NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F043514

Metagenome / Metatranscriptome Family F043514

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F043514
Family Type Metagenome / Metatranscriptome
Number of Sequences 156
Average Sequence Length 49 residues
Representative Sequence PDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIDKVKG
Number of Associated Samples 140
Number of Associated Scaffolds 156

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.67 %
% of genes near scaffold ends (potentially truncated) 83.33 %
% of genes from short scaffolds (< 2000 bps) 87.18 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.333 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(8.333 % of family members)
Environment Ontology (ENVO) Unclassified
(35.256 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(35.256 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 39.74%    β-sheet: 0.00%    Coil/Unstructured: 60.26%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 156 Family Scaffolds
PF04909Amidohydro_2 10.26
PF09084NMT1 8.97
PF13379NMT1_2 5.13
PF00903Glyoxalase 4.49
PF12728HTH_17 4.49
PF01042Ribonuc_L-PSP 3.85
PF00437T2SSE 2.56
PF00561Abhydrolase_1 2.56
PF06676DUF1178 1.28
PF12681Glyoxalase_2 1.28
PF12146Hydrolase_4 1.28
PF01717Meth_synt_2 1.28
PF02423OCD_Mu_crystall 1.28
PF02604PhdYeFM_antitox 0.64
PF00078RVT_1 0.64
PF02538Hydantoinase_B 0.64
PF05977MFS_3 0.64
PF01522Polysacc_deac_1 0.64
PF01981PTH2 0.64
PF13751DDE_Tnp_1_6 0.64
PF02518HATPase_c 0.64
PF07690MFS_1 0.64
PF01663Phosphodiest 0.64
PF13433Peripla_BP_5 0.64
PF00710Asparaginase 0.64

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 156 Family Scaffolds
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 8.97
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 8.97
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 3.85
COG0146N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunitAmino acid transport and metabolism [E] 1.28
COG0252L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit DTranslation, ribosomal structure and biogenesis [J] 1.28
COG0620Methionine synthase II (cobalamin-independent)Amino acid transport and metabolism [E] 1.28
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 1.28
COG5319Uncharacterized conserved protein, DUF1178 domainFunction unknown [S] 1.28
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.64
COG1990Peptidyl-tRNA hydrolaseTranslation, ribosomal structure and biogenesis [J] 0.64
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.64
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.64
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.64

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms83.33 %
UnclassifiedrootN/A16.67 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459013|GO6OHWN02I9K8RAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria528Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101811771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium971Open in IMG/M
3300000789|JGI1027J11758_11960637Not Available568Open in IMG/M
3300001139|JGI10220J13317_10368667Not Available559Open in IMG/M
3300001199|J055_10033754All Organisms → cellular organisms → Bacteria2349Open in IMG/M
3300003324|soilH2_10079838All Organisms → cellular organisms → Bacteria3278Open in IMG/M
3300003998|Ga0055472_10298184All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300004157|Ga0062590_100037329All Organisms → cellular organisms → Bacteria → Proteobacteria2547Open in IMG/M
3300004463|Ga0063356_100543598All Organisms → cellular organisms → Bacteria1551Open in IMG/M
3300004463|Ga0063356_102760859All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300004463|Ga0063356_105638279All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300004479|Ga0062595_101543349All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300004782|Ga0062382_10291349All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300005294|Ga0065705_11021098All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005295|Ga0065707_10830263All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300005334|Ga0068869_100242332All Organisms → cellular organisms → Bacteria1437Open in IMG/M
3300005338|Ga0068868_101530162All Organisms → cellular organisms → Bacteria → Proteobacteria625Open in IMG/M
3300005353|Ga0070669_101416855All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005356|Ga0070674_100824796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria803Open in IMG/M
3300005366|Ga0070659_101122415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria693Open in IMG/M
3300005444|Ga0070694_101766295All Organisms → cellular organisms → Bacteria → Proteobacteria527Open in IMG/M
3300005547|Ga0070693_101595829All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300005836|Ga0074470_10472720All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1208Open in IMG/M
3300005844|Ga0068862_102010359All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria589Open in IMG/M
3300006175|Ga0070712_101717695All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300006755|Ga0079222_11209155All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria678Open in IMG/M
3300006844|Ga0075428_100043999All Organisms → cellular organisms → Bacteria4908Open in IMG/M
3300006844|Ga0075428_100552122Not Available1231Open in IMG/M
3300006845|Ga0075421_100292409All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300006845|Ga0075421_102115055All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300006852|Ga0075433_11347760Not Available618Open in IMG/M
3300006854|Ga0075425_102269848Not Available604Open in IMG/M
3300006914|Ga0075436_100402326All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria992Open in IMG/M
3300006930|Ga0079303_10238511All Organisms → cellular organisms → Bacteria737Open in IMG/M
3300007004|Ga0079218_11449363All Organisms → cellular organisms → Bacteria738Open in IMG/M
3300007076|Ga0075435_100054007All Organisms → cellular organisms → Bacteria3242Open in IMG/M
3300009012|Ga0066710_101131201All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300009053|Ga0105095_10155201All Organisms → cellular organisms → Bacteria → Proteobacteria1250Open in IMG/M
3300009094|Ga0111539_12841227All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium561Open in IMG/M
3300009147|Ga0114129_10410023All Organisms → cellular organisms → Bacteria → Proteobacteria1784Open in IMG/M
3300009147|Ga0114129_12529412All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300009156|Ga0111538_11345293All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300009156|Ga0111538_11541785All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300009167|Ga0113563_13011146All Organisms → cellular organisms → Bacteria → Proteobacteria570Open in IMG/M
3300009296|Ga0103681_1076330All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1650Open in IMG/M
3300009553|Ga0105249_12257196All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300009777|Ga0105164_10574730All Organisms → cellular organisms → Bacteria559Open in IMG/M
3300009789|Ga0126307_11562203All Organisms → cellular organisms → Bacteria → Proteobacteria536Open in IMG/M
3300009792|Ga0126374_10359003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1002Open in IMG/M
3300010043|Ga0126380_11586050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium583Open in IMG/M
3300010166|Ga0126306_11528094All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300010358|Ga0126370_10670286All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300010359|Ga0126376_11311124All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300010375|Ga0105239_10092365All Organisms → cellular organisms → Bacteria3341Open in IMG/M
3300010376|Ga0126381_104486703All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300010400|Ga0134122_10622341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1001Open in IMG/M
3300010401|Ga0134121_12185554All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300011400|Ga0137312_1103872Not Available504Open in IMG/M
3300011415|Ga0137325_1069116All Organisms → cellular organisms → Bacteria773Open in IMG/M
3300011437|Ga0137429_1076126All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300012159|Ga0137344_1096948All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria545Open in IMG/M
3300012207|Ga0137381_10856262All Organisms → cellular organisms → Bacteria787Open in IMG/M
3300012209|Ga0137379_10937706Not Available770Open in IMG/M
3300012353|Ga0137367_10012477All Organisms → cellular organisms → Bacteria → Proteobacteria6761Open in IMG/M
3300012354|Ga0137366_10662436All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300012360|Ga0137375_10793133All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300012685|Ga0137397_11138865All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300012931|Ga0153915_11472479All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300012931|Ga0153915_11823593Not Available712Open in IMG/M
3300012957|Ga0164303_10848403All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300014265|Ga0075314_1064574All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300014865|Ga0180078_1089194All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300014868|Ga0180088_1009325All Organisms → cellular organisms → Bacteria1421Open in IMG/M
3300014870|Ga0180080_1018189All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300014877|Ga0180074_1068852All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300015241|Ga0137418_10208021All Organisms → cellular organisms → Bacteria1686Open in IMG/M
3300015245|Ga0137409_11325843All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300015359|Ga0134085_10501671All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300015371|Ga0132258_11304248All Organisms → cellular organisms → Bacteria1835Open in IMG/M
3300015374|Ga0132255_104333506All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300016371|Ga0182034_10232316All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300016371|Ga0182034_11219412All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria655Open in IMG/M
3300016387|Ga0182040_11464273All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300016422|Ga0182039_10412452Not Available1149Open in IMG/M
3300016445|Ga0182038_10729917Not Available864Open in IMG/M
3300017939|Ga0187775_10019515All Organisms → cellular organisms → Bacteria1838Open in IMG/M
3300018053|Ga0184626_10149297All Organisms → cellular organisms → Bacteria994Open in IMG/M
3300018056|Ga0184623_10010010All Organisms → cellular organisms → Bacteria4079Open in IMG/M
3300018056|Ga0184623_10257399All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300018061|Ga0184619_10077207All Organisms → cellular organisms → Bacteria1475Open in IMG/M
3300018063|Ga0184637_10176624All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300018076|Ga0184609_10085722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1398Open in IMG/M
3300018079|Ga0184627_10249591All Organisms → cellular organisms → Bacteria935Open in IMG/M
3300018081|Ga0184625_10018186All Organisms → cellular organisms → Bacteria3329Open in IMG/M
3300018083|Ga0184628_10048876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2132Open in IMG/M
3300018429|Ga0190272_10060446All Organisms → cellular organisms → Bacteria2245Open in IMG/M
3300018429|Ga0190272_10976037Not Available805Open in IMG/M
3300018469|Ga0190270_13195500Not Available519Open in IMG/M
3300020018|Ga0193721_1050229All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1097Open in IMG/M
3300020061|Ga0193716_1243060Not Available653Open in IMG/M
3300020084|Ga0194110_10369829All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300020197|Ga0194128_10290394All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300021090|Ga0210377_10025852All Organisms → cellular organisms → Bacteria → Proteobacteria4245Open in IMG/M
3300025160|Ga0209109_10159766All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1130Open in IMG/M
3300025313|Ga0209431_10288797All Organisms → cellular organisms → Bacteria1285Open in IMG/M
3300025319|Ga0209520_10654258All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300025324|Ga0209640_10316997All Organisms → cellular organisms → Bacteria → Proteobacteria1300Open in IMG/M
3300025903|Ga0207680_10929973Not Available623Open in IMG/M
3300025905|Ga0207685_10868855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium500Open in IMG/M
3300025913|Ga0207695_10412042All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1236Open in IMG/M
3300025915|Ga0207693_11248413All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300025922|Ga0207646_10780842All Organisms → cellular organisms → Bacteria → Proteobacteria851Open in IMG/M
3300025925|Ga0207650_10097147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2261Open in IMG/M
3300025931|Ga0207644_11547136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria556Open in IMG/M
3300025937|Ga0207669_10155013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1610Open in IMG/M
3300025938|Ga0207704_11517958All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria575Open in IMG/M
3300025960|Ga0207651_10274771All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1389Open in IMG/M
3300026529|Ga0209806_1154866All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria868Open in IMG/M
3300027462|Ga0210000_1052386Not Available656Open in IMG/M
3300027577|Ga0209874_1129617All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300027637|Ga0209818_1210439All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300027722|Ga0209819_10028413All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium1881Open in IMG/M
3300027815|Ga0209726_10518199All Organisms → cellular organisms → Bacteria → Proteobacteria532Open in IMG/M
3300027831|Ga0209797_10140063All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300027979|Ga0209705_10375428All Organisms → cellular organisms → Bacteria711Open in IMG/M
(restricted) 3300031197|Ga0255310_10118246All Organisms → cellular organisms → Bacteria718Open in IMG/M
(restricted) 3300031237|Ga0255334_1036336All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300031538|Ga0310888_10262559All Organisms → cellular organisms → Bacteria974Open in IMG/M
3300031716|Ga0310813_10298327All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300031716|Ga0310813_10443888Not Available1124Open in IMG/M
3300031720|Ga0307469_10305974Not Available1312Open in IMG/M
3300031854|Ga0310904_10617079All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria742Open in IMG/M
3300031854|Ga0310904_10838825All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300031901|Ga0307406_10099203All Organisms → cellular organisms → Bacteria1980Open in IMG/M
3300031901|Ga0307406_12049025All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300031962|Ga0307479_11432886All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium649Open in IMG/M
3300032126|Ga0307415_100214846All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300032157|Ga0315912_11311386Not Available572Open in IMG/M
3300032211|Ga0310896_10700205All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300032261|Ga0306920_100580431Not Available1660Open in IMG/M
3300032421|Ga0310812_10460818All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300033289|Ga0310914_10362262All Organisms → cellular organisms → Bacteria → Proteobacteria1311Open in IMG/M
3300033289|Ga0310914_10443741Not Available1175Open in IMG/M
3300033408|Ga0316605_11765588All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300033485|Ga0316626_11191840All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300033814|Ga0364930_0237753All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300034115|Ga0364945_0011074All Organisms → cellular organisms → Bacteria2317Open in IMG/M
3300034354|Ga0364943_0144103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium856Open in IMG/M
3300034354|Ga0364943_0417106All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300034417|Ga0364941_043820All Organisms → cellular organisms → Bacteria986Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.05%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.77%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.13%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.13%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.21%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment3.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.56%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.56%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.92%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.28%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.28%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.28%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.28%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.28%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.28%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil1.28%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.28%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.28%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.28%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.64%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.64%
LoticEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic0.64%
GroundwaterEnvironmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater0.64%
WastewaterEnvironmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater0.64%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.64%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.64%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.64%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.64%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.64%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.64%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.64%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.64%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.64%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.64%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.64%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.64%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459013Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cmEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001139Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soilEnvironmentalOpen in IMG/M
3300001199Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assemblyEnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300004808Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1FreshEnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005366Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaGHost-AssociatedOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009296Microbial communities from groundwater in Rifle, Colorado, USA-3A_0.2umEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009777Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking waterEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011437Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2EnvironmentalOpen in IMG/M
3300012159Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT500_2EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014865Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10DEnvironmentalOpen in IMG/M
3300014868Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT830_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014877Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10DEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020197Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015037 Kigoma Deep Cast 65mEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027462Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027577Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031237 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_35cm_T3_129EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031901Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2Host-AssociatedOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032421Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033485Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_AEnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
N57_055984302170459013Grass SoilRKGLEFVIAQTAKSNPKAKGQTPESLHLLEPNVLEEIRRSGFIDKVKK
INPhiseqgaiiFebDRAFT_10181177113300000364SoilVIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKH*
JGI1027J11758_1196063723300000789SoilLELVIEQVAKENTKAKGQTPESLKLMEPSVLEEIKRSGFLEKFKS*
JGI10220J13317_1036866713300001139SoilELVIEQVALENPKAKGQSPESLGLLESSILDEIKRSGFLEKLKR*
J055_1003375423300001199LoticMWGERSRHAEVARTNPKARGQTPESLKLLEPSILEEIKKSGFVEKVK*
soilH2_1007983843300003324Sugarcane Root And Bulk SoilAVIQQLARSVPNARNQTPETLRVFEPSLLDELKRSGFTDSARK*
Ga0055472_1029818413300003998Natural And Restored WetlandsGILSLPDRRGLELVIEQVARENSKAKGQTPESLGLLEPSILDEIKRSGFIEQLKR*
Ga0062590_10003732913300004157SoilRKGLEFIISQVAATNAKAKGQTPESLRLLDGSVLEEIKKSGFIEKFKK*
Ga0063356_10054359833300004463Arabidopsis Thaliana RhizosphereKGLEFILSQLVATHPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKKS*
Ga0063356_10276085923300004463Arabidopsis Thaliana RhizosphereVTVMPDRKGLEFILSQLVPTNPKAKGQTPESLRLLDSSVLDEIKKSGFIEKFKR*
Ga0063356_10563827923300004463Arabidopsis Thaliana RhizosphereGEGVLTLPDRRGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLEEIKKSGFVEKVKG*
Ga0062595_10154334923300004479SoilFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR*
Ga0062382_1029134913300004782Wetland SedimentPDRKGLEFILAQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK*
Ga0062381_1024399523300004808Wetland SedimentHAEGLVAMPDRKGVELVIAQMAKINPKAKGQSVESLRVLDSSILDELKKSGFIDKLRR*
Ga0065705_1102109823300005294Switchgrass RhizosphereVIRQLAKTNPKVKGQTPETLRVFEPSILEEIKKSGFIDKVRK*
Ga0065707_1083026323300005295Switchgrass RhizosphereTLPDRKGIEFVIADTTKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG*
Ga0068869_10024233223300005334Miscanthus RhizosphereMVMPDRKGLEFILSQVAATTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR*
Ga0068868_10153016223300005338Miscanthus RhizosphereLVIEQVALENPKAKGQSPESLGLLESSILDEIKRSGFLEKLKR*
Ga0070669_10141685523300005353Switchgrass RhizosphereVMVLPDRKGLEFIISQVATTNPKAKGQTPESLRLLDGSVLEEIKKGGFIDKFKK*
Ga0070674_10082479623300005356Miscanthus RhizosphereIGQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK*
Ga0070659_10112241523300005366Corn RhizosphereDLLSMPDRRGVELVIGQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK*
Ga0070694_10176629513300005444Corn, Switchgrass And Miscanthus RhizosphereAEGLVVMPDRKGVDLVIAQMAKSNPKAKGQTIESLKVLDSSILDYLKKSGFIDKLRS*
Ga0070693_10159582923300005547Corn, Switchgrass And Miscanthus RhizosphereVARHGDGILSLPDRRGLELVIEQVALENPKAKGQSPESLGLLESSILDEIKRSGFLEKLKR*
Ga0074470_1047272033300005836Sediment (Intertidal)MPDRKEVDLVIAEMAKSNPKARGQTIESLRVLDSSIVDEAKKSGFIENARK*
Ga0068870_1068550613300005840Miscanthus RhizosphereGKHAEDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARK
Ga0068862_10201035913300005844Switchgrass RhizosphereGLLNMPDRKGVELVINQLARTNPKAKGQTPESLRVFEPSILDELRKSGFIDKARR*
Ga0070712_10171769523300006175Corn, Switchgrass And Miscanthus RhizospherePERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR*
Ga0079222_1120915533300006755Agricultural SoilVEAVIQQLARSNPNARGQTPETLRVFEPSLLDDLKRSGFIDSARK*
Ga0075428_10004399973300006844Populus RhizosphereEFILSQVATTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR*
Ga0075428_10055212213300006844Populus RhizosphereEFILSQVATTTPKAKGQTPESLRLLDSSVLDEIKKSGFIEKFKR*
Ga0075421_10029240933300006845Populus RhizosphereKGLELVIAQTAKTNPKAKGQTPESLRLMDASILEEIKKSGFVDKLKR*
Ga0075421_10211505523300006845Populus RhizosphereLTRHGEGILTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG*
Ga0075433_1134776023300006852Populus RhizosphereMDRMGLEFVIAQTAKSNPKAKGQTFESLHLLEPTVLEEISSGFIDKVKK*
Ga0075425_10226984813300006854Populus RhizosphereEQVARENPKAKGQTPESLGLLEPSILDEIKRTGFLERFKQ*
Ga0075436_10040232613300006914Populus RhizosphereLARTNPKAKGQTPETLRVFEPGLLDEIKKSGFIDRLRK*
Ga0079303_1023851113300006930Deep SubsurfaceGDGVMVMPDRKGIEFILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK*
Ga0079218_1144936323300007004Agricultural SoilLEFIISQVATTNPKAKGQTPESLKLLDGSVLEEVKKSGFIDKFKK*
Ga0075435_10005400743300007076Populus RhizosphereDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARK*
Ga0066710_10113120123300009012Grasslands SoilLPDRRGLELVIEQVARENPKAKGQSPESLGLLEPSILDEIKRSGFLEKLKR
Ga0105095_1015520133300009053Freshwater SedimentHGEGVLTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG*
Ga0111539_1284122713300009094Populus RhizosphereILSLPDRRGLELVIEQVARENPKAKGQTPESLGLLEPSILDEIKRSGFLEKLKR*
Ga0114129_1041002343300009147Populus RhizosphereLTLPDRKGIEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG*
Ga0114129_1252941213300009147Populus RhizosphereYLTRHGEGILTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG*
Ga0111538_1134529323300009156Populus RhizosphereDGVMVLPDRKGLEFIISQVATTNSKAKGQTPESLRLLDGSVLEEIKKGGFIDKFKK*
Ga0111538_1154178513300009156Populus RhizosphereMVLPDRKGLEFIISQVALTNAKAKGQTPESLRLLDGSVLEEIKKSGFFDKFK*
Ga0113563_1301114623300009167Freshwater WetlandsVDLVIAQMAKSNPKAKGQTIESLKVLDSSILDYLKKSGFIDKLRS*
Ga0103681_107633023300009296GroundwaterFVISQLAQENPKARGQTPESIGLLEASILEEIKKSGFVEKLLQH*
Ga0105249_1225719613300009553Switchgrass RhizosphereDRKGLEFILSQVAATTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR*
Ga0105164_1057473023300009777WastewaterEMVIAQVAKTTPKAQGQTPESLRLLEPSILEEIKKSGFVEKVK*
Ga0126307_1156220323300009789Serpentine SoilQLAKTNAKAKGQTVESLRVMEPSILDELKKTGFIDKVRK*
Ga0126374_1035900313300009792Tropical Forest SoilGILTLPDRKGIEFVIADTAKTNPKAKGQTPESLRVLDASVLDEIKKSGFIEKVKG*
Ga0126380_1158605023300010043Tropical Forest SoilIEQVARENPRAKGQTPESLGLLEPSILDEIKKSGFIEKLKR*
Ga0126306_1152809413300010166Serpentine SoilRKGIEFILGQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK*
Ga0126370_1067028613300010358Tropical Forest SoilPERRGLELVIEQVARENPKAKGQTPESLGLLEPSILEEIKKSGFIEKLKR*
Ga0126376_1131112413300010359Tropical Forest SoilIVDTTKTNAKAKGQTPESLRVLDGSVLDEIKKSGFLKKVKG*
Ga0105239_1009236543300010375Corn RhizosphereLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK*
Ga0126381_10448670323300010376Tropical Forest SoilLELVIEQVARENPRAKGQTPESLGLLEPSILDEIKKSGFIEELKR*
Ga0134122_1029457613300010400Terrestrial SoilLLSMPDRRGVELVIGQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARKYFLPASICSAC*
Ga0134122_1062234123300010400Terrestrial SoilELVIRQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKVRK*
Ga0134121_1218555423300010401Terrestrial SoilARHGDGILNLPARRGLELVIEQVARENPKANGQSPESLRLLEPSVLAEIRNSGFIEKLKQ
Ga0137312_110387213300011400SoilNPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK*
Ga0137325_106911633300011415SoilIADTAKTNPKAKAQTPDSLRVLDGSVLDEIKKSGFIEKVKG*
Ga0137429_107612623300011437SoilMVLPDRKGLEFIISQVASTNARAKGQTPESLRLLDGSVLDEIKKSGFLDRFK*
Ga0137344_109694823300012159SoilQTAKSNPKAKGQTPESLHLLEPSVLEEIRKSGFIDKVKK*
Ga0137381_1085626213300012207Vadose Zone SoilGVLTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIDRVKG*
Ga0137379_1093770613300012209Vadose Zone SoilEFVIAQTAKSNPKAKGQTPESLHLLEPSVLEEIRRSGFIDKVKK*
Ga0137367_1001247713300012353Vadose Zone SoilPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIDKVKG*
Ga0137366_1066243613300012354Vadose Zone SoilDRKGLEFVIAQTARSNPKAKGQTPESLHLLEPSVLEEIRRSGFIDKVKK*
Ga0137375_1079313323300012360Vadose Zone SoilMPDRKGVELVISQLARTNPKAKGQTPETLRVFEPGILDEIKKSGFIEKARK*
Ga0137397_1113886513300012685Vadose Zone SoilYLAKYGDGVMVLPDRKGLEFIISQVALTNTKAKGQTPESLRLLDGSVLEEINKSGFFDKFK*
Ga0153915_1147247923300012931Freshwater WetlandsPDRKGVEFVIAQLATTNPKAKGQTPETLRVLEPSVLDEIRKSGFIDKLRH*
Ga0153915_1182359323300012931Freshwater WetlandsPDRRGLELVIAQSIRTNAKAKGQTPESLRLLEPSILDEIKKSGFVDRLRK*
Ga0164303_1084840323300012957SoilMVMPDRKGLEFILSQVAATTPKANGQMPESLRLLDSSVLDEIKKSGFIDKFKR*
Ga0075314_106457423300014265Natural And Restored WetlandsQVARENSKAKGQTPESLGLLEPSILDEIKRSGFIEQLKR*
Ga0180078_108919413300014865SoilKYGEGVMVLPERKGLEFIISQVASTNARAKGQTPESLRLLDGSVLDEIKKSGFLDRFK*
Ga0180088_100932543300014868SoilGDGILTLPDRKGIEFVIADTAKTNPKAKGQTPDSLRVLDGSVLDEIKKSGFIEKVKG*
Ga0180080_101818913300014870SoilNPKAKGQTPESLRLLDGSVLEEIRKSGFIDKFKKS*
Ga0180074_106885213300014877SoilKDNPKAKGQTVESLRLLDGSVLDEIRKSGFIDKFKK*
Ga0137418_1020802113300015241Vadose Zone SoilMPDRKGVELVIGQLARTNPKAKGQTPETLRVFEPGLLDEIKKSGFIDKLRK*
Ga0137409_1132584313300015245Vadose Zone SoilKGIEFIISQVTLTNAKAKGQTPESLRLLDGSVLEEIKKSGFFDKFK*
Ga0134085_1050167113300015359Grasslands SoilNPKAKGQSPESLRLMEPSVLEEIKRSGFLEKFKL*
Ga0132258_1130424813300015371Arabidopsis RhizosphereRGLDFILGQVAKDNPKAKGQTAESLRLLDGSVLDEIRKSGFIDKFKK*
Ga0132255_10433350623300015374Arabidopsis RhizosphereGVMVLPDRRGLDFILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKTGFIDKLKK*
Ga0182034_1023231633300016371SoilMLTLPDRRGLEFVIADTAKTNAKAKGQTPESLRVLDRSELDEIRKNGFLEKVKG
Ga0182034_1121941233300016371SoilGDDLLSLPDRKGLEFVIAQTAKSSPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK
Ga0182040_1146427323300016387SoilDTAKTNAKAKGQTPESLRVLDRSELDEIRKNGFLEKVKG
Ga0182039_1041245213300016422SoilGDDLLSLPDRKGLEFVIAQTAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK
Ga0182038_1072991733300016445SoilAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK
Ga0187775_1001951533300017939Tropical PeatlandVELVIAQLAKTNAKAKGQTVESLRVMEPNILDELKRSGFVDKVRK
Ga0184626_1014929713300018053Groundwater SedimentTAKANPKAKGQTPESLRVLDSSVLDEIKKSGFIEKVKG
Ga0184623_1001001033300018056Groundwater SedimentVLILPDRKGLEFVIADTAKTNLKAKGQTPESLRILDSSVLDEIKKSGFLEKVKG
Ga0184623_1025739913300018056Groundwater SedimentEGLLSMPDRRGVELVIGQLARTNPKAKGQTPETLRVFEPSILDELKKSGFIDKARRS
Ga0184619_1007720733300018061Groundwater SedimentQTAKSNPKAKGQTFESLHLLEPTVLEEIRKSGFIDKVKK
Ga0184637_1017662413300018063Groundwater SedimentVLILPDRKGLEFVIADTAKTNLKAKGQTPESLRILDSSVLDEIKKSGVLEKVKG
Ga0184609_1008572213300018076Groundwater SedimentGVELVIRQLARTNPKAKGQTPETLRVFEPSILDELKTSGFIEKARK
Ga0184627_1024959123300018079Groundwater SedimentMWGERSRHAEVARTNPNARGQTPESLRLLEPSVLEEIKRSGFVE
Ga0184625_1001818613300018081Groundwater SedimentVAATTPKAKGQTPESLRLLDASVLDEIKKSGFIDKFKR
Ga0184628_1004887633300018083Groundwater SedimentLSMPDRKGVELVIAQLAKTNPKAKGQTVESLRVMEPSILDEIKKSWFVDKVRR
Ga0190272_1006044613300018429SoilYGDGVMVMPDRKGIEFILGQVAKDNPKAKGQTAESLRLLDGSVLDEIRKSGFIDKFKN
Ga0190272_1097603713300018429SoilRSRSLLSMPDRKGVELVIGQLARTTPKAKGQTPETLRVFEPSILEEIKKSGFIEKVRR
Ga0190270_1319550013300018469SoilKGVELVIAQLAKTNPKAKGQTVESLRVMEPSILDELKKSGFIDKARK
Ga0193713_115595023300019882SoilLGKHAEGLLSMPDRRGVELVIGQLARTNAKAKGQTPETLRVFEPGLLDEIKKSGFIDRLR
Ga0193721_105022923300020018SoilHAEGLLSMPDRRGVELVIGQLARTNAKAKGQTPETLRVFEPGLLDEIKKSGFIDKLRK
Ga0193716_124306013300020061SoilLTLPDRKGLEFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG
Ga0194110_1036982923300020084Freshwater LakeMVMPDRKGIEFILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK
Ga0194128_1029039413300020197Freshwater LakeILGQVAKDNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK
Ga0210377_1002585253300021090Groundwater SedimentMPDRRGVELVIGQLARTNPKAKGQTPETLRVFEPSILDEIRKSGFIDRARR
Ga0209109_1015976623300025160SoilMPDRRGLELVIAQSIRTNAKAKGQTPESLRLLEPSILDEIKKSGFVEKLRK
Ga0209431_1028879723300025313SoilSMPDRRGLDLVIAQSVRTNAKAKGQTPESLRLLEPSILDEIKKSGFVEKLRK
Ga0209520_1065425813300025319SoilHADGLLSMPDRRGLELVIAQSVRTNAKAKGQTPESLRLLEPSILDEIKKSGFIERLRR
Ga0209640_1031699723300025324SoilMPESKGVELVIAQLAKTNPKAQGQTVESLRVMEPSILDELKKSGFIDRVRK
Ga0207680_1092997313300025903Switchgrass RhizosphereYFLAKHGDGLLVMPERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR
Ga0207685_1086885513300025905Corn, Switchgrass And Miscanthus RhizosphereGDGILSLPDRRGLELVIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKR
Ga0207695_1041204213300025913Corn RhizosphereAEDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKARK
Ga0207693_1124841323300025915Corn, Switchgrass And Miscanthus RhizospherePERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR
Ga0207646_1078084233300025922Corn, Switchgrass And Miscanthus RhizosphereTAKTNPKAKGQTPESLRVLDASVLDEIKKSGFIEKVKG
Ga0207650_1009714713300025925Switchgrass RhizosphereDRRGVELVIRQLAKTNPKAKGQSLETLRVFEPSILEEIKNSGFIDKVRK
Ga0207644_1154713613300025931Switchgrass RhizosphereQLAKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKARK
Ga0207669_1015501313300025937Miscanthus RhizospherePDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKVRK
Ga0207704_1151795813300025938Miscanthus RhizosphereKTNPKAKGQTPETLRVFEPSILEEIKKSGFIDKVRK
Ga0207651_1027477113300025960Switchgrass RhizosphereEDLLSMPDRRGVELVIRQLAKTNPKAKGQTPETLRVFEPNILEEIKKSGFIDKARK
Ga0207677_1115970213300026023Miscanthus RhizosphereHAEGLLSMPDRRGVELVIRQLAKTNPKAKGQSLETLRVFEPSILEEIKKSGFIDKARK
Ga0209806_115486623300026529SoilGVELVIGQLARTNAKAKGQTPETLRVFEPGLLDEIKKSGFIDRLRK
Ga0210000_105238623300027462Arabidopsis Thaliana RhizosphereDRRGLEFILSQLVPTNPKAKGQTVESLRLLDASVLDEIQKSGFIDKFER
Ga0209874_112961723300027577Groundwater SandRHGDGILTLPDRKGIDFVIADTAKTNPKAKGQTPESLRVLDGSVLDEIKKSGFIEKVKG
Ga0209818_121043923300027637Agricultural SoilLELVIAQTAKTNPKAKGQTPESLRLMDASVLEEIKKSGFVDKLKR
Ga0209819_1002841313300027722Freshwater SedimentDRKGLEFIISQVPNTNPKAKGQTPESLRLLDSSVLDEIKKSGFLDKFKN
Ga0209726_1051819923300027815GroundwaterKGVEQVIAQLAKTNPKAKGQTVESLRVMEPSILDELKKSGFIDRVRK
Ga0209797_1014006323300027831Wetland SedimentVMVMPDRKGIEFILSQVAKDNPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK
Ga0209705_1037542813300027979Freshwater SedimentVLTLPDRKGLEFVITDTAKTNPKAKGQTPESLRVLDSSVLDEIKKSGVV
(restricted) Ga0255310_1011824623300031197Sandy SoilEGVLTLPDRRGLEFVISDTAKTNPKAKGQTPDSLRVLDGSVLDEIKKSGFIEKVKG
(restricted) Ga0255334_103633613300031237Sandy SoilHGEGVLTLPDRRGLEFVISDTAKTNPKAKGQTPDSLRVLDGSVLDEIKKSGFIEKVKG
Ga0310888_1026255913300031538SoilRKGLEFIISQVATTNPKAKGQTPESLRLLDGSVLEEIKKGGFIDKFKK
Ga0310813_1029832713300031716SoilKGLEFILAQLVSTTPKAKGQTSESLRLLDSSVLDEIKKSGFIDKLKP
Ga0310813_1044388823300031716SoilDMLVMPDRKGIEFILSQVVATNAKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR
Ga0307469_1030597423300031720Hardwood Forest SoilIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKR
Ga0310904_1061707923300031854SoilVIGQLARTNPKAKGQTPETLRVFEPSILDELKKSGFIDKARRS
Ga0310904_1083882523300031854SoilEFILSQVAATTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKFKR
Ga0307406_1009920313300031901RhizosphereVMPDRRGIEFILAQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK
Ga0307406_1204902523300031901RhizosphereATNAKAKGQTPESLRLLDGSVLEEIKKSGFIDKFKK
Ga0307479_1143288613300031962Hardwood Forest SoilVIEQVARENPKAKGQTPESLGLLEPSILDEIKKSGFIEKLKR
Ga0310902_1063303023300032012SoilHAEGLLSMPDRKGVELVIAQLAKTNAKAKGQTLESLRVMEPSILDELKKSGFIDKARK
Ga0307415_10021484623300032126RhizosphereRKGIEFILTQIAKENPKAKGQTAESLRLLDGSVLDEIRRSGFIDKFKK
Ga0315912_1131138623300032157SoilSMPDRKGVELVIGQLARTNPKAKGQTPEMLRVFEPSILDEIRKSGFIDKIRR
Ga0310896_1070020523300032211SoilEFILSQLVPTNPKAKGQTPESLRLLDGSVLDEIRKSGFIDKFKK
Ga0306920_10058043143300032261SoilGLEFVIAQTAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK
Ga0310812_1046081823300032421SoilMPERKGLEFILAQLVSTTPKAKGQTPESLRLLDSSVLDEIKKSGFIDKLKR
Ga0310914_1036226243300033289SoilKTNAKAKGQTPESLRVLDRSELDEIRKNGFLEKVKG
Ga0310914_1044374113300033289SoilDLLSLPDRKGLEFVIAQTAKSNPKAKGQTPESLRLLEPSVLEEIKKGGFIDKVKK
Ga0316605_1176558813300033408SoilILGQVAKENPKAKGQTPESLRLLDSSVLDEIRKSGFIDKFKK
Ga0316626_1119184013300033485SoilVSTNPKAKGQTPESLRLLDASVLDEIKKSGFIDKFQK
Ga0364930_0237753_2_1363300033814SedimentEFVIADTAKTNPKAKGQTPESLRVLDGSVLEEIKKSGFIEKVKG
Ga0364945_0011074_9_1943300034115SedimentLAKYGDDLLSLPDRKGLEFVIAQTAKSNPKAKGQTPESLHLLEPSVLEEIRKSGFIDKVK
Ga0364943_0144103_3_1553300034354SedimentPDRKGVELVIAQLAKTNPKAKGQTVESLRVMEPSILDEIKKIGFVDKVRR
Ga0364943_0417106_337_4923300034354SedimentMPDRKGVELVINQVAKTNPKAKGQTPESLRVFEPSILDELKKSGFIDKARR
Ga0364941_043820_1_1443300034417SedimentKGLEFIISQVAFTNAKAKGQTPESLRLLDGSVLDEIKKSGFLDKFKK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.