYLNSQDEKASAELSTAVRTFETPVRPAGVPPQPG
Ga0066690_1026724933300005177SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVLGAIAFGGWYYVNTQDEKASAEFSTAVRTWETPVRPAGVPPQPGSDSFASAQERATAARKQFQAIV
Ga0070713_10008593213300005436Corn, Switchgrass And Miscanthus RhizosphereVRAETRHQLKQDRFSKVTFEAAGNAAHWTVEHQAKLIAAVIAVIVIAAIAFGGWYYVNTQYEKASAELTTAVRTFETPVRPAGVPPQPGTDSFASAQERATAARKQFQAI
Ga0070707_10014550623300005468Corn, Switchgrass And Miscanthus RhizosphereVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGGIAFGGWYYVNSQDEKASAEFSTAVRTWETPLRPAGVPPQPGTDSFASAQERATAARKQFQAIVD
Ga0070707_10045686733300005468Corn, Switchgrass And Miscanthus RhizosphereVRAETRHQLKQDRFSRVTFEAAGNAAHWSVEHQSKLIAAVIAVIIIGAIAFGGWYYLNSQDEKASAEFSTAVRTFETQVRRAGLPPQPGSDSFASSQERATAARKQFQ
Ga0070697_10130006523300005536Corn, Switchgrass And Miscanthus RhizosphereVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIVGIVVAVVALIGFGGWYYMNSQDEKASIELGSATRVLEQQVRPAGVPAQ
Ga0070766_1099707613300005921SoilVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVSSQDEKASGDLATAVRTFGTPIRPAGMPAQPEYPSFASVQERATAARKQFQDIVDKYPRTHTADMA
Ga0075017_10081049413300006059WatershedsVRAETRHQLKEDRFSKATIQAAEKTVHWTVEHQSKLIAAAIAVIAVAAIAVGGWYYLNMQDEKASGELSTAVRTFDAPVRPAGMPPQPGS
Ga0075017_10154748013300006059WatershedsLSARLRAEKETVRAETRHQLKQDRFSKATFEAAEKTVHWTVEHQSKLIVAAIAVIAVAAVALGGWYYLNSQDEKASGELSTAVRTFDSPVRPAVD
Ga0075019_1060374623300006086WatershedsVRAETRHQLKQDGFSKATFEAAEKTVHWTVEHQSKLIAVAIAVIAVAAIVLGGWYYLNTQDEKASGELTTAVRTFDAFLRPAGMPPQPGTESYASLEE
Ga0075015_10018169513300006102WatershedsVRAETRHQLKQDRFSKVTLEAAENAAHWSEEHKAKLIAAVIAVVVLAAIGFGGWYYVNAQDEKASAELSTAVRTFETPIRPAGVPAQPGYDTFASSQERATAA
Ga0075014_10001755243300006174WatershedsVRAETRHQLKEDRFSKVTLEAAEKTAHWGAENQAKLIAGVIAVVVIAAIAFGGWYYIGSQEEKASGEFSAAVRTFQTPVRPTGVPPQPGYDSFGSPQERATAA
Ga0066659_1115132723300006797SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVISAIAFGGWYYINSQDEKASAEFSTAVRTWETPVRPAGVPPQPGSDSFASAQERATAARKQF
Ga0099829_1027778923300009038Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSEEHKSTLIAAAIAVVAIAAITFGGWYYLNSQDEKASAEFSTAVRTWETPLRPAGVPPQPGSDSFASAQERATAARKQ
Ga0099828_1034384933300009089Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGAIAFGGWYYVNSQDEKASAEFSTAVRTFETQVRPAGVPPQPGSDSFASSQERATAARKQFQAIVDRYPHTHTA
Ga0099792_1046058513300009143Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSEEHKSTLIAAAIAVVAIAAIAFGGWYYINTQDEKASAEFSTAVRTWETPVRPAGVPAQPGTDSFAS
Ga0116218_154256113300009522Peatlands SoilVRAETRHQLKQDRFSKVTLEAAEKTAHWTVEHRAKLIAAVIAVVVIGAIAFGGWYYVNTQDEKAGAELSTAVRTFETPVRPAGVPAQPGYESFASTQERATAARK
Ga0116137_109955823300009549PeatlandVRAETRHQLKQDRFSKVTLEAAEKTANWTVEHQSKLIAAVIAVVVIGAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPVGMPPQPGYDTF
Ga0116103_103257433300009615PeatlandVRAETRHQLKQDRFSKVTLEAAEKTANWTVEHQSKLIAAVIAVVVIGAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGMPPQPGYDSFASPQERATAARKQFQAIA
Ga0116123_102115433300009617PeatlandVRAETRHQLKQDRFSKVTLEAAEKTANWTVEHQSKLIAAVIAVVVIGAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGMPPQPGYDTFASPGERATAARKQFQAIVDKYP
Ga0116125_118752613300009628PeatlandVRAETRHQLKQDRFSKVTLEAAENAAHWSEEHKAKLIAAVIAVVVLAAVGFGGWYYVNTQDEKASLEFSAAVRTFETPIRPAGVPAQPGYDTFASFQERAGAAHKQ
Ga0116102_108791613300009632PeatlandVRAETRHQLKQDRFRKGTLEAAESAAHWTVEHQSKLIAAVIAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDS
Ga0116112_100611883300009636PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYINSQDEKASAEFSTAVRTFETPVRPAGVPAQ
Ga0116121_117469823300009644PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWSVEHQAKLIAAVIAVVVIAGIAFGGWYYVNSQDEKASADLSSAVRTFETPVRPAGVPA
Ga0116130_100375513300009762PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYINSQDEKASAEFSTAVRTFETPVRPAGVPAQPGYDSFASSGERATAARKQFQEIVDKYPRTHTADMARYF
Ga0116223_1076588223300009839Peatlands SoilVRAETRHQLKQDRFRQGTLDAAENAAHWTVEHQSKVIAAVIAVVVIAAIAFGGWYYVQTQDEKASAELSTAVRTFETQVRPAGVPPQPGTDSFASS
Ga0126384_1203278213300010046Tropical Forest SoilVRAETRHQLKQDKFSKATIQVAEQTVHWTVEHQSKLLIAGVVVAVAALIGLGGWYYMNSLDEKASLELGAATRVLEAPVRPAGVPPQPGYESYASGQ
Ga0126384_1217214813300010046Tropical Forest SoilVRAEARHQLKEDRIGRATIYAAEQTVHWTVEHKSKLIMAGIVVAVAVLIGAGGWYYMTQQDERASMALGSATRVLEEPIRPAGVPPQPGFPSFASVT
Ga0126373_1246978113300010048Tropical Forest SoilVRAETRHQLKEDRFSKATIEAAEKTVHWTVEHQSKVLVAAIVVAVVAAVAIGGWYYLNTQDEKASAELTVAVRTLDAPVLPGGATAPPGVQTFSSSQERSTAARKQFQA
Ga0126370_1248889813300010358Tropical Forest SoilVRAETRHQLKEDRFSKATFEAAEKTVHWTVEHQSTLIVASIIAAVIVAVVGGGWFYLNTQDEKASGELSTAVRTLETPVRPAGMPPQPGFDSFASSQERATEARKQ
Ga0126372_1160516223300010360Tropical Forest SoilVRAETRHQLKEDRFSRATFEAAEKTVHWTVEHQNKLVVGAVALIVIVALGFGGWYYTNSKDERAGLEFGAATRTMETQVRPAGVPAQPGFESFASSQERATAARKQFQA
Ga0136449_10206734113300010379Peatlands SoilVRAETRHQLKEDRFSKATFEAAEKTVNWSQEHQGKLIAAVVAVAVVASIAIGGWYYVKSQDEKASFELATAVRTLETPLRPAGTPEQPGYPSFESGT
Ga0126352_128477313300010859Boreal Forest SoilVRAEARHQLKEDRFSKVTFQAAEKTVHWTAEHQAKLIAAVIAVVVIAGIAVGGWYYVNSQDEKASAELSTGVRTLEAQVRPAGVPPQPGTESFDSASERATAARKQFQAIIDKYPRTHTADMA
Ga0138559_115365013300011074Peatlands SoilVRAETRHQLKQDRFSKVTLEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASSQERATAARKQFQEIVDQYPHTHTADMARY
Ga0137391_1134329013300011270Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGAIAFGGWYYLNSQDEKASAEFSTAVRTWETPLRPAGVPPQPGSD
Ga0137388_1019957933300012189Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGAIAFGGWYYVNSQDEKASAEFSTAVRTFETQVRPAGVPPQPGSDSFASSQERATAAR
Ga0137399_1046038913300012203Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVLGAIAFGGWYYVNTQDEKASAEFSTAVRTWETAVRPAGVPPQPGSD
Ga0137362_1124481023300012205Vadose Zone SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAVVALIGFGGWYYMNSQDEKASVELGAATRVLEQQVRPAGVPAQPGFPSFASAQE
Ga0137381_1036318613300012207Vadose Zone SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAVVALIGFGGWYYMNSQDEKASIELGAATRVLEQQVRPAGVPAQPGFPSFASAQ
Ga0137360_1079254523300012361Vadose Zone SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAVIALIGFGGWYYMNSQDEKASIELGAATRVLEQQVRPVGVPAQPGFPSFASAQERATEARKQFQ
Ga0137398_1015912133300012683Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWTAEHQAKLIAAVIGVIVVAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPPQPGTDSFASAQERATAARK
Ga0137398_1041239213300012683Vadose Zone SoilVRAETRHQLKEDRFSKATIHAAEQTVHWTVEHQSKLLIAGIVIAVAALIGFGGWYYLNTQDEKASLELGAAGRVLEEQVRPAGVPAQPGFPSF
Ga0137359_1031906213300012923Vadose Zone SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGVIAFGGWYYINSQDEKASAEFSTAVRTWETPVRPAGVPPQPGSESFASAQ
Ga0137416_1133193813300012927Vadose Zone SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTAEHQSKLVIAAIVVAMVALIGFGGWYYMNSLDEKASIELGSATRVLEQPVRPAGVPAQPGYPSFASAQERAAEAR
Ga0134075_1038357713300014154Grasslands SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAVVALIGFGGWYYMNSQDEKASVELGAATRVLEHQVRPAGVPAQPGFPSFASAQERATEARKQ
Ga0181524_1024477123300014155BogVRAETRHQLKQDRFSKVTLEAAENAAHWSEEHQGKLIAATIAIIVIGVLAIGGWSYLNLQDEKAGAELSTAVRTLETPVRPAGMPPQPEYDSFASPAERATAARKQFQ
Ga0181532_10006027123300014164BogVRAETRHQLKQDRFSKVTIEAAENAAHWSAEHQSKIIAVVIAVVVIGAIAFGGWYYVNTQDEKASGELSTAVRTFETPVRPAGVPAQPDYDSFASTEE
Ga0181532_1049637013300014164BogVRAETRHQLKQDRFSKVTFEAAEKTAHWTVEHQAKIIAAVVAVAVIAAIAFGGWYYVNMQDEKASGELSTAVRTFETPVRPAGV
Ga0181523_1034851313300014165BogVRAETRHQLKQDRFSKVTIEAAENAAHWSAEHQSKIIAVVIAVVVIGAIAFGGWYYVNTQDEKASGELSTAVRTFETPVRPA
Ga0181531_1096600813300014169BogVRAETRRQLKEDRFSKVTFEAAGNAAHWTAEHQSKLIAAVIAVIIVGAIGFGGWYYVSSQDEKASFDLTAAVRTFETPLRPAGSPP
Ga0182014_1049234023300014491BogVRAETRHQLKQDRFSKVTLEAAEKTANWSAEHQSKIIAVVIAVVVIGAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPDYDSFASTEERATAARKQF
Ga0137403_1067409623300015264Vadose Zone SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAVIALIGFGGWYYMNSQDEKASIELGAATRVLEQQVRPAGVPAQPGFPSFASAQ
Ga0187818_1023505613300017823Freshwater SedimentVRAETRHQLKEDRFSKATLEAAEKTVHWTVEHQSKLIVAAIAVVAIAAITLGGWYYLNTQDEKASGELSTAVRTFESPVRPAGMPPQPGSESYGSLQERATEARK
Ga0187818_1053476123300017823Freshwater SedimentVRAETRHQLKEDRFSKATFEAAEKTVNWTQEHQGKLIVAAVAVVVVAAIGFGGWYYVKTQDEKASFELATAVRTLETPLRPAGTPEQPGFPSFESGTARATEARKEFQAI
Ga0187856_119903413300017925PeatlandVRAETRHQLKQDRFSKVTIEAAEKTAHWTVEHQSKLIIAVIAVVAIGAMAFVGWYYVNQQNEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASPQERATAARKQ
Ga0187806_126111023300017928Freshwater SedimentVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVVAVVVIAAVAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDTFASPQERA
Ga0187848_1047472413300017935PeatlandVRAETRHQLKQDRFSKVTFEAAENAAHWTVEHQAKLIAAVIAVVVIAGIAFGGWYYVNSQDEKASGELSTAVRTFETPVRPAGVPAQPGFDSFASAQER
Ga0187854_1005336133300017938PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASSQERATAARK
Ga0187854_1015229433300017938PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAAVVIAAIAFGGWYYVNSQDEKASAEFSKAVRTFETPVRPAGVPAQPGYDSFAS
Ga0187879_1018070013300017946PeatlandVRAETRHQLKQDRFRKGTLEAAESAAHWTVEHQSKLIAAVIAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASPQERATLARKQFQEIVDKYPRTHTADLARYF
Ga0187879_1081264913300017946PeatlandVRAETRHQLKQDRFSKVTLEAAENAAHWSEEHKAKLIAAVIAVVVLAAVGFGGWYYVNTQDEKASLEFSAAVRTFETPIRPAGVPAQPGYDTFASFQERAGAAHKQFQD
Ga0187847_1083930013300017948PeatlandVRAETRHQLKQDRFSKATFEAAGNAAHWTVEHQSKVVAAVIAVAVIGAIAFGGWYYVSQQDEKASSDLSTAVRTFETPVRPAGVPPQPGYDSFASTQERATAARKQFQEIVDK
Ga0187780_1020547413300017973Tropical PeatlandVRAETRHQLKEDRFSKATLQAAEKTVHWTQEHQGKLIAAAVAAIVIAAIALGGWYYVNSQDEKASHDFAAAVRTFDTPVRPAGVPEQPGFSSFESSQARAAAARKQFQA
Ga0187868_122676223300018002PeatlandVRAEARHQMKEDRFSKVTLEAAENAAHWSEEHKSKLIAVAIAVVVIAAIAAGGWYYLNVQDEEASAELSTAVRTLDTPVRPAGTPA
Ga0187884_1027705613300018009PeatlandVRAETRHQLKQDRFSKVTLEAAEKTANWSAEHQSKIIAVVIAVVVIGAIAFGGWYYVNSQDEKASGELSTAVRTFETPVRPAGVPAQPDYD
Ga0187873_109098613300018013PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYINSQDEKASAEFSTAVRTFETPVRPAGVPAQPGYDSFASSGERATAARKQFQEIVDK
Ga0187880_1006516103300018016PeatlandVRAETRHQLKQDRFRKGTLEAAESAAHWTVEHQSKLIAAVIAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFAS
Ga0187874_1042961013300018019PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASSQERATAARKQFQEIVD
Ga0187882_138874313300018021PeatlandVRAETRHQLKQDRFRKGTLEAAESAAHWTVEHQSKLIAAVIAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQP
Ga0187864_1019597123300018022PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGY
Ga0187857_1014098223300018026PeatlandVRAETRHQLKQDRFRKGTLEAAESAAHWTVEHQSKLIAAVIAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASPQERATLARKQFQ
Ga0187869_1014453713300018030PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYINSQDEKASAEFSTAVRTFETPVRPAGVPAQPGYDSFASSGERATAARKQFQEIV
Ga0187869_1041228913300018030PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTAEHQSKVVAAVIAVVVIAAIALGGWYYISQQDEKASSELSTAVRTFETPIRPAGVPAQPGFETFASSQE
Ga0187867_1076891813300018033PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTAEHQSKVVAAVIAVVVIAAIALGGWYYISQQDEKASSELSTAVRTFETPIRPAGVPAQPGFETFASSQERATAARKQFQ
Ga0187883_1009101323300018037PeatlandVRAETRHQLKQDRFSKATFEAAGNAAHWTVEHQSKVVAAVIAVVVIGAIAFGGWYYVNTQDEKASAELSTAVRTFETTVRPAGVPAQPGY
Ga0187890_1052417823300018044PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYINSQDEKASAEFSTAVRTFETPVRPAGVPAQPGYDSFASSGERATAARKQFQEIVDKYPRTHTA
Ga0187890_1055264723300018044PeatlandVRAETRHQLKEDRFSKTTLEAAEKTVHWSQEHQSKLIVAAVAVAVIAAIAFGGWYYINSQDEKASLDLTAAVRTLETPLRPAGTPEQPGYASFDSTTARATAARKQFQDIVDKY
Ga0187859_1033674923300018047PeatlandVRAETRRQLKEDRFSKVTFEAAGNAAHWTAEHQAKLIAAVIAVVVIAAIAFGGWYYVNQQDEKASAELSTAVRTFETPVRPAGVPA
Ga0187765_1076892013300018060Tropical PeatlandVRAETRHQLKEDRFSKATLQAAEKTVHWSVEHQSKLIVAAIILVVVVLLGIGGWYYLNTQDEKASLELGAATRILEQPVRPAGIPAEPGFPSYASSQER
Ga0187784_1136373913300018062Tropical PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHRAKLIAAAIAVVVIGAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGFD
Ga0187784_1142167113300018062Tropical PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHRAKLIAAAIAVVVIGALAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGFD
Ga0187772_1033676013300018085Tropical PeatlandVRAETRHQLKEDRFSKTTLQVAEKTVNWTQEHQGKLIVAAVAVIVIAAVGFGGWYYINTQDEKASLDLAVAVRTFETPLRPAGTPG
Ga0187769_1023931413300018086Tropical PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHRAKLIAAAIAVVVIGAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFAS
Ga0187774_1141720323300018089Tropical PeatlandVRAETRHQLKQDRFSKATIEAAEKTVHWTVEHESKLIVAAIVVAAIAAILAGGWYYLNTQDEKASAELSVAVRTFEAPVRPA
Ga0187770_1045085723300018090Tropical PeatlandVRAETRHQLKEDRFSKATLEAAEKTVDWSQEHKGKLIAAAVAVIVVAAVAFGGWYYINSQDEKASADLSAAVRTLDTPLRPAGTPEQPGYPSFESATARATAARKQFQAIAD
Ga0066662_1256828413300018468Grasslands SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVISAIAFGGWYYLNSQDEKASAELSTAVRTWETPVRPAGVPPQPGSDSFASAQERATA
Ga0193751_118211423300019888SoilKRKPVRAETRHQLKQDRFSRVTFEAAGNAAHWTVEHRAKLIVAVIAVVVIAAIAFGGWYYINAQDEKASAELSTAVRTFETPVRPAGVPPQPGTDSFASAQERATAARKQFQAIVDNGRYGALFCRASFVSTR
Ga0210388_1150093913300021181SoilVRAETRHQLKEDRFSKATFEAAGKTADWTSENQSKVIAGVIAVVVIAAIAFGGWYYYNAQDEKAGGELSTAVRTFETPVRPAGVPPQPG
Ga0210387_1053294013300021405SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGGIAFGGWYYLNSQDEKASAEFSTAVRAWETPLRPAGVPPQPGTDSFASAQERATAARKQFQAIVDKYPRTHTADMAR
Ga0210402_1116698123300021478SoilVRAETRHQLKEDRFSKVTLQAAEKTANWTAENQAKVIAGVVAVVVIAAIAFGGWYYISTQDEKASGELSAAVRTFETPVRPTGVPAQPGFDSFASPQ
Ga0126371_1109267823300021560Tropical Forest SoilVRAETRHSLKEDRFSRTTIRVAESTVHWTVEHQNKLVVGAVALIVIVALGFGGWYYTNSQDERAGLEFGAATRTMETQVRPAGVPAQPGFDSFASSQERATAARKQFQA
Ga0224541_100330713300022521SoilVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASGQERATAARKQFQDIVDK
Ga0224541_100613733300022521SoilVRAETRRQMKQDRFSKVTLEAAENAAHWSEEHKTKLAVIVIAVAVIAAIAFGGWYYVNTQDEKASAGFSTAVRTFETPVRPVGMPAQPGVDSFASTQERNTAARKQ
Ga0224549_103927513300022840SoilVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASGQERATAARKQFQD
Ga0224558_116455813300023090SoilVRAETRHQLKQDRFTKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIGAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFA
Ga0224551_100037813300023259SoilVRAETRHQLKQDRFRKGTLDAAENAAHWTVEHQSKVIAAVIAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGFDSFASMQERATAARKQFQAII
Ga0228598_101508013300024227RhizosphereVRAETRHQLKEDRFSKVTFQAAENAVHWSEEHQSTLIIAAIAVVIVAAIAIGGWYYVNQQDEKASAELSTAVRTFETPIRPAGMPPQPGMDSFASMQE
Ga0208936_102760513300025404PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTAEHQSKVVAAVIAVVVIAAIALGGWYYISQQDEKASSELSTAVRTFETPIRPAGVPAQPGF
Ga0208194_101810313300025412PeatlandVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYINSQDEKASAEFSTAVRTFETPVRPAGVPAQPGYDSFASSGERATAARKQFQEIVDKY
Ga0208323_105685613300025439PeatlandVRAETRHQLKQDRFSKVTIEAAEKTAHWTVEHQSKLIIAVIAVVAIGAMAFVGWYYVNQQNEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASPQERAT
Ga0208190_106861123300025473PeatlandVRAETRHQLKEDRFSKTTLEAAEKTVHWSQEHQSKLIVAAVAVAVIAAIAFGGWYYINSQDEKASLDLTAAVRTLETPLRPAGTPEQPGYASFDSTTARATA
Ga0207646_1012419523300025922Corn, Switchgrass And Miscanthus RhizosphereVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVIGGIAFGGWYYVNSQDEKASAEFSTAVRTWETPVRPAGVPPQPGSDSFASAQ
Ga0209881_117826113300026273SoilVRAETRHQLKQDRFSKVTLEAAENAAHWTVEHQAKLIAAAVAVVVIAAVAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASPQERATAARKQFQAI
Ga0257166_105793213300026358SoilVRAETRHQLKQDRFSKVTFEAAGNAAQWSVEHQSKLIAAVIAVIVIGAIAFGGWYYVNSQDEKASAEFSTAVRTFETPVRPAGVPAQPGTESFASSQERATAARKQFQAIVD
Ga0257179_104486713300026371SoilVRAETRHQLKQDRFSKVTFEAAENAAHWTVEHQSKLIVAAIAVVVIAAIASGGWYYVNTQDEKASAEFSTAVRTFETPVRPAGVPAQPGT
Ga0257167_105308223300026376SoilVRAETRHQLKQDRFSKVTFEAAENAAHWTVEHQSKLIVAAIAVVVIAAIAFGGWYYVNTQDEKASAEFSTAVRTFETPVRPAGVPAQPGTESFASSQERATAARKQ
Ga0257181_101861623300026499SoilVRAETRHQLKQDRFSKVTFEAAENAAHWTVEHQSKLIVAAIAVVVIAAIAFGGWYYVNTQDEKASAEFSTAVRTFETPVRPAGVPAQPGTESFASSQER
Ga0209648_1055471013300026551Grasslands SoilVRAETRHQLKQDRFSKVTLEAAENAAHWTVEHQSKLIAAAVAVVVIAAVAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASPQERATAARKQFQ
Ga0207818_102283823300026868Tropical Forest SoilVRAETRHQLKEDRFSKATIEAAEKTAHWTAEHKSRLIIAAIAAAVIAALAVGGWYYTNSQNEKAGLEFSNATRTMETPIRPAAVPPQPGFPSF
Ga0208696_117726813300027696Peatlands SoilVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASSQER
Ga0209248_1005759413300027729Bog Forest SoilVRAEARHQLKQDRFSKVTIEAAENAAHWTVEHQSKVVAAVIALVVIGAIAFGGWYYVSQQDEKASFDLSGAVRTFETPVRPAGVPAQPGYDSFASTQERATAARKQFQEIVDKY
Ga0209773_1019026313300027829Bog Forest SoilVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQSKVVAAVIALVVIGAIAFGGWYYVSQQDEKASFELSVAVRTFETPVRPAGVPAQPGYDSFASGPERATAARKQ
Ga0209517_1043819223300027854Peatlands SoilVRAETRHQLKQDRFSKVTIEAAENAAHWTVEHQAKLIAAVIAVVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFETPVRPAGV
Ga0209693_1025832013300027855SoilVRAETRHQLKQDRFSKATFEAAGNAANWSEEHKTKLVVIVIAAVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFDTPVRPAGVPAQPEYDSFASSQERATAARKQF
Ga0209169_1006996333300027879SoilVRAETRHQLKQDRFSKATFEAAGNAANWSEEHKTKLVVIVIAAVVIAAIAFGGWYYVNSQDEKASAELSTAVRTFDTPVRPAGVPAQPEYDSFASSQERATAARKQFQAI
Ga0209067_1037345023300027898WatershedsVRAETRHQLKQDGFSKATFEAAEKTVHWTVEHQSKLIAVAIAVIAVAAIVLGGWYYLNTQDEKASGELTTAVRTFDAFLRPAGMPPQPGTESYASLEERATAA
Ga0302294_1010695723300028740FenVRAETRHSLKEDRFSKATFEAAEKTVHWTQEHQSKLIAAAVAVAVIAAIAVGGWYYINSQDEKASLDFTSAVRTFDAQLRPPGSPAQPGVQSFESFALRATAARKEFQG
Ga0302233_1022423913300028746PalsaVRAETRHQLKQDRFSKVTFDAAGNAAHWTAEHQTKLVVALIAVVIVGAIAFGGWYYVNSQDEKASADLSIAVRTFETPIRPAGSPPQPDFPTFASAQ
Ga0302222_1025822113300028798PalsaVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASGQERATAARKQFQDIVDKYPR
Ga0302230_1039075613300028871PalsaVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASGQERATAARKQFQDIVDKYP
Ga0222749_1020261513300029636SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIVVIVIGAIAFGGWYYLNSQDEKASAEFSTAVRTWETPLRPAGVPPQPGTDSFASAQERATAAGKQFQ
Ga0311347_1028560633300029923FenVRAETRHSLKEDRFSKATFEAAEKTVHWTQEHQSKLIAAAVAVAVIAAIAVGGWYYINSQDEKASLDFTSAVRTFDAQLRPPGSPAQP
Ga0311365_1043523533300029989FenVRAETRHSLKEDRFSKATFEAAEKTVHWTQEHQSKLIAAAVAVAVIAAIAVGGWYYINSQDEKASLDFTSAVRTFDAQLRPPGSPAQPGVQSFESLALRATAARKEFQTIVDKYPQT
Ga0311339_1101467413300029999PalsaVRAEARHQLKQDRFSKVTIEAAENAAHWTVEHQSKVVAAVIALVVIGAIAFGGWYYVSQQDEKASFDLSGAVRTFETPVRPAGVPAQPGYDSFASTQERATAARKQFQEIVDKYPH
Ga0311338_1182173423300030007PalsaVRAETRHQLKQDRFSKVTFEAAGNAAHWTAEHQTKLVVALIAVVIVGAIVFGGWYYVNSQDEKASADLSIAVRTFETPIRPAGSPPQPDFPTFASAQERAAAARKQFQEIVDR
Ga0302175_1014705513300030014FenVRAETRHSLKEDRFSKATFEAAEKTVHWTQEHQSKLIAAAVAVAVIAAIAVGGWYYINSQDEKASLDFTSAVRTFDAQLRPPGSPAQPGV
Ga0302306_1019761723300030043PalsaVRAETRHQLKQDRFSKVTFEAAGNAAHWTAEHQTKLVVALIAVVIVGAIAFGGWYYVNSQDEKASADLSIAVRTFETPIRPAGSP
Ga0302176_1005661123300030057PalsaVRAETRHQLKQDRFRKTTLDAAENAAHWTVEHQSKVIVGVIAVVVIAAIAFGGWYYVQTQDEKASAELSTAVRTFEAQVRPAGMPPQPGLDSFASTQ
Ga0302176_1042230613300030057PalsaVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASGQE
Ga0302179_1008843113300030058PalsaVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASGQER
Ga0311370_1102082823300030503PalsaVRAETRRQMKQDRFSKVTLEAAENAAHWSEEHKTKLAVIVIAVAVIAAIAFGGWYYVNTQDEKASAGFSTAVRTFETPVRPAGMPAQPGVDSFASTQERDTAAR
Ga0302183_1013241323300030509PalsaVRAETRHQLKQDRFRKTTLDAAENAAHWTVEHQSKVIVGVIAVVVIAAIAFGGWYYVQTQDEKASAELSTAVRTFEAQVRPAGMPPQPGLDSFASTQERATAARKQFQ
Ga0302183_1026039013300030509PalsaVRAETRHQLKQDRFSKVTFEAAGNAAHWTAEHQTKLVVALIAVVIVGAIAFGGWYYVNSQDEKASADLSIAVRTFETPIRPAGSPPQPDFPTF
Ga0302310_1022358733300030737PalsaVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVATIAVVVIAAIAFGGWYYVNSQDEKASGDLATAVRTFDTPIRPA
Ga0265461_1005551223300030743SoilVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIVAIIAVVVIAAIAFGGWYYVNTQDEKASGDLATAVRTFDTPIRPAGMPAQPEYPSFASAQERATAARKQFQDIVDRKKIKKKIKE
Ga0265328_1036860013300031239RhizosphereVRAETRHQLKQDRFSKVTLEAAENAAHWSEEHKYKLFFAAIVVIIIAAVALGGWYYIDLQDEKASADLSTAVRTLETPVRPAGMPAQPDFESFASTTERATAA
Ga0310686_10626418033300031708SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWTVEHRSKVVAAVIAVVVIGAIAFGGWYYINTQDEKASAEFSTAVRTFETPVRPVGVPAQPGYDSFGSP
Ga0307474_1024789233300031718Hardwood Forest SoilVRAETRHQLKQDRFSKVTLEAAENAAHWSVEHQSKLIAAVIAVIVIGGIAFGGWYYLNSQDEKASAEFSTAVRTWETPLRPAGVPPQPGSDS
Ga0307473_1020819923300031820Hardwood Forest SoilVRAETRHQLKEDRFSKATLHAAEQTVHWTVEHQSKLLIAGIVVAVIALIGFGGWYYMNSQDEKASIELGAATRVLEQQVRPAGVPAQPGFPSFASAQERATEARKQFQAIVDK
Ga0307473_1093287723300031820Hardwood Forest SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSEEHKSTLILAAIAVVVIAAIALGGWYYINSQDEKASAEFSTAVRTWEIPLRPAGVPPQPGSDSFASAQERATAARKQFQAIVDK
Ga0307478_1115213113300031823Hardwood Forest SoilVRAETRHQLKQDRFSKVTFEAAESAAHWSVEHQSKLIAAVIAVIVIGGIAFGGWYYLNSQDEKASAEFSTAVRTWETSLRPAGVPPQPGSDSFASAQERATAARKQFQAIVDKYPR
Ga0307479_1029749133300031962Hardwood Forest SoilVRAETRHQLKQDRFSKVTFEAAGNAAHWSVEHQSKLIAAVIAVIVVGGIAFGGWYYLNSQDEKASAEFSTAVRTWETPLRPAGVPPQPGSDSFASAQERATAARKQ
Ga0335076_1120000713300032955SoilVRAETRHQLKQDRFSKVTFEAAERTANWTAENQAKLIAGVIAVVIVGGIAFAGWYYVNTQDEKASAEFTTAVRTFDTPVRPAGVPAQPGFDSFASIRERAAAAQKQFQAVVDKYPHSHTAEMAR
Ga0326728_1011103043300033402Peat SoilVRAETRHQLKQDRFSKVTLEAAENAAHWSEEHKTKIIVIAIAVIVIAAVAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFAS
Ga0326727_1057501223300033405Peat SoilVRAETRHQLKQDRFSKVTIEAAENAAHWSAEHRSKIIAAVIAVVVIGAIGFGGWYYVNSQDEKASAELATAVRTFETPVRPAGMPAQPGYDSFGSLEER
Ga0326726_1057414213300033433Peat SoilVRAETRHQLKEDRFSKATIQAAEKTVHWTVEHQSKLIAVAIVVIAVAAIAVGGWYYLNLQDEKASGELTAAVRTFDAPVRPAGMPA
Ga0371490_107479913300033561Peat SoilVRAETRHQLKEDRFSKVTMEAAGKTVDWSQEHKGILMAGAVALAIIAAIAVGGWYYVNSQDQKASLDLSVAVRTMETPVRPAGTPEQPGFPSFDSSTARATEARKQFQAIVDKYS
Ga0334847_005467_2_2473300033826SoilVRAETRHQLKQDRFSKVTLEAAEKTVHWSEEHKSKLIVIVLAVVVIAAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPA
Ga0334854_127724_380_6133300033829SoilMKQDRFSKVTLEAAENAAHWSEEHKTKLAVIVIAVAVIAAIAFGGWYYVNTQDEKASAGFSTAVRTFETPVRPAGMPA
Ga0371488_0168602_857_11293300033983Peat SoilVRAETRHQLKQDRFSKVTIEAAENAAHWSEEHKTKLIVIVVAVAVIAAIAVGGWYYINSQDEKASAELSTAVRTLETPIRPAGVPAQPGYD
Ga0326724_0049946_3_3533300034091Peat SoilVRAETRHQLKQDRFSKVTIEAAENAANWSAEHQSKIIAAVIAVVVIGAIAFGGWYYVNTQDEKASAELSTAVRTFETPVRPAGVPAQPGYDSFASTGERATAARKQFQAIVDKYPRT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.